Fundamental Study of Physical and Biochemical
Alterations to Casein Micelles during Milk
Evaporation and Ultrafiltration
Zhe Liu
Submitted in total fulfilment of the requirements for the degree of
Doctor of Philosophy
December 2013
Department of Chemical & Biomolecular Engineering
The University of Melbourne
Victoria, Australia
i
Abstract
Casein represents 80% of the protein in milk, which is predominantly present in the
form of hydrated colloidal assemblies known as casein micelles. It is one of the most
important components in milk system that has significant influence on the properties of
dairy products. It is also the main component of several highly value-added dairy
products (such as milk protein concentrate (MPC) and milk protein isolate (MPI)). The
objective of this work was to investigate the physico-chemical alterations of skim milk
(specifically casein and casein micelles) during processing (evaporation and
ultrafiltration) and to understand the processes at a fundamental level in order to
determine the effect of the processing parameters on the properties of casein micelles
and milk products to ultimately improve the efficiency of dairy processing.
Evaporation in the dairy industry is used for concentrating products such as milk and
whey while it is also used as a preliminary step to drying. Milk products intended for
milk powder are normally concentrated to a final concentration of 40 – 50 % total solids
before going to the spray dryer. To reduce heat impact on the heat sensitive components
in milk system, evaporation takes place under vacuum at relatively low temperature. In
this study, skim milk was concentrated by vacuum evaporation to concentration 12 – 45 %
total solids content. The hydration, composition and size of the casein micelle were
investigated. The results show that during evaporation, both inter and intra micelle
water were removed from the milk system and preferentially the serum water. The
alterations were rapidly reversible but not completely.
Ultrafiltration is a process in which semi-permeable membranes are used to separate
components in a fluid on the basis of size. It is widely used in the dairy industry for
recovering, fractionating and concentrating proteins in milk process streams. In this
study, skim milk was concentrated by ultrafiltration up to four folds at different
processing temperatures. The changes of milk and caseins were discussed and different
processing conditions were compared.
Casein micelles and colloidal calcium phosphate are affected contemporaneously by the
system temperature. A comprehensive physico-chemical investigation of the dynamic
responses of casein micelles to changes in temperature was performed in the range
ii
10 °C – 40 °C in real time. The temperature effects on casein micelles were consistent
with the results of the ultrafiltration processing at different temperature.
Lactose is an important energy source in milk system, and it also regulates the water
content of milk during secretion. In evaporation and UF concentration, micellar water
behaved differently: the micelle hydration decreased during evaporation, whilst
increased during UF concentration. Lactose is highly responsible for this difference, and
the lactose effects on casein micelles were studied in this work.
This study investigates the temperature dependent dynamics of casein micelles, and
physico-chemical behaviours under different lactose concentrations, evaporation or
ultrafiltration conditions. The results show that casein micelles and colloidal calcium
phosphate (CCP) are dynamic entities which are significantly affected by processing.
The results have important implications for improving milk processing in dairy industry.
iii
Declaration
This is to certify that
the thesis comprises only my original work towards the PhD,
due acknowledgement has been made in the text to all other material used,
the thesis is less than 100,000 words in length, exclusive of tables, maps,
bibliographies and appendices.
Dylan Zhe Liu
iv
Preface
Sections of this thesis have been published in the following journal papers:
1 Liu, D. Z., Dunstan, D. E., & Martin, G. J. O. (2012). Evaporative concentration of
skimmed milk: Effect on casein micelle hydration, composition, and size. Food
Chemistry, 134 (3), 1446-1452.
2 Liu, D. Z., Weeks, M. G., Dunstan, D. E., & Martin, G. J. O. (2013). Temperature-
dependent dynamics of bovine casein micelles in the range 10 – 40 °C. Food Chemistry,
141 (4), 4081-4086.
3 Liu, D. Z., Weeks, M. G., Dunstan, D. E., & Martin, G. J. O. (2014). Alterations to the
composition of casein micelles and retentate serum during ultrafiltration of skim milk at
10 °C and 40 °C. International Dairy Journal, 35 (1), 63-69.
Note: Further journal paper presenting the remainder of the work in this thesis is
currently in preparation as:
Liu, D. Z., Weeks, M. G., Dunstan, D. E., & Martin, G. J. O. (2014). Lactose effects on
casein micelles: The regulator of micelle hydration.
v
Acknowledgements
First of all, I want to express my heartfelt gratitude to my supervisors, Professor David
Dunstan and Dr. Greg Martin, for giving me direction, invaluable advice, support and
encouragement. The knowledge and experience I gained from this study was invaluable.
Also, I like to express my deepest gratitude to Dr. Ian Mckinnon for his help, advice and
providing access to the DWS and UF system.
I would like to thank Dr. Michael Weeks of Dairy Innovation Australia for advice and
feedback and the regular meetings we had for keep me on track. I am also thankful to Dr.
Lydia Ong for her advice and help. I would like to thank Dr. Jayani Chandrapala who
provided a lot of help. I would also like to thank Ms. Alita Anastasia Aguiar for her
assistance with the AAS. Also, I thank Annmaree Sharkey for sorting out my progress
forms.
Equally important are my fellow lab- and office-mates, who made the three years here
more interesting and less stressful. Thanks a lot for their help and support.
Thanks to DIAL, Australian Research Council (ARC), Department of Chemical and
Biomolecular Engineering and the University of Melbourne for financial assistance.
Finally, I would like to thank my family and friends who helped and encouraged me on
this journey.
vi
Table of Contents Abstract .............................................................................................................................. i
Declaration....................................................................................................................... iii
Preface ............................................................................................................................. iv
Acknowledgements .......................................................................................................... v
Index of Figures ................................................................................................................ x
List of Tables .................................................................................................................. xii
Nomenclature................................................................................................................. xiii
1 Introduction ................................................................................................................... 1
2 Literature Review .......................................................................................................... 4
2.1 Properties of Milk ................................................................................................... 4
2.1.1 Water ............................................................................................................... 4
2.1.2 Lactose ............................................................................................................. 5
2.1.3 Milk Fat ........................................................................................................... 6
2.1.4 Vitamins .......................................................................................................... 6
2.1.5 Minerals ........................................................................................................... 7
2.1.6 Proteins ............................................................................................................ 8
2.2 Casein and Casein micelles .................................................................................. 11
2.2.1 Caseins ........................................................................................................... 11
General Information ............................................................................................... 11
Casein Properties .................................................................................................... 14
2.2.2 Casein Micelles ............................................................................................. 16
Formation and digestion of casein micelles ........................................................... 17
Casein micelle structure.......................................................................................... 18
Casein micelle properties........................................................................................ 23
Alterations to casein micelle during processing ..................................................... 28
2.3 Summary ............................................................................................................... 34
vii
3 Experimental Techniques and Applications ................................................................ 35
3.1 Overview of experimental approach..................................................................... 35
3.2 Milk viscosity and the determination of casein micelle volume faction .............. 36
3.3 Turbidity ............................................................................................................... 38
3.4 Dynamic Light Scattering ..................................................................................... 40
3.5 Ultracentrifugation................................................................................................ 42
3.6 Calcium measurement .......................................................................................... 48
3.7 Lactose measurement ........................................................................................... 49
3.8 SDS-PAGE and Native-PAGE ............................................................................. 49
4 Evaporative concentration of skim milk: Effect on casein micelle hydration,
composition, and size ..................................................................................................... 50
4.1 Introduction .......................................................................................................... 50
4.2 Materials and methods .......................................................................................... 51
4.2.1 Skim milk and concentrated skim milk samples ........................................... 51
4.2.2 Casein micelle hydration rate and mass balance ........................................... 52
4.2.3 SDS-PAGE .................................................................................................... 52
4.2.4 Calcium measurement ................................................................................... 52
4.2.5 Turbidity and viscosity measurements .......................................................... 53
4.2.6 Particle size analysis ...................................................................................... 53
4.3 Results .................................................................................................................. 54
4.3.1 Direct measurements of concentrated milk ................................................... 54
4.3.2 Measurements of re-diluted concentrated milk ............................................. 57
4.4 Discussion ............................................................................................................. 62
4.4.1 Hydration of casein micelles ......................................................................... 62
4.4.2 Composition of casein micelles ..................................................................... 63
4.4.3 Size of casein micelles ................................................................................... 64
4.5 Conclusions .......................................................................................................... 66
viii
5 Temperature-dependent dynamics of bovine casein micelle in the range 10-40 °C ... 67
5.1 Introduction .......................................................................................................... 67
5.2 Materials and methods .......................................................................................... 70
5.2.1 Skim milk samples ........................................................................................ 71
5.2.2 Fraction of casein by centrifugation .............................................................. 71
5.2.3 Casein micelle hydration and serum calcium measurement .......................... 71
5.2.4 Determination of casein micelle volume fraction.......................................... 72
5.2.5 Dynamic light scattering ................................................................................ 72
5.2.6 Turbidity and pH measurement ..................................................................... 72
5.2.7 Temperature kinetic studies ........................................................................... 73
5.3 Results and discussion .......................................................................................... 73
5.3.1 Micelle equilibrium as a function of temperature ......................................... 73
5.3.2 Micelle dynamics ........................................................................................... 78
5.4 Conclusions .......................................................................................................... 80
6 Alterations to the composition of casein micelles and retentate serum during
ultrafiltration of skim milk at 10 °C and 40 °C .............................................................. 81
6.1 Introduction .......................................................................................................... 81
6.2 Materials and methods .......................................................................................... 82
6.2.1 Skim milk samples ........................................................................................ 83
6.2.2 Ultrafiltration and pH measurements ............................................................ 83
6.2.3 Casein micelle separation and hydration ....................................................... 84
6.2.4 Protein and calcium quantification ................................................................ 84
6.2.5 Dynamic light scattering ................................................................................ 84
6.2.6 Determination of lactose content ................................................................... 85
6.3 Results and discussion .......................................................................................... 85
6.4 Conclusions .......................................................................................................... 95
7 Lactose effects on casein micelles: The regulator of micelle hydration...................... 96
ix
7.1 Introduction .......................................................................................................... 96
7.2 Materials and methods .......................................................................................... 97
7.2.1 Skim milk and MPC solutions ....................................................................... 97
7.2.2 Volume fraction and pH ................................................................................ 97
7.2.3 Casein micelle hydration ............................................................................... 97
7.2.4 Dynamic light scattering ................................................................................ 98
7.2.5 Casein and Calcium quantification ................................................................ 98
7.2.6 Determination of lactose content ................................................................... 98
7.3 Results and discussion .......................................................................................... 98
7.3.1 Lactose effects on casein micelles in MPC solutions .................................... 98
7.3.2 Lactose effects in skim milk ........................................................................ 101
7.3.3 Lactose effects during milk processing ....................................................... 104
7.4 Conclusions ........................................................................................................ 105
8 Conclusions and recommendations ........................................................................... 106
8.1 Conclusions ........................................................................................................ 106
8.2 Recommendations for Future Research .............................................................. 110
References .................................................................................................................... 112
Appendix: Physical properties of whole bovine milk (Sherbon, 1988; Singh et al., 1997;
Walstra et al., 1984) ...................................................................................................... 126
x
Index of Figures
Figure 1.1 Application of membrane separation processes in dairy industry .................. 2
Figure 2.1 Amino acid sequences of the bovine αs1-, αs2-, β- and κ-caseins. ................. 12
Figure 2.2 Protocols for casein whey co-precipitates ..................................................... 16
Figure 2.3 SEM image of a casein micelle ..................................................................... 17
Figure 2.4 Formation of casein micelles (CM) in Golgi vesicles (G). Top, a Golgi
vesicle discharged its contents into the alveolar lumen; Bottom, One casein micelle
presents in lumen. ........................................................................................................... 18
Figure 2.5 Representation of the submicelle model of casein micelles proposed by
Walstra ............................................................................................................................ 20
Figure 2.6 Schematic diagram of casein micelle assembly according to dual-binding
model reproduced from (Horne, 2003) ........................................................................... 21
Figure 2.7 Representation of the nanocluster model ...................................................... 22
Figure 2.8 Schematic picture of casein micelle sponge model....................................... 23
Figure 2.9 Outline of some processes used to produce milk protein products ............... 29
Figure 3.1 Composition of milk, evaporative concentrates and UF retentates separated
by ultracentrifugation ..................................................................................................... 36
Figure 3.2 Simplified schematic of dynamic light scattering set-up .............................. 41
Figure 3.3 Geometry of Ultracentrifuge rotor 90 Ti ....................................................... 43
Figure 3.4 The amount of soluble caseins in the supernatants of original skim milk after
different period of ultracentrifugation. ........................................................................... 45
Figure 3.5 The amount of soluble caseins in the supernatants of ultrafiltered CF4
retentates and evaporative concentrated skim milk (42% TS).. ..................................... 47
Figure 4.1 Analyses performed on evaporative concentrates ......................................... 51
Figure 4.2 Hydration and water content of casein micelles during evaporation. ........... 55
Figure 4.3 Total serum calcium and casein in the supernatant during evaporation. ...... 56
Figure 4.4 Turbidity and average micelle size of rediluted evaporative concentrated milk
........................................................................................................................................ 58
Figure 4.5 Total serum calcium and casein in the supernatants of rediluted evaporative
concentrates.. .................................................................................................................. 59
xi
Figure 4.6 Relative alterations of average micelle size, viscosity, pH, turbidity and
soluble caseins of rediluted evaporative concentrates. ................................................... 61
Figure 4.7 Casein micelle alterations during skim milk evaporative concentration and
re-dilution. ...................................................................................................................... 66
Figure 5.1 Analysis performed on fresh skim milk as a function of temperature .......... 70
Figure 5.2 Equilibrium state of skim milk as a function of temperature. ....................... 74
Figure 5.3 SDS-PAGE image of soluble milk proteins in ultracentrifugation (75940 g)
supernatants at different temperatures. ........................................................................... 75
Figure 5.4 Relative amount of casein present as soluble casein, ‘small’ casein micelles
(CM), ‘medium’ CM, or ‘large’ CM in skim milk as a function of temperature as
determined by different centrifugation. .......................................................................... 77
Figure 5.5 Dynamics of skim milk warmed and cooled between 10 and 20 °C (A), and
10 and 40 °C (B).. ........................................................................................................... 79
Figure 6.1 Analyses performed on UF retentates and permeates ................................... 83
Figure 6.2 Native-PAGE analysis of UF permeates and the supernatants of the
ultracentrifuged retentates (60 min ultracentrifugation). ................................................ 86
Figure 6.3 Native-PAGE analysis of whey protein content in the serum of retentates
from ultrafiltered skim milk.. ......................................................................................... 87
Figure 6.4 Alterations to the casein micelle and serum compositions of UF retentates as
a function of volumetric concentration factor (CF).. ...................................................... 89
Figure 6.5 Alterations to skim milk after UF concentration to CF2 at 10 °C or 40 °C
followed by concentration to CF3 at 40 °C or 10 °C.. ................................................... 93
Figure 6.6 Casein micelle alterations during UF ............................................................ 95
Figure 7.1 Pelletization of casein micelles and composition of the serum of MPC 85
disolved in water (A, B) and SMUF (C, D) as a function of lactose concentration. ...... 99
Figure 7.2 Relative turbidity of MPC 85 solutions as a function of lactose concentration.
