Understanding Bioinformatics
Sequence motifs, information content, logos, and HMMs Morten Nielsen, CBS, BioCentrum, DTU.
Sequence Alignment and Phylogeny Dr Peter Smooker, [email protected] B I O I N F O R M A T I C S | | | | | | | B I O L O G Y - M A T H - S.
Bioinformatica 27-10-2011-t4-alignments
Bioinformatica
Scoring the Alignment of Amino Acid Sequences Constructing PAM and Blosum Matrices.
Lecture invitation 8.4. 2015 AI, 14:30 (we will finish earlier this day, at 14:20) How Lab IT Accelerates Pharmaceutical Research For more information,
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: 123456789…. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
BLAST : Basic local alignment search tool B L A S T !
Computational searches of biological sequences
Tutorial 4 Substitution matrices and PSI-BLAST 1.
Molecular evolution, cont. Comparing estimation methods. Application to human and mouse sequences
