Genetically Engineered Food: The Science Behind the Controversy
Transcript of Genetically Engineered Food: The Science Behind the Controversy
![Page 1: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/1.jpg)
Genetically Engineered Food:The Science Behind the
ControversyToby Bradshaw
Washington Research Foundation Professor of Basic Biological Science
Department of BiologyUniversity of Washington
![Page 2: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/2.jpg)
KCPQ 13 News KIRO 7 News
Prof. Kern Ewing (Center for Urban Horticulture, UW)
![Page 3: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/3.jpg)
An hour from now, I hope that you:
• Know more, and perhaps worry less,
about the genetic engineering (GE) of
food plants
• Know more, and perhaps worry more,
about “traditional” food plants
produced by “conventional” breeding
![Page 4: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/4.jpg)
Genetically engineered (GE) or genetically modified (GM)?
• Genetic engineering -- Intentional
transfer of genes (DNA) from one
organism to another by an asexual
process called transformation or
transgenesis
![Page 5: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/5.jpg)
Genetically engineered (GE) or genetically modified (GM)?
• Genetic modification -- Change in genes or genomes by any means, including mutation, chromosome doubling, selection, or hybridization (cross-pollination)
![Page 6: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/6.jpg)
• Why is plant genetic engineering so controversial?
• Why genetically engineer plants?
• How is plant genetic engineering done?
• How was plant breeding done before genetic engineering?
• Does genetic engineering pose unique, unfamiliar risks?
![Page 7: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/7.jpg)
Why is plant genetic engineering so controversial?
• It is an unnatural breaching of the species barrier
• Potential risks to human health
• Potential risks to the environment
• Increased corporate control of food
![Page 8: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/8.jpg)
A polarizing debate
“I happen to believe that this kind of
genetic modification takes mankind
into realms that belong to God and
to God alone.” -- Charles, Prince of
Wales
![Page 9: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/9.jpg)
A polarizing debate
“In all honesty, if scientists don’t play
God, who will?” -- James Watson
![Page 10: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/10.jpg)
Why genetically engineer plants?For exactly the same reasons that we
have genetically modified them by “conventional” methods for centuries
• Increased yield
• Improved quality and variety
• Profit
• Basic research on plant form, function, and evolution
![Page 11: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/11.jpg)
How is genetic engineering done?
![Page 12: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/12.jpg)
“Genetic engineering enables scientists to create plants, animals and micro-organisms by manipulating genes in a way that does not occur naturally.” -- Greenpeace
http://www.ext.nodak.edu/extpubs/plantsci/crops/a1219-3x.jpg
http://www.blc.arizona.edu/INTERACTIVE/cells3l/bacteria2.gif
![Page 13: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/13.jpg)
http://www.nikkei-bookdirect.com/science/beyond-discovery/transgenics/closeup04d.html
![Page 14: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/14.jpg)
http://www.mun.ca/biology/scarr/Fig15_transgenic_tobacco.gif
Griffiths et al. 1996
![Page 15: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/15.jpg)
How was genetic modification done in the 10,000 years
before genetic engineering?• Artificial selection of spontaneous
mutations and spontaneous hybrids
• Artificial hybridization, including “unnatural” wide crosses between species and genera
• Mutations induced by radiation or DNA-damaging chemicals
![Page 16: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/16.jpg)
The power of “unnatural” selection
http://imagecache2.allposters.com/images/pf/PHD0308_f.jpg
http://www.wsdot.wa.gov/environment/biology/usfw-list/images/wolf.jpg
![Page 17: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/17.jpg)
Here is the wolf. What is the chihuahua?
![Page 18: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/18.jpg)
What is the chihuahua?
![Page 19: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/19.jpg)
Here is the wolf. What is the chihuahua?
http://www.first-nature.com/flowers/images/brassica_oleracea1.jpg
![Page 20: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/20.jpg)
What is the chihuahua?
![Page 21: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/21.jpg)
Here is the wolf. What is the chihuahua?
http://www.primitiveways.com/Images2/teosinte.jpg
![Page 22: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/22.jpg)
What is the chihuahua?
![Page 23: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/23.jpg)
Here is the wolf. What is the chihuahua?
![Page 24: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/24.jpg)
What is the chihuahua?
![Page 25: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/25.jpg)
Crops are as out of place on a natural landscape as the Grand Coulee Dam or a nuclear power plant.
http://www.fema.gov/graphics/fima/damsafe/grand-coulee-dam-security-wa.jpg
http://www.glue.umd.edu/~sliang/validation/field.jpg
![Page 26: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/26.jpg)
• Humans have harnessed (critics might say “subverted”) natural processes (hydrological cycle, gravity, nuclear fission, mutation, hybridization, genetic engineering) to concentrate energy and food production.