...................................................................................................................................... 101
Figure 7.3 Alterations of casein micelles and serum of skim milk as a function of
lactose concentration. ................................................................................................... 103
Figure 7.4 Micelle hydration alterations in response to lactose concentration. ........... 105
Figure 8.1 A schematic overview of the effect of evaporative concentration and
ultrafiltration on casein micelles as revealed through this study .................................. 106
xii
List of Tables
Table 2.1 Composition of bovine milk (Walstra & Jenness, 1984) ................................. 4
Table 2.2 Distribution of salts between the soluble and colloidal phase of milk (20 °C,
pH 6.77) (Davies & White, 1960) .................................................................................... 7
Table 2.3 Major bovine milk proteins and some of their biological functions (adapted
from (Korhonen & Pihlanto, 2007)) ................................................................................. 8
Table 3.1 Pelleted micelle hydration of skim milk after different period of
ultracentrifugation .......................................................................................................... 46
Table 3.2 Pelleted micelle hydration of concentrated milk samples after different period
of ultracentrifugation ...................................................................................................... 48
Table 4.1 Rehydration of casein micelles upon redilution of concentrated skim milk.
Comparison of pelleted solids, pelleted water, and pellet hydration for ultracentrifuged
skim milk and a corresponding sample of concentrate (34% TS) rediluted to 8.7% TS.57
Table 5.1 Fractionation of definite sized micelles .......................................................... 71
Table 6.1 Micelle and mineral alterations during UF. .................................................... 91
Table 7.1 Micellar lactose and micelle hydration in MPC 85 ...................................... 100
Table 7.2 Micellar lactose and micelle hydration in Skim milk ................................... 102
xiii
Nomenclature
A Baseline at infinite time
a Particle radius
aw Water activity
Abs Spectrophotometer value of absorbance
B Amplitude
Csca Light scattering cross-section
cvi Volume concentration
D Translational diffusion coefficient
d Effective Stokes diameter
dave Average pelleted casein micelle size
d (H) Hydrodynamic diameter
g Gravitational acceleration
H Effective setting height
Have Average centrifugation path length of casein micelles
I Incident light intensity
I0 Transmitted light intensity
k Boltzmann’s constant
L Pathlength of the light through the scattering suspension
Lc Pathlength of the light through cuvette
n Number concentration
Qsca Scattering coefficient
xiv
q Scattering vector
T Absolute temperature
t Time delay
te Effective setting time
Vg Terminal setting velocity
Vi Voluminosity
τ Turbidity
τa Turbidity for mono dispersed spherical particles with radius ‘a’
τshear Shear stress
τsample Turbidity of the re-diluted milk concentrate sample
τskim Turbidity of original skim milk
τsample fat Turbidity of the re-diluted milk concentrate sample diluted in
EDTA multiplied by 10 to account for the dilution
τskim fat Turbidity of the original skim milk diluted in EDTA
multiplied by 10 to account for the dilution
ηc Coefficient of viscosity
η Viscosity
ηcp Viscosity of the continuous phase
η0 Coefficient of viscosity of the portion in the fluid
consisting of water and low molecular mass species
φ Volume fraction
φd Volume fraction of all dispersed particles
xv
φmax Hypothetical maximum volume fraction
φf Volume fraction of fat
φc Volume fraction of casein
φw Volume fraction of whey proteins
φl Volume fraction of lactose
φ spherical Volume fraction of spherical particle
γ Shear rate
θ Light scattering testing angle
Δρ Density difference between the solid particle
and suspending fluid
AAS Atomic absorption spectroscopy
BSA Bovine serum albumin
CCP Colloidal calcium phosphate
CF Concentration factor
CM Casein micelle
DLS Dynamic light scattering
MF Microfiltration
MPC Milk protein concentrate
MPI Milk protein isolate
NF Nanofiltration
PCS Photon correlation spectroscopy
RI Refractive index
RO Reverse osmosis
xvi
SEM Scanning electron microscopy
SMP Skim milk powder
TCA Trichloroacetic acid
TEM Transmission electron microscopy
TS Total solids
UF Ultrafiltration
UHT Ultra high temperature processing
WPC Whey protein concentrate
1
1 Introduction
Fresh milk and dairy products are widely used high nutritional value human food. Since
the first cows arrived in Australia in the 1700’s, the Australian dairy industry has
developed both its size and range of products with a large export component. Today,
with a gross value of over $4 billion annually (in 2011), it is the third largest
agricultural industry in Australia (PricewaterhouseCoopers, 2011). Australia exports
nearly half of its milk products, which accounts for 10% of the global market. This
makes Australia the third largest exporter in the world (PricewaterhouseCoopers, 2011).
Importantly, there are still significant opportunities for growth of the Australian dairy
industry as the global market demand continues to increase (DairyAustralia, 2013).
As most milk products are transported and stored, proper processing is needed to meet
microbiologically stable requirement. Reducing water activity by concentration and
drying is one of the most widely used techniques. Since the nineteenth century,
evaporation has been used in the food industry for liquid concentration. In the dairy
industry, evaporation is an important process used for concentration of different milk
products and it is also used as a preliminary step to spray drying (Henning, Baer,
Hassan & Dave, 2006). As most milk products are heat sensitive, evaporation is
conducted at low temperatures under vacuum for short times in order to reduce thermal
degradation and flavour changes (Heldman & Hartel, 1998). However, alterations of
physicochemical state and functional properties of milk products still take place during
milk evaporation.
Membrane filtration (Figure 1.1) is a more recent technology used to fractionate and
concentrate solutes on the basis of size. Since the beginning of the 1970s, the following
categories of membrane filtration have been adapted for the dairy industry to serve
different purposes (TetraPak, 1995):
Reverse Osmosis (RO) is used for dehydration of whey, ultrafiltration permeates and
retentates by removal of water.
Nanofiltration (NF) is used for desalination of whey, ultrafiltration permeate or retentate
by partial removal of monovalent ions like sodium and chlorine.
2
Ultrafiltration (UF) is typically used for concentration and standardization of milk
proteins which is intended for cheese, yoghurt and other products.
Microfiltration (MF) is primarily used for removing bacteria from skim milk, whey and
brine, although sometimes it is also used for whey defatting.
Figure 1.1 Application of membrane separation processes in dairy industry (adapted
from Dairy processing handbook (TetraPak, 1995))
Among these filtration techniques, UF is used widely in the dairy industry to produce
several highly value-added products such as milk protein concentrate (MPC) and milk
protein isolate (MPI). In the application of UF, water, soluble minerals and lactose pass
through membranes thereby concentrating whey proteins and casein to achieve a final
protein concentration. However, the physical and biochemical alterations of milk during
UF are not yet understood in sufficient detail.
Casein micelles comprise most of the protein in milk system. Four different casein
proteins and nanoclusters of colloidal calcium phosphate (CCP) exist as micelles in a
state of dynamic equilibrium (Walstra, 1999) with the proteins and mineral species in
milk serum (Holt, 2004). The properties of the casein micelles (such as micelle
hydration and size, and protein distribution), and their interactions with other milk
components are sensitive to alterations in process variables such as temperature, pH and
concentration (Martin, Williams & Dunstan, 2007). However, there is currently only
3
limited knowledge about how casein micelles behave during milk evaporation and UF
(Karlsson, Ipsen & Ardö, 2007; Martin, Williams & Dunstan, 2010; Singh, 2007).
Lactose, a disaccharide of β-1,4-linked glucose and galatose, is the major carbohydrate
in milk. The presence of lactose regulates the final concentration of caseins in milk
during secretion in the Golgi vesicles (Jenness & Holt, 1987) and also alters the casein
micelle structure (Farrell Jr, Malin, Brown & Qi, 2006). During evaporation and UF,
lactose is either concentrated or removed from milk, however, detailed information
about the lactose effects on casein micelles is currently limited.
The major theme of this thesis is the systematic study of casein micelle alterations
during milk evaporation and UF processing to investigate the effects of casein and
lactose on the physico-chemical properties of casein micelles. The data and information
presented here sheds new light on the physicochemical behaviour of casein micelles
during milk processing, which will importantly help improve the performance of milk
evaporation and UF and the functional properties of the final products.
In this thesis, Chapter 2 provides general information about milk and reviews the
existing literatures on casein protein and casein micelles. Emphasis is placed on the
casein micelle structure and casein micelle alterations in response to processing and
changes in environmental conditions. The experimental techniques and protocols
applied in this work are described in Chapter 3. The first experimental section, Chapter
4, investigates the evaporation effects on casein micelle hydration, composition and size
distribution, and their reversibility on re-dilution back to the native concentration. In
Chapter 5, the dynamics of the temperature effect on casein micelles are investigated in
a comprehensive study using real-time measurement of casein micelle properties in the
range 10 - 40 °C. In Chapter 6, the effects of UF concentration at different processing
temperatures on the hydration, composition and size of casein micelles were
investigated and the composition of retentate serum and micelles were compared,
providing new understanding of the temperature effects on skim milk UF and the
resulting retentates. In Chapter 7, the lactose effects on casein micelles were studied in
different milk protein systems. The thesis concludes with a general discussion of the
main outcomes of these studies and the implications of the findings (Chapter 8).
4
2 Literature Review
2.1 Properties of Milk
Milk is a biological fluid which is secreted by mammals to provide nutrition to the
neonate including energy, amino acids, water, inorganic elements, essential fatty acids
and vitamins (Fox & McSweeney, 1998a). Bovine milk contains hundreds of molecular
species; however, most are at trace levels. The typical concentration of the major
components is outlined in Table 2.1.
Table 2.1 Composition of bovine milk (Walstra & Jenness, 1984)
Component Typical Content Range
[wt %] [wt %]
Water 87.3 85.5~88.7
Solids-not-fat 8.8 7.9~10.0
Fat in dry matter 31.0 21.0~38.0
Lactose 4.6 3.8~5.3
Fat 3.9 2.4~5.5
Protein 3.25 2.3~4.4
Casein 2.6 1.7~3.5
Mineral substance 0.65 0.53~0.80
Organic acids 0.18 0.13~0.22
Miscellaneous 0.14 0.10~0.19
2.1.1 Water
The water content of dairy products ranges from 2.5 to 94% (Fox et al., 1998a) and cow
milk contains about 87% of water. The most important practical aspect of water in dairy
5
products is its effect on their chemical and physical stability. Biochemical changes such
as the denaturation and re-organization of proteins, lipid oxidation, crystallization of
lactose, Maillard reaction and loss of certain vitamins are influenced by water content
and water activity. (Water activity is defined as the ratio between the water vapour
pressure exerted by the water in a food system and that of pure water at the same
temperature. Due to the presence of various solutes, the water exerted vapour pressure
in milk system is always less than that of pure water.)
2.1.2 Lactose
Lactose is the predominant carbohydrate in milk (Fox et al., 1998a). It is a reducing
disaccharide of linked glucose and galactose, which is responsible for the Maillard
reaction when milk is heated to a high temperature.
Lactose plays a distinctive role in milk synthesis, as it is one of the major osmole in
milk. In mammary gland, the lactose synthesis process regulates the final water content
in milk by drawing water into it (Jenness et al., 1987). Although 30% of calories is
provided by lactose in bovine milk, disaccharides cannot be absorbed in intestine.
Therefore, lactose is hydrolysed by β-galctosidase during digestion (Thompson, Boland
& Singh 2009). Most mammalian species are able to produce adequate level of lactase,
however, as they age, the secretion declines and eventually becomes inadequate for
complete hydrolysis lactose. Lactose intolerance frequency and intensity vary from
nearly 100% in Southeast Asia to around 5% in Northwest Europe (Ingram, Mulcare,
Itan, Thomas & Swallow, 2009; Thompson et al., 2009).
Lactose is important in dairy processing. In the absence of nuclei and agitation, the
solubility of lactose is temperature dependent. Before spontaneous crystallization,
lactose solutions are capable of being highly saturated (Fox et al., 1998a). Cooling a
saturated solution or continuous concentrating beyond the saturation point can lead to
super saturation of lactose, in which case crystallization does not occur readily (Fox et
al., 1998a). During the manufacture of concentrated milk products, the insolubility of
lactose and its capacity to form supersaturated solution are of considerable practical
importance. In the mean time, lactose is also significant in manufacturing fermented
dairy products such as yogurt. The lactose metabolize ability of lactic acid bacteria
6
making them have a competitive advantage over many spoilage and pathogenic
organisms (Fox et al., 1998a).
2.1.3 Milk Fat
Milk fat is the most compositionally variable component in milk and it is the major lipid
source used by the mammalian newborn for accumulating body adipose tissue. Milk fat
consists of numerous different lipids, however, is largely present in milk (98 to 99 wt%)
as droplets of triacylglycerides surrounded by a interfacial membrane (8 to 10 nm in
thickness) comprised of phospholipid and proteins (Shipe et al., 1978). The majority of
these liquid fat droplets range from 0.1 to 15 µm in diameter, with the membrane
stabilizing the fat globules in an emulsion within the aqueous environment of milk.
When exposed to moderate mechanical treatment-pumping and flow in pipes, the fat
globules can change their shapes easily without being released from their membranes
(TetraPak, 1995). The remaining 1 to 2 wt% of milk lipid comprises cholesterol,
phospholipids, sterol, carotenoids, fat-soluble vitamins A, D, E, and K, and some other
trace fatty acids (Walstra et al., 1984).
2.1.4 Vitamins
Vitamins are organic chemicals required in trace amounts. The chemical structures of
the vitamins have no relationship with each other. Milk contains all the major vitamins
as it is the only source of nutrients for the neonatal mammal until weaning (Fox et al.,
1998a). The fat soluble vitamins A, D, E, and K are found mainly in milk fat, while the
water soluble B group vitamins (thiamine, riboflavin, niacin, biotin, panthothenate,
folate, pyridoxine, and related substances), cobalamin and its derivatives, and ascorbic
acid are found in the aqueous phase of milk.
Riboflavin is one of the most important vitamins as it is part of two significant
coenzymes involved in numerous metabolic pathways. It also contributes to DNA
reparation in the ribonucleotid reductase pathway (Haug, Høstmark & Harstad, 2007).
In milk products, riboflavin is responsible for the off flavour when exposed to light,
which is caused by photo-oxidation and the production of methional (Fox et al., 1998a;
Hand & Sharp, 1939). Light exposure is the most important parameter affecting the
7
stability of riboflavin in dairy products (Fox et al., 1998a; Hand et al., 1939). The
fluorescence of vitamins (specifically riboflavin in this study) can affect the analysis of
milk products as discussed in section 5.2.5.
2.1.5 Minerals
Milk contains a large variety of minerals and salts present in a complex state of
speciation. The total concentration of minerals in milk is less than 1 wt%. The milk
minerals are mainly the chlorides, citrates, sulphates, carbonates, bicarbonates and
phosphates of sodium, potassium, magnesium and calcium. Trace amount of other
elements are also found in milk including iron, silicon, zinc, copper and iodine. Milk
and milk products are important mineral source, in particular in the uptake of sufficient
quantities of calcium to ensure healthy bones and teeth, and prevention of hypertension
(Insel, Turner & Ross, 2004). Sufficient intake of magnesium is also important, being
involved in more than 300 reactions in the body (Haug et al., 2007).
Various minerals are interrelated and the interrelationships are affected by pH either
directly or indirectly. Milk salts exist in two forms (Table 2.2): diffusible (soluble) and
non-diffusible (colloidal) which are bound to proteins. The mineral equilibrium between
soluble and colloidal phase and the role of calcium phosphate in casein micelle structure
will be discussed in the next chapter.
Table 2.2 Distribution of salts between the soluble and colloidal phase of milk (20 °C,
pH 6.77) (Davies & White, 1960)
Constituent Diffusible Colloidal
Total calcium
Magnesium
Sodium
Potassium
Total phosphorus
Citrate (as citric acid)
Chloride
30.5%
65.5%
98.0%
93.9%
45.6%
93.5%
100%
69.5%
34.5%
2.0%
6.1%
54.4%
6.5%
0%
8
2.1.6 Proteins
Normal bovine milk contains 30-35 g protein/L which serves as a source of essential
amino acid, enzymes, antibodies and immune stimulants (Clare & Swaisgood, 2000;
Korhonen, Pihlanto-Leppäla, Rantamäki & Tupasela, 1998) (Table 2.3). Milk proteins
can be categorised as either caseins or whey proteins, with the caseins defined as those
proteins that precipitate on lowering of the pH to 4.6. Minor proteins also exist in the
milk serum and in the fat globule membrane (Walstra et al., 1984). Another important
difference between casein and whey proteins is that caseins are heat insensitive, whilst
whey proteins denature at high temperatures (Visser & Jeurnink, 1997).
Table 2.3 Major bovine milk proteins and some of their biological functions (adapted
from (Korhonen & Pihlanto, 2007))
Protein
Average
concentration
in milk (g/L)
Molecular
weight
Major biological Functions
α-Lactalbumin 1.2 14200 Lactose synthesis in mammary gland
β-Lactoglobulin 3.3 18400 Retinol carrier, antioxidant and vitamin-
A-binding protein
Bovine serum albumin 0.3 66300 Peptide source
Immunoglobulin 0.5 – 1.0 150000 -
1000000
Immune protection
Lactoferrin 0.1 80000 Antimicrobial, antioxidant and anti-
inflammatory
Caseins 28 19000 -
25000
Mineral carrier and peptide source
Whey Proteins
Milk whey proteins, which are classified as globular proteins, are those remaining in
solution at pH 4.6. The group consists of 4 types of proteins: α-lactalbumin, β-
lactoglobulin, proteose-peptones, and blood proteins such as serum albumins and
immunoglobulins. Some of them are only mammary secretory cell synthesized proteins
(e.g. α-lactalbumin and β-lactoglobulin).
9
α-lactalbumin (α-LA) is a protein unique to milk whey and is present in the milks of all
mammalian subdivisions: eutherians, marsupials and monotremes. It is the regulatory
protein of the lactose synthesis enzyme system that catalyses and regulates the synthesis
of lactose in the lactating mammary gland (Walstra et al., 1984). It is a small, relatively
stable and pressure resistant protein (Considine, Patel, Anema, Singh & Creamer, 2007),
which exists in two genetic variants, A and B. The structure of α-LA consists of 4 α-
helices contained in a bundle like form. This general structure can change to three
different forms: calcium bound, calcium free, and low pH form, which results from its
ability to bind to calcium and other ions (Creamer & MacGibbon, 1996). The binding of
calcium to native α-LA is very strong and associated (Kronman, Sinha & Brew, 1981;
Schaer, Milos & Cox, 1985) and indicates the presence of the calcium binding sites on
the protein (Kuwajima, 1996; Kuwajima, Mitani & Sugai, 1989). It is not required for
activation of α-LA (Kronman et al., 1981; Musci & Berliner, 1985), but has strong
effect on molecular stability (Ikeguchi, Kuwajima & Sugai, 1986). In the reduced
denatured protein, calcium binding is also necessary for native disulfide bond formation
and refolding (Ewbank & Creighton, 1991; Rao & Brew, 1989). For denatured α-LA,
more than two orders of magnitude of the rate of refolding can be accelerated by
calcium while maintaining the general pathway of the transition (Forge et al., 1999;
Kuwajima et al., 1989). The folding rate of α-LA is dependent on the calcium
concentration, while on removal of calcium, the protein is more susceptible to
denaturation (Walstra et al., 1984).
β-lactoglobulin (β-LG) which represents around half of the whey proteins (Thompson et
al., 2009) has been studied extensively. Consequently, its amino acid sequence and
cross-linking mechanisms have been known for some time. The primary function of β-
lactoglobulin is not nutritional, as it is very resistant to proteolysis in its native state
(Thompson et al., 2009). The structure of β-LG shows the main features are an eight-
stranded β-barrel and a three turn helix lying parallel to three β-strands (Creamer et al.,
1996; Visser et al., 1997). The amino acid sequence of the entire structure contains five
cysteine residues, of which four are bound via disulphide linkages, and the fifth, at room
temperature is buried within a group of hydrophobic residues between the helix and the
β-strands (Creamer et al., 1996; Sawyer et al., 2002; Visser et al., 1997; Walstra et al.,
1984). The free thiol group plays a significant role in the changes of β-LG and its
interactions with other milk proteins during thermal processing. At elevated
10
temperatures, β-LG unfolds, exposing the reactive thiol group, resulting in irreversible
aggregation with itself and other molecules such as κ-casein and α-LA (Visser et al.,
1997).
The structure and aggregation state of β-LG is strongly dependent on pH (Creamer et al.,
1996; Sawyer et al., 2002; Visser et al., 1997), and the effect of temperature varies as a
function of pH. Below pH 2.0, β-LG exists as a monomer; when closer to its isoelectric
point (pH=5.1), it exists as an octamer at room temperature. Between pH 5.5 and 6.5, β-
LG exists as a dimer at room temperature. Dissociation to a monomer occurs at
temperature above 50 °C. Further heating to 65 °C results in unfolding of the structure
and subsequent exposure of the free SH group, which is followed by aggregation.
Bovine serum albumin (BSA) is a large protein and it makes up approximately 10 to 15%
of total whey protein in bovine milk. BSA consists of three domains and nine sub-
domains (Krisdhasima, Vinaraphong & McGuire, 1993). It can irreversibly adsorb onto
either hydrophobic or hydrophilic surfaces regardless of the surface charge (Frateur,
Lecoeur, Zanna, Olsson, Landolt & Marcus, 2007; Fukuzaki, Urano & Nagata, 1995;
Nasir & McGuire, 1998), with the presence of divalent cations in milk (Ca2+
and Mg2+
)
enhancing this adsorption (Zanna, Compère & Marcus, 2006).
Immunoglobulin has multiple functions, including bacterial opsonisation, agglutination
and complement activation (Thompson et al., 2009). The protein is glycosylated at
different sits, and β-sheet structures make up both the heavy chain and the light chain
predominantly.
Lactoferrin is a monomeric Fe3+
binding glycoprotein (Strom, Svendsen & Rekdal,
2000). The calcium bound state of bovine lactoferrin is more stable to chemical
denaturants and heat (Rossi et al., 2002).