• Concentrated production of energy and food make modern civilization possible, but has health and environmental risks.
![Page 27: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/27.jpg)
The question is not whether plant genetic engineering has risks –as with all technologies, it does.
![Page 28: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/28.jpg)
The question we should be asking is:DOES PLANT GENETIC
ENGINEERING POSE ANY UNIQUERISKS – RISKS WITH WHICH WE
ARE NOT ALREADY FAMILIAR AFTER 10,000 YEARS OF
GENETICALLY MODIFYING PLANTS THROUGH
“CONVENTIONAL” BREEDING?
![Page 29: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/29.jpg)
Is genetic engineering unique in breaching the species barrier?
• Rutabaga
• Canola (oilseed rape)
• Triticale (Triticum x Secale)
• Strawberry
• Wheat, potato, tomato, tobacco, cotton ...
![Page 30: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/30.jpg)
Is genetic engineering unique in potentially introducing toxins?
http://www.rogerlovejoy.co.uk/elf/invasive/gt-hogweed/images/blister.jpg
![Page 31: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/31.jpg)
Plant chemical warfare
• Chili pepper
• Potato
• Oilseed rape
• Cassava
• Castor bean
![Page 32: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/32.jpg)
Plant carcinogens
• Coffee contains >1000 chemical compounds. Of 28 tested, 19 cause cancer in rats and mice.
• Plants produce “natural” pesticides. Of 71 tested, 37 cause cancer in rats and mice. One of these is pyrethrum, perhaps the most widely used insecticide in organic farming.
![Page 33: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/33.jpg)
Is genetic engineering unique in potentially introducing allergens?
Genetic engineering
• Brazil nut protein gene soybean
“Traditional” agriculture
• Peanuts
• Wheat gluten
![Page 34: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/34.jpg)
Does genetic engineering pose unique environmental risks?
• Herbicide resistant crops have been produced by genetic engineering (e.g., “Roundup Ready”) and by traditional breeding. They have the same:
• benefits (no-till weed control)
• risks (evolution of resistant weeds, dependence on chemical weeding)
![Page 35: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/35.jpg)
Does genetic engineering pose unique environmental risks?
• Insect resistant crops have been produced by genetic engineering (e.g., “NewLeaf” potato) and traditional breeding. They have the same:
• benefits (plant protection, reduced reliance on sprayed insecticides)
• risks (evolution of resistant insects)
![Page 36: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/36.jpg)
• Not everything that is natural is good for you.
• Not everything that is good for you is natural.
• We have 10,000 years of experience with many of the risks posed by genetic engineering.
• In plant breeding, it is the properties of the PRODUCT that determine benefits and risks, not the process by which it was made.
![Page 37: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/37.jpg)
Are there products of plant genetic engineering that may
be of unique concern?
• Transgenes encoding common allergens from nuts, wheat, crustaceans, mollusks, or eggs if introduced into staple food crops
• Pharmaceutical proteins or other drugs in food crops
![Page 38: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/38.jpg)
Are there products of plant genetic engineering that may increase public acceptance?
• Improved nutrient content and flavor
• Edible vaccines
• Non-food plants engineered for production of industrial raw materials
• Crops engineered for low-input, sustainable agriculture
![Page 39: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/39.jpg)
GE in perspective• In the U.S., we have cut down,
burned, and plowed 300 million acres of native ecosystems to grow just four crops – corn, soybeans, wheat, and cotton –none of which is native to the U.S.
![Page 40: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/40.jpg)
GE in perspective• Introduction of these four non-
native crops brought ca. 200,000 “new” and untested genes into the U.S.
• Genetic engineering has added about a dozen “new” genes, all of which have been tested extensively.
![Page 41: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/41.jpg)
But isn’t there something creepy about putting flounder
genes into a tomato?
Flounder PRGLKMSSTFIGNSTAIQELFKRMSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMND
Human PRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMND
Potato PTGLKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMND
* ****::**:****:***:*:*:************************************
![Page 42: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/42.jpg)
“Ignorance more frequently begets confidence than does knowledge: it is those who know little, and not those who know much, who so positively assert that this or that problem will never be solved by science.” -- Charles Darwin
![Page 43: Genetically Engineered Food: The Science Behind the Controversy](https://reader036.fdocuments.net/reader036/viewer/2022071602/613d5df8736caf36b75c7cef/html5/thumbnails/43.jpg)
You are not what you eat.YOU ARE WHAT YOU
KNOW !