Caseins
About 80% of milk proteins are caseins and there are four casein variants (αs1-, αs2-, β-
and κ-casein) in bovine milk system. The main functions of caseins in milk system are
to safely transport calcium and phosphate to the mammary gland without precipitation
(Creamer et al., 1996). In order to do this, caseins form multi-molecular complex
11
structure called “casein micelle”, which is the colloidal phase of milk. A detailed review
of the known information about caseins and casein micelles will be presented in the
following chapters.
Nutritional value of milk proteins and peptides
It is known that both the mineral binding and cytomodulatory peptides in bovine milk
are health enhancing, which are claimed to be able to reduce the risk of getting diseases
and improve physiological functions (Meisel & FitzGerald, 2003). For example, some
milk peptides have antihypertensive effects both due to inhibition of angiotensin-
converting enzyme and binding minerals (Jauhiainen & Korpela, 2007).
2.2 Casein and Casein micelles
The overall theme of this thesis is the understanding of the effects of processing on the
physicochemical properties of casein micelles. This section provides a comprehensive
review of the current literature on casein, casein micelles, and casein micelles during
processing that is necessary for the research performed in the thesis.
2.2.1 Caseins
General Information
The caseins are phosphoproteins (Farrell Jr et al., 2004) that constitute 76 to 86% of the
total protein in milk system. There are four casein variants (αs1-, αs2-, β-, and κ-casein)
in bovine milk which can be categorized into calcium sensitive caseins (αs1-, αs2-, β-
caseins) and calcium insensitive κ-casein. The primary structures are shown in Figure
2.1. The polar and apolar residues of all caseins are not uniformly distributed but occur
in clusters, giving hydrophobic and hydrophilic regions (Thompson et al., 2009).
12
P02662| αs1-Casein
MKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAME
DIKQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKE
GIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSEKTT
MPLW
P02663| αs2-Casein
MKFFIFTCLLAVALAKNTMEHVSSSEESIISQETYKQEKNMAINPSKENLCSTFCKEVVRNANEEEYSIG
SSSEESAEVATEEVKITVDDKHYQKALNEINQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNR
EQLSTSEENSKKTVDMESTEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQKAMKPWIQ
PKTKVIPYVRYL
P02666| β-Casein
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQT
QSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSL
TLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQE
PVLGPVRGPFPIIV
P02668| κ-Casein
MMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVA
LINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEI
PTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
Figure 2.1 Amino acid sequences of the bovine αs1-, αs2-, β- and κ-caseins. (Swiss-Prot
accession number, proteins names and sequences for the caseins. The database
sequences are for the B variant of αs1-casein, the A variant of αs2-casein, the A2 variant
of β-casein and κ-casein A.) Confirmed phosphorylation sites are shown in bold type in
αs1-, αs2- and β-casein sequences, potential phosphorylation and glycosylation sites are
indicated in bold in κ-casein sequence (modified from (Thompson et al., 2009)).
13
The four bovine caseins do not appear to have highly organized secondary structure
suggesting only short-length structures are present (Kumosinski, Brown & Farrell, 1993;
Kumosinski & Farrell, 1994). The fairly uniformly distributed proline residues and the
unphosphorylated and unglycosylated polypeptides can form regular structures, giving
the caseins a type of helix loop conformation (Fox & McSweeney, 1998b; Holt &
Sawyer, 1988). Considering the biological function of the caseins, these conformations
on the calcium sensitive caseins are suited to modulating the precipitation of calcium
phosphate in milk by either acting as sites for nucleation or binding rapidly to calcium
phosphate nuclei (Holt et al., 1988).
α-caseins stabilize milk proteins by both refolding properties and chaperone-like
activity (Sakono, Motomura, Maruyama, Kamiya & Goto, 2011). The solubility of α-
caseins is marginally influenced by temperature but strongly influenced by pH (Post,
Arnold, Weiss & Hinrichs, 2012).
αs1-casein which has two predominantly hydrophobic regions and one highly charged
polar zone (Fox et al., 1998a), exists as a loose flexible polypeptide chain. αs1-casein A
is soluble at calcium concentrations up to 0.4 M below 33 °C, whilst αs1-casein B and C
are insoluble and form coarse precipitates when calcium is present at concentrations
above 4 mM (Singh & Flanagan, 2006). The presence of αs1-casein A modifies the
behaviour of αs1-casein B, which is then soluble in 0.4 M calcium at low temperature
(Singh et al., 2006).
αs2-casein is more varied than αs1-casein and is generally present as a mixture of four
phosphor forms with 10-13 phosphates (Thompson et al., 2009). It has a dipolar
structure where the N terminus is negatively charged, and the C terminus is positively
charged (Fox et al., 1998a). αs2-casein is insoluble in calcium solution over 4 mM
(Singh et al., 2006).
β-casein has an unordered structure, which has a high degree of segmental motion
(Nasir et al., 1998). It has a strong negatively charged N terminus and an uncharged
hydrophobic tail (Krisdhasima et al., 1993). It can stabilize the calcium phosphate in
solutions (Holt, 2004) but in a temperature-dependent manner (Singh et al., 2006). This
could be because β-casein undergoes a temperature-dependent conformational change in
which the content of poly-proline helix decrease as a function of temperature (Singh et
al., 2006).
14
By following a sequential process, β-casein is able to form micelle-like aggregates
(O'Connell, Grinberg & de Kruif, 2003) and this is primarily attributed to diffusive
motion, long range concentration fluctuations (de Kruif & Grinberg, 2002) and
hydrophobic interactions (Pierre & Brule, 1981). The experiments related to β-casein
micelle formation fit well with the thermodynamics underlying the shell model of
casein micelle structure, which has been well discussed by many researchers (Kegeles,
1979; Mikheeva, Grinberg, Grinberg, Khokhlov & de Kruif, 2003).
κ-casein has a flexible structure which includes a positively charged hydrophobic
regions, negatively charged polar regions, and connecting domains (Fox et al., 1998a).
It contains high amount of β-sheet structure which can form close association with
phosphorylated caseins (Farrell, Cooke, Wickham, Piotrowski & Hoagland, 2003). κ-
casein is markedly different from the other three caseins in terms of its solubility
characteristics. It is insensitive to calcium and is soluble in calcium solutions at all
concentrations up to those at which general salting out occurs (Singh et al., 2006). It is
able to stabilize and absorb onto other caseins, terminating casein aggregation so that no
further casein protein adsorption can be achieved, even in the presence of calcium. This
is consistent with the understanding that it forms the outer layer of casein micelles,
helping to stabilize the colloidal particles (Nagy, Váró & Szalontai, 2012). The
proportion of κ-casein in casein micelles has been shown to be inversely related to their
size (Davies & Law, 1983).
Casein Properties
Solubility
Solubility is an important functional property for proteins in fluid and it is also essential
for other functionalities since insoluble proteins cannot perform useful properties. In a
calcium free system, the solubility of individual caseins is pH and temperature
dependent (Bingham, 1971). The caseins are insoluble at their isoelectric point (pH 4.6)
and the insolubility range becomes wider with increasing temperature (Fox et al.,
1998a). Due to the open structure and relatively high water binding capacity of caseins,
they are able to form high viscous solutions; however, not more than 20% casein protein
can be dissolved even at elevated temperature (Fox et al., 1998a).
15
Gelation
In milk, caseins undergo gelation when the environment is changed in one of several
ways. The most important of these are rennet induced coagulation for cheese or rennet
casein manufacture and acidification to the isoelectric point. In addition, caseins may
also be gelled or coagulated by organic solvents or extremely severe thermal conditions
(Fox et al., 1998a). Studying the gelation process can provide crucial information on the
casein micelle structure (Horne, 2002a).
Surface activity
As far as their functionality is concerned in food system, the surface activity of caseins
is an important property that makes them good foaming agents and emulsifers (Fox et
al., 1998a). To be an effective emulsifying agent, a molecule should be relatively small
and capable of adsorbing onto oil-water or air-water interface. αs1- and β-casein which
have relatively high surface hydrophobicity meet these requirements very well
(Dickinson, 1989).
Co-precipitation with whey proteins
Casein and whey protein co-precipitation can be achieved by acidification of denatured
whey proteins to pH 4.6 or by addition of calcium at 90 °C (Figure 2.2) (Fox et al.,
1998a). The functionality of the caseins is not adversely affected when adjusting the
milk to an alkaline pH before denaturing the whey proteins and then co-precipitating
them with casein acidification at pH 4.6. This might be because the denatured whey
proteins do not form complex with the casein micelles at elevated pH (Mulvihill, 1992).
16
Figure 2.2 Protocols for casein whey co-precipitates (Mulvihill, 1992)
2.2.2 Casein Micelles
It has been known for a long time that casein in milk exists predominantly in the form
of complex, approximately spherical aggregates (Figure 2.3) with a diameter in the
range 50 – 500 nm (Fox et al., 1998a) that are termed casein micelles. Casein micelles
scatter light and the white colour of the skim is largely due to the presence of casein
micelles. The micelles are very stable; they can withstand heat treatment, commercial
homogenization and high calcium concentration (Thompson et al., 2009). The casein
micelles are able to keep high concentrations of calcium phosphate in colloidal form
making them essential for development of bones and teeth in the sucking infant, as it is
able to deliver these supersaturated minerals to mammary gland (Thompson et al.,
2009). At the same time, micelles are also known as important amino acid source
(Thompson et al., 2009).
Milk pH Adjustment or adding Calcium
Heat treatment
Precipitation
Casein and whey protein co-precipitation
17
Figure 2.3 SEM image of a casein micelle (Dalgleish & Corredig, 2012)
Formation and digestion of casein micelles
In the Golgi apparatus, caseins appear to be spherical complexes with a diameter of 10
nm (Farrell Jr et al., 2006). Calcium transport starts from the phosphorylation of caseins
by calcium activated kinase which binds with the Golgi membrane (Bingham & Farrell,
1974) and followed by delivery of calcium to the casein vesicles with a membrane
associated ATPase (Bingham, McGranaghan, Wickham, Leung & Farrell Jr, 1993). The
step-by-step interactions of caseins, calcium and phosphate gradually form complex
structures which lead to the casein micelles (shown in Figure 2.4, top) and insure the
effective transport of the vital minerals. The formed casein micelles are then secreted by
reverse pinocytosis (shown in Figure 2.4, bottom) (Farrell Jr et al., 2006). After milk
ingestion, casein micelles are precipitated due to acidification in stomach, which delays
the entry of proteins into the small intestine and improves the digestibility (Fox &
Brodkorb, 2008). The micelles are then digested by pepsin in the stomach followed by
trypsin digestion in the intestine (Ono, Takagi & Kunishi, 1998).
18
Figure 2.4 Formation of casein micelles (CM) in Golgi vesicles (G). Top, a Golgi
vesicle discharged its contents into the alveolar lumen; Bottom, One casein micelle
presents in lumen.(Farrell et al., 2003)
Casein micelle structure
The structure of casein micelles has attracted the attention of scientists for a
considerable time. Knowledge of micelle structure is important because the stability and
behaviour of the micelles are central to many dairy processing operations. Since the
pioneering work of some researchers (Shimmin & Hill, 1964; Waugh, 1958), numerous
investigations and a number of models have been made and refined. The following is a
summary of some of the important attributes of casein micelles that are generally
accepted in the literature:
(1) Casein micelles have a porous structure in which protein occupies only about 25%
of the total volume (Fox et al., 1998a). The micelles are highly hydrated, having a water
content of 2 to 4 gram of water per gram of protein (de Kruif, 1999; Morris, Foster &
Harding, 2000; Walstra, 1979). Cryo-TEM studies have revealed the presence of water
filled cavities and channels inside casein micelles (Trejo, Dokland, Jurat-Fuentes &
Harte, 2011).
(2) κ-casein, which represents about 15% of total casein, covers part of the casein
micelle surface (Dalgleish, 1998). It stabilizes the calcium sensitive caseins, which
19
represent about 85% of total casein (Fox et al., 1998a). The content of κ-casein in casein
micelles is inversely proportional to the micelle size (Dalgleish, Horne & Law, 1989;
Davies et al., 1983).
(3) Some casein is able to shift between the serum and the casein micelles, particularly
as a result of changes in temperature (Creamer, Berry & Mills, 1977; Udabage,
McKinnon & Augustin, 2003). Upon cooling, β-casein is liberated from large micelles
and κ-casein is solubilised from small micelles (Ono, Murayama, Kaketa & Odagiri,
1990). The released caseins have been reported to be fully reversible after incubation at
room temperature (Davies et al., 1983). At high temperature (i.e. above 70 °C), micelle
size increases due to heat induced protein aggregation and attachment of denatured
whey proteins (Anema & Li, 2003).
(4) The calcium and phosphate within the micelles form high density colloidal calcium
phosphate (CCP) nanoclusters (Choi, Horne & Lucey, 2011; McMahon & Oommen,
2008; Rose & Colvin, 1966; Trejo et al., 2011), which are associated with the
phosphorylated amino acid residues of caseins through electrostatic interactions (de
Kruif, Huppertz, Urban & Petukhov, 2012b). Calcium and phosphate are known to
exchange between the serum and the micelles (McMahon & Brown, 1984). CCP is
more stable at high temperature (Morr, 1967) and removal of CCP will not change the
size distribution and protein composition of casein micelles (Griffin, Lyster & Price,
1988; Lin, Leong, Dewan, Bloomfield & Morr, 1972).
Modified from the models presented by Waugh (1958) and Schmidt (1982), the well
known submicelle model was developed (Walstra, 1990; Walstra, 1999) (shown in
Figure 2.5). In this model, researchers proposed that casein sub-micelle units build up
the internal structure and form roughly spherical casein micelles which have a hairy
outer layer (comprising mostly κ-casein) on the surface. The sub-micelles vary in
composition (one type consists of α-casein and β-casein primarily, and the other type
consists of α-casein and κ-casein) and they can be linked together by calcium phosphate
clusters between them (Walstra, 1999). Early X-ray scattering study and electron
microscopy suggested the existence of sub-micelles around 15 nm in diameter (Pessen,
Kumosinski & Farrell, 1989; Schmidt, 1982), however, more recently this has been
determined to be an artefact due to sample preparation (such as casein separation and
dehydration, chemical fixation as well as metal coating, which lead to protein
20
coagulation and crosslinking and altered micelle original state) (McMahon &
McManus, 1998; McMahon et al., 2008).
Figure 2.5 Representation of the submicelle model of casein micelles proposed by
Walstra (1999)
Although the sub-micelle model is able to explain many of the physico-chemical
reactions and the principal features of casein micelles, it has never enjoyed unanimous
support. The main challenge is that inadequate evidence has been found to support the
presence of sub-micelles from cryo-EM (McMahon et al., 1998). As alternative, Visser
(1992) described a randomly aggregated casein micelle structure held together by
hydrophobic bonds and amorphous calcium phosphate, with κ-casein at the outer
surface layer, however, this model retains the key features of the sub-micelle model.
Several models have been proposed as alternatives. The dual-binding model was first
developed by Horne (1998). In this model, the assembly and growth of casein micelles
take place by a polymerization process involving the links between calcium phosphate
nanoclusters and through hydrophobic regions of caseins. Each casein molecule remains
intact and functions as a block copolymer effectively as shown in Figure 2.6. The
hydrophobic regions (shown in Figure 3.6) on caseins offer the possibility of multiple
interactions. κ-casein is the most important molecule in the dual-binding model, which
is able to link through its hydrophobic block with the growing chains, whilst the
21
hydrophilic part cannot sustain the growth. The other calcium sensitive caseins, contain
phosphoserine clusters and have multiple functionalities for cross-linking. αs1-casein
can associate through the hydrophobic blocks; αs2-casein, which is only a small fraction
of total bovine casein, has both hydrophobic regions and phosphoserine clusters and is
able to sustain growth through all its blocks; β-casein contains hydrophilic and
hydrophobic blocks can also form polymer links in the network. The dual-binding
model describes casein micelles as a dynamic system and the presence of these weak
interactions are able to lead to breaking and recombining on a continuous basis
(Thompson et al., 2009).
Figure 2.6 Schematic diagram of casein micelle assembly according to dual-binding
model reproduced from (Horne, 2003)
(Blue parts represent the hydrophilic regions, Red parts represent the hydrophobic
regions, C on the κ-casein represents the C-terminal)
Holt (1992; Holt, 2004) proposed the nanocluster model, which describes the micelle to
be a gel-like structure with tangled web of flexible caseins and the calcium phosphate
nanoclusters dispersed as small ‘cherry stones’ (as shown in Figure 2.7) (de Kruif et al.,
2012b). The presence of the nanoclusters in casein micelles is to avoid calcification of
mammary gland. This model is very similar to the dual-binding model, which suggests
22
that the proteins assemble through a collection of weak interactions (including hydrogen
bonding, ion bonding, hydrophobic interactions, weak electrostatic interactions and
other factors) (de Kruif et al., 2012b).
Figure 2.7 Representation of the nanocluster model (de Kruif & Holt, 2003)
The sponge model is a recent description of casein micelle as shown in Figure 2.8
(Bouchoux, Gésan-Guiziou, Pérez & Cabane, 2010). It presents the casein micelle as a
soft micro-emulsion-like object when responding to environment changes (i.e. water
removal) (Sørensen, Pedersen, Mortensen & Ipsen, 2013). The internal structure of the
micelles contains hard regions (including CCP nanoclusters) which are difficult to
compress and regions that can be at least partly merged with other parts upon
compression. This is an alternative model to those based on individual sub units.
23
Figure 2.8 Schematic picture of casein micelle sponge model (Bouchoux et al., 2010)
More recently, the internal structure of casein micelles was studied by small-angle
neutron and X-ray scattering, and the results indicate that the nanocluster model predicts
the distribution of CCP nanoclusters successfully with an average distance of 18.6 nm
(de Kruif et al., 2012b; Holt, Carver, Ecroyd & Thorn, 2013). Meanwhile, with the help
of high-resolution TEM, a sponge-like structure was also observed with CCP
nanoclusters linking the proteins together (Dalgleish, 2011b; Dalgleish et al., 2012;
McMahon et al., 2008). In summary, casein micelles are complex and somewhat
dynamic entities. There is no precise description of the micelle internal structure to date
and each of the models is in various ways oversimplification. The casein micelle models
presented here will be discussed in relation to the results presented in the following
sections which will aid in the interpretation of the results and help achieve a better
understanding of the micelle structure.
Casein micelle properties
To study the casein micelle alterations during milk processing, it is essential to have a
detailed understanding of casein micelle properties and their alterations upon
environmental changes.
Mineral equilibrium
24
As mentioned above, milk contains a large variety of minerals. Except chloride, all the
major ionic species in milk are distributed between the soluble and colloidal phases
(Table 2.2). However, the principal colloidal salt is calcium phosphate. About 67% and
57% of the total calcium and phosphate are in the colloidal phase respectively (Fox et
al., 1998a), associated with the caseins, incorporated into the casein micelles as CCP.
The chemical composition of CCP is yet to be determined with certainty. Based on the
assumption that the amount of calcium bound directly to casein is equivalent to the
number of ester phosphate groups present, Pyne (1960) first suggested that CCP has an
apatite structure with the formula: 3Ca3(PO4)2·CaHCitr- or
2.5Ca3(PO4)2·CaHPO4·0.5Ca3Citr2-. The hypothesis from Schmidt (1982) suggested
that CCP is most likely to be amorphous calcium phosphate [Ca9(PO4)6] ion clusters
linked through calcium bridges to the phosphoseryl residues of caseins. Based on this
information, a more detailed physical study on the structure of CCP has been
undertaken using various forms of X-ray spectroscopy, it was concluded that the most
likely form of CCP is brushite (CaHPO4·2H2O), which has also been identified in bone
and other calcified tissues (Holt, Davies & Law, 1986; Holt et al., 1989). The difference
between the calcium and phosphate ratio (from 1.0 to 1.6) found by analysis is
presumably due to the ability of phosphate moiety of phosphoserine to substitute a
brushite type lattice on their surface sites (Fox et al., 1998a).
The CCP does not precipitate out of milk because of physical protection and chemical
association with caseins inside the micelles. Although CCP represents only about 6 %
of the dry weight of the casein micelles, as mentioned in the nanaocluster model, it
plays essential role in the structure and function of casein micelles and therefore has
major effects on the properties of milk. The concentration of calcium and phosphate
affects casein micelles coagulation during rennet (Choi, Horne & Lucey, 2007;
Dalgleish, 1983; Dalgleish et al., 2012; Lucey & Fox, 1993) and the heat and calcium
stability of the caseins (Fox & Hoynes, 1975; Rose, 1961; Singh & Fox, 1985; Singh &
Fox, 1987).
The equilibrium between the soluble and colloidal minerals of milk is influenced by
many factors including changes in temperature, dilution or concentration, and addition
of salts. For instance dilution reduces the concentration of serum minerals and leads to
solubilisation of some CCP, making the milk more alkaline (Fox et al., 1998a). The
25
details of these relationships and other important effects relating to mineral balance are
now discussed below in the context of alterations to casein micelles in response to
environmental factors.
The effects of pH and minerals on casein micelles
Casein micelles formed at low pH have more compact structure due to low charge on
the proteins (Liu & Guo, 2008). The content and surface hydrophobicity of micelles can
also be changed by acidification (Jean, Renan, Famelart & Guyomarc'h, 2006; Law,
1996). A progressive solubilisation of CCP and other colloidal salts from the micelles
takes place at low pH regardless of the overall ionic strength (Le Graët & Gaucheron,
1999). All of the inorganic phosphate is known to solubilise at pH 5.2, whilst most of
the remaining calcium ions are solubilised when pH reaches 4.6, with the disappearance
of the CCP nano-clusters confirmed by small angle X-ray scattering (Marchin, Putaux,
Pignon & Léonil, 2007). The addition of alkali results in the dissociation of κ-casein
which increases with temperature above pH 6.5 (Anema & Klostermeyer, 1997). At
about pH 11 almost all the calcium phosphate is present in the colloidal phase and these
changes are not reversible on subsequent dialysis against untreated milk (Fox et al.,
1998a). When milk is heated at pH values over 6.9, the amount of α- and β-casein
liberated into serum increases as a function of temperature up to 60 °C and also above
100 °C (Park, Nakamura & Niki, 1996; Singh, McCarthy & Lucey, 1997) but decreases
in the range between 60 to100 °C (Anema & Li, 2000). The CCP can also be removed
from casein micelles by adding EDTA, citrate or oxalate (Horne, 2002b), which might
combine with the release of soluble caseins (Griffin et al., 1988; Lin et al., 1972).
Casein micelles have a sufficiently open structure to allow movement of casein proteins
and the exchange of mineral ions (Udabage et al., 2003). The voluminosity of the core
of the casein micelles is dependent on the hydration and relative partitioning of
exchangeable minerals and casein between the micelles and serum. The overall
(hydrodynamic) voluminosity of the casein micelles also depends on the thickness of
the κ-casein hairy layer, which increase with the addition of NaCl (Kapsimalis & Zall,
1981). Adding calcium has more complicated effects. It increases the calcium activity
(McGookin & Augustin, 1991) which decreases the soluble casein concentration
(Famelart, Le Graet & Raulot, 1999; Sood, Graind & Dewan, 1979). It also reduces the
26
negative charge of caseins (Anema et al., 1997; Anema, Lowe & Stockmann, 2005) and
weakens the κ-casein hairy layer (Müller-Buschbaum, Gebhardt, Roth, Metwalli &
Doster, 2007) thereby modifying the hydrophobic interactions and electrostatic
interactions between casein micelles (Van Hooydonk, Hagedoorn & Boerrigter, 1986).
The addition of magnesium and ferric iron can reduce micelle heat stability (Philippe,
Le Graët & Gaucheron, 2005), while the addition of secondary Na or K phosphate
causes the precipitation of CCP, with concomitant decrease in the concentration of
soluble calcium and calcium ion (Fox et al., 1998a). Adding citrate reduces the
concentration of CCP, and increases the soluble calcium, soluble phosphate and the pH
(Fox et al., 1998a).
Temperature induced alterations of casein and casein micelles
Temperature has a large influence on the state of the milk system and milk viscosity
decreases as a function of temperature (Fernández-Martín, 1972). The caseins have
marked heat stability and there are two main reasons for this. Firstly, being amorphous
unstructured proteins the caseins do not denature and aggregate on heating (Fox et al.,
1998a). Secondly, the structure of casein micelles is such that the calcium sensitive
caseins are located inside the micelles and are protected from further aggregation at
elevated temperature by the outer layer of κ-casein (Griffin, Price & Martin, 1986). The
high heat stability of caseins allows heat sterilized dairy products to be produced
without major changes in physical properties. The heat stability of unconcentrated milk
is almost always sufficient to withstand the temperatures associated with normal heat
treatment processes. However, the heat stability of milk decreases sharply on
concentration (Fox et al., 2008) and is usually inadequate to withstand in-container or
UHT processing unless certain adjustments and/or treatment are made (Fox &
Morrissey, 1977; Horne & Muir, 1990).
Soluble casein is known to shift from serum into the micelles when increasing the
temperature (Creamer et al., 1977; Rose, 1968), which consequently leads to a compact
internal micelle structure and decrease of the apparent voluminosity of casein micelles
(Nöbel, Weidendorfer & Hinrichs, 2012). The effects of heat treatment on the
partitioning of caseins between serum and micelle phase are reversible on cooling
(Creamer et al., 1977; Downey & Murphy, 1970; Pouliot, Boulet & Paquin, 1989b). β-
casein is able to shift from large micelles to serum (Creamer et al., 1977) and κ-casein is
27
solubilised from small micelles (Ono et al., 1990) at low temperature. Loss of these
temperature sensitive caseins from micelles leads to additional releases of caseins to
serum (Rose, 1968).
At high temperature, interactions between denatured whey proteins and caseins can
occur (Donato, Guyomarc'h, Amiot & Dalgleish, 2007; Jovanovic, Barac, Macej, Vucic
& Lacnjevac, 2007; Oldfield, Singh & Taylor, 2005; Oldfield, Singh, Taylor & Pearce,
2000), due to the formation of inter-molecular disulfide bonds (Jang & Swaisgood,
1990; Lowe, Anema, Bienvenue, Boland, Creamer & Jiménez-Flores, 2004). During
heating, whey proteins denature, exposing free thiol groups that then form disulfide
bonds with κ-casein on the surface of the casein micelles. This can result in a significant
size increase as well as surface modification of the casein micelles (Anema et al., 2003;
Park et al., 1996; Singh et al., 1997). β-lactoglobulin is essential in this whey protein-
casein reaction (Considine et al., 2007; Corredig & Dalgleish, 1999; Elfagm &
Wheelock, 1978). It forms aggregates with α-lactalbumin in a fixed ratio before
interacting with caseins (Guyomarc'h, Law & Dalgleish, 2003). The addition of β-
lactoglobulin reduces the level of soluble α- and β-casein at temperature above 60°C
(Anema et al., 2000), presumably due to the formation of whey protein-casein complex.
The exchange of minerals between the serum and colloidal phases is also temperature
dependent, and soluble calcium concentration is known to decrease at high temperature
(Rose & Tessier, 1959) due to decrease of solubility (Morr, 1967) while the distribution
of Na, K, Mg and citrate is not affected (Rose et al., 1959). Cooling on the other hand,
increases the concentrations of soluble calcium and phosphate at the expense of CCP
(Fox et al., 1998a; Pouliot et al., 1989b). The mineral composition of milk is also
important to the zeta potential of casein micelles, which decreases as a function of
temperature (Darling & Dickson, 1979).
As discussed above, much is known about the temperature effects on casein and casein
micelles. However, most of the studies have investigated the casein micelles in an
equilibrium state and the dynamic of casein micelles have not been fully elucidated,
which is clearly important. In Chapter 6 of this thesis, both the equilibrium and kinetic
aspect of casein and mineral alterations in response to temperature was examined.
28
Alterations to casein micelle during processing
Of the various skimmed milk components, the casein micelles arguably have the
greatest impact on properties of different milk products. As discussed above,
environmental conditions can have a considerable influence on the properties and
structure of casein micelles in milk. During processing (as illustrated in Figure 2.9),
milk is exposed to a range of different conditions that can cause various alterations to
the physico-chemical properties of casein micelles. In this section, the current
understanding of these processes is reviewed and the key research questions for the
thesis indentified in this context.
29
Figure 2.9 Outline of some processes used to produce milk protein products
30
Casein micelle alterations during evaporation
Highlighted in Figure 2.9, concentration of skim milk by evaporation is an important
unit operation in dairy processing. In particular, the manufacture of spray dried products
such as skim milk powder (SMP) requires evaporative concentration of milk (usually
performed under vacuum at temperature in the range of 45 to 50 °C) up to
approximately 40 to 50% total solids (TS) prior to spray drying. Casein micelles are
highly hydrated, having in the order of 2-4 g water per gram of protein, depending on
the method of measurement (de Kruif, 1999; Morris et al., 2000; Walstra, 1979).
Although, as discussed above, their overall structure is quite sound over a wide range of
processing conditions, the combination of heating and water removal occurring during
evaporative concentration would be expected to influence the hydration, composition
and size of the casein micelles.
As mentioned above, literature covers the effect of pH and high temperature on casein
micelles extensively. Apart from the information above, it is known that the micellar
phosphate shifts to serum at low pH (Tsioulpas, Lewis & Grandison, 2007; Walstra,
1990). The decrease of soluble caseins at high temperature was also confirmed (Davies
et al., 1983; Tsioulpas et al., 2007; Walstra, 1990). These alterations are in part because
the CCP is in dynamic equilibrium with the minerals contained in the serum, which are
in a complex state of speciation (Holt, 2004). While studies have investigated the pH
and temperature effects on casein micelles in detail, (Ali, Andrews & Cheeseman, 1980;
Creamer et al., 1977; Davies et al., 1983; Downey et al., 1970; Rose, 1968; Tsioulpas et
al., 2007; Visser, Minihan, Smits, Tjan & Heertje, 1986; Walstra, 1990), surprisingly,
information on the effect of concentration on casein micelles is comparatively sparse
(Singh, 2007).
It has been shown that both calcium and phosphate increasingly shift from the serum to
the micellar phase during evaporative concentration of skim (Le Graët & Brule, 1982;
Vujicic & Deman, 1966) and full-cream milk (Nieuwenhuijse, Timmermans & Walstra,
1988). However, the hydration and size of the micelles and the partitioning of casein
between the serum and micelles were not examined. Other studies have investigated the
effect of concentration on macroscopic rheological properties of milk and suggested that
the viscosity of milk concentrates increases as a function of total solids content
(Bienvenue, Jiménez-Flores & Singh, 2003; Vélez-Ruiz & Barbosa-Cánovas, 1998).
31
Collapse (Bouchoux et al., 2010) and aggregation of casein micelles (Bienvenue et al.,
2003; Vélez-Ruiz & Barbosa-Cánovas, 2000) were also observed at high concentration
and during storage, but these investigations have not thoroughly examined the effects on
casein micelle composition. Other studies have also been performed using concentrated
suspensions of reconstituted skim milk powder (SMP) to examine the effects of high
pressure treatment (Huppertz, Fox, de Kruif & Kelly, 2006) and acidification (Anema,
1998; Ward, Goddard, Augustin & McKinnon, 1996), however, not on the casein
micelle structure. In addition, Martin et al., (2007) have previously shown that the
casein micelles in reconstituted SMP are different to those in fresh skim milk. Although
not thoroughly investigated in this previous study, it appeared that some of the observed
alterations to casein micelles were incurred by the evaporative concentration process
(Martin et al., 2007). While it appears significant alterations to casein micelles can
occur during evaporative concentration, a comprehensive study has yet to be performed.
In order to provide detailed information about casein micelle alterations during
evaporation, in Chapter 4 of this thesis, the properties of casein micelles in evaporative
concentrates were investigated, including the size, hydration and composition of casein
micelles. The extent and rate of reversibility were also examined by re-diluting
concentrated samples with water.
Casein micelle alterations during ultrafiltration
Ultrafiltration (UF), as outlined in Figure 2.9, is an important processing step in the
manufacture of cheese and dairy ingredients and in milk standardization (Gésan-
Guiziou, 2013). During UF of skim milk, water, soluble minerals and lactose pass
though the membrane into the permeate while proteins are concentrated in the retentate
(Mistry & Maubois, 2004).
Casein is an important component of skim milk to be considered during UF. The casein
micelles have been reported to be responsible for concentration polarization and gel
layer that form during UF of skim milk, directly influencing flux and processing
efficiency at different pH (Bouzid, Rabiller-Baudry, Paugam, Rousseau, Derriche &
Bettahar, 2008; Rabiller-Baudry, Gesan-Guiziou, Roldan-Calbo, Beaulieu & Michel,
2005) as well as the cleaning efficiency (Rabiller-Baudry, Bégoin, Delaunay, Paugam &
Chaufer, 2008). High zeta potential of the casein micelles will lead to high processing
32
flux at neutral pH (Bouzid et al., 2008; Rabiller-Baudry et al., 2005). In the mean time,
casein micelles are dynamic entities that can themselves be affected by UF processing.
A fundamental understanding of casein micelle behaviour during UF, could therefore
lead to improvements in processing efficiency (David, Pignon, Narayanan, Sztucki,
Gesan-Guiziou & Magnin, 2008; Rabiller-Baudry et al., 2005), the use of UF retentates
for standardizing cheese milk, and the quality of products such as milk protein
concentrate (MPC) powders (Martin et al., 2010). Despite this, to date only a limited
number of studies have been devoted to understanding the effect of UF on the
composition, size or structure of casein micelles (Singh, 2007). In one analysis of
transmission electron microscopy (TEM) images, a decreased average casein micelle
size was observed in UF retentates at volume concentration factors of 3 and 5 compared
with the unconcentrated skim milk (Srilaorkul, Ozimek, Ooraikul, Hadziyev & Wolfe,
1991). The size changes were attributed to compositional changes in the retentate;
however the composition of the micelles was not directly investigated. In another study
employing TEM, the size of casein micelles was observed to remain relatively
unchanged during UF but become progressively swollen on subsequent diafiltration
(McKenna, 2000). In a more recent study, different methods were employed to compare
casein micelles in fresh skim milk to those in commercial UF retentates and
reconstituted milk protein concentrate powders (MPC). The average size of casein
micelles was found to be similar in all these samples as measured by dynamic light
scattering (Martin et al., 2010). Rabiller-Baudry et al. (2005) and Karlsson et al. (2007)
have investigated the effect of pH and mineral content on the physical properties of
skim milk during membrane filtration and found that the casein micelle voluminosity
appeared to increase in the presence of added NaCl and decrease when the pH was
decreased from 6.5 to 5.5. In studies on the functional properties of UF treated milk,
alterations to the bulk mineral composition caused by UF have been shown to affect the
renneting process (Ferrer, Alexander & Corredig, 2011; Martin et al., 2010; Sandra &
Corredig, 2013). It was also found that on rennet induced gelation of casein micelles,
stiffer gels could be formed from UF concentrated skim milk than unconcentrated milk
presumably due to an increase in the network bonds (McMahon, Yousif & Kaláb, 1993;
Sandra, Cooper, Alexander & Corredig, 2011). While these studies showed that UF
processing can affect the functional properties of casein micelles, alterations to the
composition of the casein micelles were not investigated. In addition, as discussed
above, the temperature effects on casein micelles are very important. However, the
33
alterations of casein micelles during UF at different temperatures have not been
examined thoroughly (section 6.1). This information will lead to a better understanding
of UF processing of skim milk and the properties of the resulting retentates.
Casein micelle alterations during other processing steps
During processing, milk can be extensively concentrated and the casein micelles still
behave like a dispersion of hard spheres (Bouchoux, Cayemitte, Jardin, Gésan-Guiziou
& Cabane, 2009; Mezzenga, Schurtenberger, Burbidge & Michel, 2005; Sandra et al.,
2011). However, further concentration leads to expulsion of the internal water and
micelle fusion (Bouchoux, Debbou, Gésan-Guiziou, Famelart, Doublier & Cabane,
2009). During the manufacture of milk powder, irreversible shift of small casein
particles towards larger casein micelles takes place (Martin et al., 2007) and whey
proteins attachment to casein micelles during heat treatment occurs, which will continue
in the water removal processes (Martin et al., 2007; Oldfield, Singh, Taylor & Pearce,
1998). In the cheese making process, κ-casein molecules on the micelles breakdown and
leads to the decrease of repulsion (Panouillé, Nicolai & Durand, 2004). These allow
micelles to approach each other and form gels (Castillo, Lucey & Payne, 2006; Gastaldi,
Trial, Guillaume, Bourret, Gontard & Cuq, 2003; Li & Dalgleish, 2006; Tranchant,
Dalgleish & Hill, 2001).
Other treatments such as pressure treatment and ultrasonication have also been
investigated. Aggregation of casein micelles has been reported as a function of pressure
below 300 MPa (Anema, 2008; Anema et al., 2005). Ultrahigh pressure processing
(over 300 MPa), leads to micelle size decrease initially (Gaucheron, Famelart, Mariette,
Raulot, Michela & Le Graeta, 1997; Gebhardt, Doster, Friedrich & Kulozik, 2006;
Huppertz, Fox & Kelly, 2004) and follows by re-association for longer processing time
(Orlien, Knudsen, Colon & Skibsted, 2006). Compared to static high pressure treatment,
there are few changes in the micelles during dynamic high pressure processing (i.e.
homogenization) (Sandra & Dalgleish, 2007). Casein micelle is also very stable in milk
system during the exposure to ultrasound while reducing the size of fat globules and
breaking up whey protein aggregates (Chandrapala, Martin, Zisu, Kentish &
Ashokkumar, 2012).
34
2.3 Summary
Evaporation and ultrafiltration are important processing steps in the manufacture of
different dairy products. It has been shown from current literature that casein micelles
have great impact on the properties of milk system, quality of the products and the
processing efficiency, however, little is currently known about how the
physicochemical properties of casein micelles change in response to evaporative
concentration and ultrafiltration. In this study, the physicochemical behaviours of casein
micelles under different evaporative concentration (Chapter 4) or ultrafiltration (Chapter
6) conditions were investigated by studying alterations of both the serum and casein
micelle phase.
Temperature is an important parameter in milk processing that affects a wide range of
physicochemical properties. While many studies are available on the temperature effects
on casein micelles in an equilibrium state, detailed information about casein micelle
kinetic response to heating and cooling are yet to be obtained. In Chapter 5 of this thesis,
the temperature induced kinetic changes of casein micelles and mineral equilibrium
were examined by using close to real-time pH and turbidity measurements. Based on
this information, the effects of ultrafiltration temperature on casein micelles were
further studied in Chapter 6.
In addition, while only water was removed during evaporative concentration, lactose,
minerals and water pass membrane in skim milk UF process. The casein micelle
hydration was different in these two processing units (discussed in Chapter 4, 6 and 7).
The lactose effect on casein micelle hydration was studied in Chapter 7, as lactose is
known to regulate the water content of milk during secretion.
The thorough studies in this thesis have important implications for improving
processing efficiency as well as the properties of the resulting products.
35
3 Experimental Techniques and Applications
A systematic study using a number of complementary techniques was employed in this
study to investigate the alterations of casein micelles during processing. The general
experimental approach, methodology and principles of the analytical techniques that
were used will be presented in this chapter. Specific information about the materials and
methods pertaining to each experimental chapter will then be presented separately.
3.1 Overview of experimental approach
In order to study alteration to the casein micelles and the partitioning of components
between the micelles and the serum, ultracentrifugation was used to separate the
micelles from the serum. The supernatant and pellet fractions were then analysed to
obtain information about the serum and casein micelles respectively. This enabled direct
observation of changes at the actual concentration to be performed, with other
techniques that require dilution (e.g. DLS) performed as supplementary techniques.
Figure 3.1 shows how the components of milk are separated during evaporation and UF
and how the evaporative concentrates and UF retentates were separated for analysis by
ultracentrifugation. A more detailed summary of the analyses performed on evaporative
concentrates (Chapter 4), fresh skim milk as a function of temperature (Chapter 5) and
UF retentates and permeates (Chapter 6) are shown in each chapter respectively.
36
Figure 3.1 Composition of milk, evaporative concentrates and UF retentates separated
by ultracentrifugation (sCN, soluble casein)
3.2 Milk viscosity and the determination of casein micelle volume faction
The volume faction of casein micelle is an important parameter that was investigated in
this work. The relationship between casein micelle and its volume fraction is important,
both for viscosity to be used as a measure of micelle volume fraction, and conversely,
changes in the volume faction of casein micelles will affect the viscosity and therefore
impact on processing. Milk is a dilute emulsion of fat globules and a colloidal
suspension of casein micelles suspended in an aqueous solution of lactose and minerals.
The physical properties of milk are similar to those of water but are modified by the
presence of various solutes (proteins, salts and lactose and to a lesser extent the residual
fat droplets) in the continuous phase and by the alterations of the casein micelle
colloidal suspension (see Appendix for specific properties). Data on the physical
properties of milk are important as such parameters influence the design and operation
of dairy processing. It also can be used to determine physicochemical changes of
specific components in milk such as the total volume fraction occupied by the casein
micelles.
37
Under certain conditions, milk behaves as a Newtonian fluid, as described by this
equation:
(3.1)
Where: τshear is the shear stress,
γ is the shear rate,
ηc is the coefficient of viscosity.
The coefficient of viscosity for a Newtonian fluid is independent of shear rate but is
influenced by temperature and pressure. The coefficient of viscosity for whole milk and
skim milk are 2.127 mPa·s and 1.790 mPa·s respectively, for water and milk serum are
1.002 and 1.68 mPa·s respectively at 20 °C (Fox et al., 1998a).
The viscosity of milk and Newtonian milk products is influenced by composition,
concentration, pH, temperature, thermal history and processing operations. In skim
milk, casein is one of the principal contributors to the viscosity as it represents the
majority of the particulate volume fraction, with whey proteins and low molecular mass
species occupying less (Jeurnink & de Kruif, 1993). Einstein equation was used to
described the volume fraction of solid non-interacting spheres in highly dilute
dispersion, however, in more concentrated dispersions (such as skim milk), Eiler’s
equation is known to well describe the relationship between viscosity and volume
fraction (Anema, Lowe & Li, 2004; Krishnankutty Nair, Alexander, Dalgleish &
Corredig, 2014; Walstra et al., 1984):
(3.2)
Where: η0 is the coefficient of viscosity of the portion in the fluid consisting of water
and low molecular mass species,
φd is the volume fraction of all dispersed particles.
The volume fraction of any component is given by
(3.3)
Where: Vi is the voluminosity of component i,
38
cvi is the volume concentration of the component in the product.
The volume fraction of different components in milk system is given by
(3.4)
Where: φf, φc, φw, and φl are the volume fractions of fat, casein, whey proteins and lactose
respectively.
φmax in equation 3.2 is the hypothetical maximum volume fraction. It is the volume
fraction that could be occupied by the close packing of the representative particles. To
apply Eiler’s equation to milk system, it is necessary to have a reasonable estimate of
φmax, which has been found to be 0.79 (Snoeren, Damman & Kolk, 1982) and used for
original and concentrated milk systems (Krishnankutty Nair et al., 2014; Snoeren &
Damman, 1984; Snoeren et al., 1982). The relative viscosity measurements were
performed by using a capillary viscometry as described in section 4.2.5.
3.3 Turbidity
The turbidity is a reliable and repeatable technique which can detect real-time
alterations of milk samples in the native concentration (i.e. measurements can be
obtained without requiring dilution). To interpret turbidity data in meaningful way, it is
necessary to understand what contributes to the turbidity. Due to absorption and
scattering of light by the suspended particles in solution, turbidity by definition is the
extinction or reduction in intensity of light transmitted through a suspension of length L.
Sometimes, when light with a particular wavelength hits particles in solution and
converted into heat instead of being propagated or scattered, absorption occurs.
Compared to light scattering, in the turbidity measurements the absorption is assumed to
be negligible. The turbidity is defined by Lamber-Beer law as below (Kerker, 1969):
(3.5)
Where: I is the incident light intensity,
I0 the transmitted light intensity,
τ is the turbidity,
39
L is the pathlength of the light through the scattering suspension.
For a uniform particle:
(3.6)
Where: n is the number concentration,
Csca is the light scattering cross-section.
And the Csca for spherical particles can be described as:
(3.7)
Where: Qsca is the scattering coefficient which depends on the relative refractive index,
a is the particle radius.
As the volume fraction of a spherical particle is:
(3.8)
The turbidity for mono-dispersed spherical particles with radius ‘a’ is
(3.9)
Based on the discussion above, the turbidity is dependent on the concentration, as well
as the size, number and relative refractive index of the particles. In skim milk system,
casein micelle is the only significant contributor to turbidity (Martin, 2008), therefore,
various investigations on casein micelles alterations have been done by monitoring
turbidity changes (Huppertz & de Kruif, 2007; Mizuno & Lucey, 2005; Orlien et al.,
2006; Regnault, Thiebaud, Dumay & Cheftel, 2004).
An analytical spectrophotometer was used for turbidity measurement in this study.
Longer wavelength results in less light scattering allowing measurements to be
performed at higher concentrations, and avoids absorbance by proteins that occurs at
lower wavelengths (Martin, 2008). As the upper wavelength limit (900 nm) of the
available spectrophotometer did not operate stably, 860 nm was selected. Skim milk
samples were investigated in a relative short pathlength 2 mm cuvette to minimize the
effect of multiple scattering from the dense suspension. The standard spectrophotometer
40
data is absorbance, and it can be converted to turbidity (with a unit of length-1
) by using
the following equation when assuming light absorbance is negligible compared to
scattering.
(3.10)
Where Lc is the pathlength of light through the suspension in cuvette,
Abs is the spectrophotometer value of absorbance.
3.4 Dynamic Light Scattering
Dynamic light scattering (DLS) or known as Photon Correlation Spectroscopy (PCS) is
a technique for measuring particle size in a solution. As shown in Figure 3.2, a DLS
system comprises of several components including laser, attenuator, detector and
collector. The laser (with a single wavelength) is used to illuminate the samples and the
attenuator is used to adjust the intensity. The size of a particle can be calculated by
using the Stokes-Einstein equation:
(3.11)
Where: d (H) is the hydrodynamic diameter,
D is the translational diffusion coefficient,
k is the Boltzmann’s constant,
T is the absolute temperature,
η is the viscosity.
The translational diffusion coefficient D can be determined by correlating the
movement of particles with time according to the following equation (Finsy, 1994):
(3.12)
Where: A is the baseline at infinite time,
B is the amplitude,
41
q is the scattering vector,
D is the translational diffusion coefficient,
t is the time delay.
Unique correlation function with a single exponential decay can be generated from each
mono-disperse population of particle sizes. An algorithm is then used to trial different
sets of correlation functions and the best set corresponding to a particle size distribution
is then presented as the result.
Figure 3.2 Simplified schematic of dynamic light scattering set-up
As casein micelles undergo Brownian motion in milk system, the hydrodynamic size
can be measured by DLS. To avoid a faster decay of the autocorrelation function, which
42
results from multiple-scattered signal in concentrated samples (Finsy, 1994), it is
necessary to dilute milk samples in DLS measurements. Therefore, different diluting
buffers were used in this study including UF permeate (Anema et al., 2005), simulated
milk ultrafiltrate (SMUF) (K2HPO4 1.58 g·L-1
, K2SO4 0.18 g·L-1
, K2CO3 0.30 g·L-1
, K3
citrate · H2O 1.2 g·L-1
, CaCl 0.74 g·L-1
, KCl 0.6 g·L-1
, Na3 citrate·2H2O 1.79 g·L-1
,
MgCl2·6H2O 0.65 g·L-1
which was adjusted to pH 6.6 using KOH) (Jenness & Koops,
1962; Regnault et al., 2004) and simplified simulated ultrafiltrate buffer (Tris base 0.02
mol·L-1
, NaCl 0.05 mol·L-1
, CaCl2 0.003 mol·L-1
which was adjusted to pH 6.7 using
0.1 mol·L-1
HCl) (Martin et al., 2007) to minimize the dissociation of casein micelles
during dilution due to ionic strength alterations. (Large fat globules are removed from
skim milk samples, and the remaining small fat globules only scatter little light and
create minor interference (Martin, 2008).) An intensity-based size distribution was used
in this study, which tends to emphasise relative large particles as they scatter more
lights than small ones.
3.5 Ultracentrifugation
As discussed above, ultracentrifugation was employed thoroughout this work as the
mean of separating casein micelles from the serum to determine alterations to casein
micelles and the partitioning of different micelle components. It is particularly powerful
for this purpose as it can be applied to milk and milk concentrates in their native state
(i.e. temperature and concentration). It has been reported that casein micelles can be
fractionated by ultracentrifugation as a pellet (Corredig & Dalgleish, 1996; Huppertz et
al., 2007; Park et al., 1996; Philippe et al., 2005) from serum by using different
centrifuge regimes. Although exact determination of the sedimentation times of
different micelles was not possible owing to the complex geometry, Stokes law can be
used to provide estimates of the sedimentation times of micelles of different sizes:
(3.13)
Where: Vg is the terminal setting velocity of a particle,
H is the effective setting height for the particle,
d is the effective Stokes diameter of the particle,
43
te is the effective setting time for the particle,
Δρ is the density difference between the solid particle and suspending fluid,
(the density of casein micelle: 1253.1 Kg·m-3
, the density of casein free serum:
1026.4 Kg·m-3
at 25 °C (Ford, Ramsdell & Alexander, 1959; Martin, 2008))
g is the gravitational acceleration,
ηcp is the viscosity of the continuous phase (the viscosity of the milk ultrafiltrate:
0.001143 Kg·m-1
·s-1
at 25 °C (Martin, 2008)).
The effective setting time for a particle can be calculated as:
(3.14)
Figure 3.3 Geometry of Ultracentrifuge rotor 90 Ti (Beckman Instruments Inc., Palo
Alto, CA, USA) used in this study (rmin=34.2 mm, rav=55.4 mm, rmax=76.5 mm)
The average pelleted casein micelle size for a certain period of centrifugation time is
dependent on the density, viscosity, gravitational acceleration, and average
centrifugation travel path length. The average pelleted casein micelle size can be
calculated by:
44
(4.15)
Where: dave is the average pelleted casein micelle size,
Have is the average centrifugation path length of casein micelles.
Exact separation of the casein micelles from milk serum by ultracentrifugation is not
straightforward, and many different combinations of centrifugation speed and time
(from 60,000 g 40 min to 100,000 g 90 min) have been reported in the literature for this
purpose (Corredig et al., 1996; Huppertz et al., 2007; Park et al., 1996; Philippe et al.,
2005). If insufficient centrifugation force is applied incomplete palletisation of the
micelles will be achieved, whereas if the centrifugation force is too great, the micelles
will be compressed and true measures of micelle hydration will not be obtained. In this
study 35,000 rpm was used in the rotor shown in Figure 3.3 with a centrifugation force
of 75,940 g on average (ca 76,000 g). To verify and determine the most effective
micelle pelletisation conditions, a series of ultracentrifugation tests were performed as a
function of centrifugation time. Comparison of the pelletisation and investigation of the
potential compression of casein micelles during ultracentrifugation were performed to
ensure that a consistent evaluation could be applied across the different temperatures
and concentrations of the milk samples to be tested. The soluble casein concentration in
the supernatant and the pelleted micelle hydration were measured. The protein
concentration in the supernatant was determined by SDS-PAGE (see section 4.2.3) and
the hydration of the pelleted micelle phase was measured by mass balance of the pellet
before and after drying (105 °C, 24 h) (see section 4.2.2). As the upper temperature
limit for ultracentrifugation is 40 °C, original skim milk samples were ultracentrifuged
at 10, 20 and 40 °C respectively. As shown in Figure 3.4, at both 10 °C and 20 °C, at
least 60 min of centrifugation was required to achieve complete pelletisation of micellar
caseins. However, at long centrifugation times, compression of casein micelles was
evident as a reduction in the pelleted water (Table 3.1). At 40 °C, after 39 min of
ultracentrifugation, the consistent pelletisation was achieved throughout the range of
times investigated (Figure 3.4), with no evidence of micelle compression (Table 3.1)
due to the already relatively dehydrated states of the micelles at this temperature (which
will be discussed in Chapter 5).
45
In order to pellet the micellar materials from the serum of original milk and get
comparable hydration results, a centrifugation time of 60 min was used in Chapter 4,
Chapter 6 and Chapter 7. In chapter 5 the only variable that was tested was the
temperature. As such, the ultracentrifugation time were adjusted to account for the
change in viscosity of the solvent as function of temperature. To fractionate the casein
micelles into broadly different sizes based on different centrifugation (details discussed
in section 5.2.2), ultracentrifugation was performed for 78 min at 10 °C and 39 min at
40 °C at different rotational speeds in accordance to Stokes law.
Figure 3.4 The amount of soluble caseins in the supernatants of original skim milk after
different period of ultracentrifugation at 10 °C (), 20 °C () and 40°C () relative to
the 90 min ultracentrifuged milk samples. Error bars represent the standard deviation of
duplicate measurements of a single sample.
0.6
0.7
0.8
0.9
1.0
1.1
1.2
1.3
1.4
1.5
20 40 60 80 100
Re
lati
ve a
mo
un
t o
f so
lub
le c
ase
ins
in
sup
ern
atan
t
Centrifugation time (min)
46
Table 3.1 Pelleted micelle hydration of skim milk after different period of
ultracentrifugation
Sample (Temperature, centrifugation time) Micelle Hydration (g water/g solids)
10 °C-30 min 3.22±0.23
10 °C-60 min 2.91±0.14
10 °C-78 min 2.89±0.19
10 °C-90 min 2.57±0.16
20 °C-30 min 2.72±0.21
20 °C-60 min 2.50±0.13
20 °C-78 min 2.49±0.18
20 °C-90 min 2.27±0.15
40 °C-30 min 2.08±0.10
40 °C-39 min 2.04±0.07
40 °C-60 min 2.05±0.05
40 °C-90 min 2.04±0.06
Errors represent the standard deviation of duplicate measurements of a single sample
During vacuum evaporation and ultrafiltration, milk is concentrated and its viscosity
increases. To verify the ultracentrifugation condition (most importantly the
centrifugation time), the micelle hydration and the soluble protein concentration in the
supernatant were measured for a 42 % total solids (TS) content evaporative
concentrated milk (30 min, 60 min and 90 min of ultracentrifugation respectively at
40 °C) and four-fold concentrated (CF4) UF retentates generated at 10 °C and 40 °C UF
respectively (30, 60, 78, and 90 min for 10 °C ultracentrifugation and 30, 40, 60 and 90
min for 40 °C ultracentrifugation).
As shown in Figure 3.5 and Table 3.2, after 60 min ultracentrifugation, the soluble
casein concentration in the supernatant of both UF retentates and evaporative
concentrated milk was stable up to 90 min ultracentrifugation. This indicates that the
casein micelles were properly pelleted after 60 min of centrifugation. The hydration
showed no change at 40 °C after 60 min of centrifugation, and it decreased at 10 °C
centrifugation as a function of time, which suggested a compression of the casein
micelles at long centrifugation times. These results show that 60 min of
ultracentrifugation is able to separate micellar caseins from concentrated milk samples
47
and get comparable hydration trends. In order to separate casein micelles from milk
system and to study the micelle hydration changes, milk concentrates were
ultracentrifuged for 60 min in both Chapter 4 and Chapter 6.
Figure 3.5 The amount of soluble caseins in the supernatants of ultrafiltered CF4
retentates and evaporative concentrated skim milk (42% TS). CF4 retentate at 10 °C ()
and 40°C () and evaporative concentrated skim milk (42% TS) at 40 °C () after
different period of ultracentrifugation relative to the 90 min ultracentrifuged milk
samples. Error bars represent the standard deviation of duplicate measurements of a
single sample.
0.6
0.7
0.8
0.9
1.0
1.1
1.2
1.3
1.4
1.5
20 40 60 80 100
Re
lati
ve a
mo
un
t o
f so
lub
le c
ase
ins
in
sup
ern
atan
t
Centrifugation time (min)
48
Table 3.2 Pelleted micelle hydration of concentrated milk samples after different period
of ultracentrifugation
Sample (Temperature, centrifugation time) Micelle Hydration (g water/g solids)
CF4-10 °C-30 min 3.43±0.17
CF4-10 °C-60 min 3.30±0.11
CF4-10 °C-78 min 3.26±0.10
CF4-10 °C-90 min 3.12±0.08
CF4-40 °C-30 min 2.24±0.15
CF4-40 °C-39 min 2.25±0.07
CF4-40 °C-60 min 2.23±0.09
CF4-40 °C-90 min 2.25±0.06
42% TS-40 °C-30 min 1.39±0.12
42% TS -40 °C-60 min 1.21±0.07
42% TS -40 °C-90 min 1.20±0.09
Errors represent the standard deviation of duplicate measurements of a single sample
3.6 Calcium measurement
As mentioned in section 2.1.5, milk contains colloidal minerals and soluble minerals in
the system. It has been shown that calcium exists as micellar calcium and serum
(soluble) calcium in milk (Wahlgren, Dejmek & Drakenberg, 1990; Yamauchi, Yoneda,
Koga & Tsugo, 1969). The micellar calcium is the calcium bound to the casein micelles,
and it is assumed to be associated with phosphate as CCP, whilst the serum (soluble)
calcium includes ionic calcium, calcium-anion complexes and calcium associated with
serum caseins (Martin, 2008; Wahlgren et al., 1990). In this study, changes in the
partitioning of calcium between serum and micelle phase were well investigated.
Atomic absorption spectroscopy (AAS) is now a routinely and widely employed
technique for trace analysis of complex liquid samples and has been widely used for
dairy products (Jeng, Lee & Lin, 1994; Murthy & Rhea, 1967; Murthy & Rhea, 1968).
In this thesis, the calcium content of different milk samples was determined by using
AAS (see section 4.2.4). Lanthanum is a releasing agent which releases calcium from
phosphates, and it was added to overcome the interferences of phosphates (Welch,
Hamar & Fettman, 1990).
49
3.7 Lactose measurement
The lactose content in milk samples and in casein micelles was measured by using
enzymatic method. Skim milk samples and resuspended ultracentrifugation pelleted
casein micelles were deproteinated following the ISO standard (ISO 5764/IDF 79-part
2). Carrez reagents which have proven to be very effective in removing turbid
impurities and in breaking up emulsions (Kleyn, 1985) were used to remove proteins.
Lactose in these pre-treated samples was then hydrolysed to glucose and galactose by
using lactase. The galactose was subsequently oxidized and generate colour (OD 570
nm). Lactose amount was then plotted verses absorption readings. Background control
was necessary to correct the free galactose reading in the samples.
3.8 SDS-PAGE and Native-PAGE
Polyacrylamide gel electrophoresis (PAGE) is a widely used technique to separate
proteins. It is based on the different mobility of macromolecules through the gel, which
is depending on the size, conformation and charge of the proteins. In sodium dodecyl
sulphate polyacrylamide gel electrophoresis (SDS-PAGE), SDS is used to denature,
linearize and impact charge on the proteins. In Native-PAGE, the conformation of
proteins or protein complexes remains intact. In this study, both SDS-PAGE (see
section 4.2.3) and native-PAGE (see section 6.2.4) were used in this study to determine
the relative concentration of proteins in milk samples in both denatured and native states.
50
4 Evaporative concentration of skim milk: Effect on casein micelle
hydration, composition, and size
(This Chapter has been published as Liu, D. Z., Dunstan, D. E., & Martin, G. J. O.
(2012). Evaporative concentration of skimmed milk: Effect on casein micelle hydration,
composition, and size. Food Chemistry, 134 (3), 1446-1452.)
4.1 Introduction
As discussed in Chapter 2, evaporative concentration is an important step in milk
processing, which is used to reduce the content of water economically. It alters the
physicochemical state of the milk, affecting process relevant properties such as viscosity,
and influencing the functional properties of the end products. As mentioned above, the
casein micelles which consist of four different proteins (αs1-, αs2-, β-, and κ-casein), and
colloidal calcium phosphate (CCP) (Bouchoux et al., 2010; Dalgleish, 2011a), have the
greatest impact on the macroscopic and functional properties of skim milk. However,
little is currently known about how the physicochemical properties of the casein
micelles change in response to evaporative concentration.
The casein micelles have highly hydrated internal structures which consist
predominantly of αs1-, αs2-, and β-casein and nanoclusters of colloidal calcium
phosphate, while the κ-casein is located preferentially on the micelle surface (Dalgleish,
2011a). Studying the effect of the combination of heating and water removal during
evaporative concentration on casein micelles would improve the understanding of the
behaviour of casein micelle during concentration and ultimately the properties of the
resulting products.
In this chapter, the effect of evaporative concentration on the hydration, composition
and size of casein micelles in fresh skim milk were examined for the first time. The
hydration and composition of casein micelles in concentrated milk was first investigated
by direct analysis of a series of concentrate samples. Additional experiments were
performed on samples re-diluted with water back to the original concentration to
examine the extent and rate of reversibility.
51
4.2 Materials and methods
To gain new knowledge into the alterations of casein micelles during evaporative
concentration a systematic approach had to be developed. A series of preparative and
analytical steps were performed for this purpose as outlined in Figure 4.1.
Figure 4.1 Analyses performed on evaporative concentrates
4.2.1 Skim milk and concentrated skim milk samples
Fresh skim milk was purchased from local supermarket with 33 g·L-1
protein, 1.5 g·L-1
total fat and 52 g·L-1
carbohydrate. All analyses were performed within two days of
purchase after first bringing the samples to room temperature and then allowing them to
equilibrate at this temperature for at least 1 hour. Skimmed milk samples were
concentrated at 50 °C in a rotary evaporator at 355±5 Torr (47.32±0.67 kPa) for
different times to acquire different concentrations of milk. Total solids content of the
samples was determined by oven drying 24 hours at 105 °C. Redilution of concentrated
samples back to the concentration of the original skimmed milk sample was done by
accurately replacing the mass lost though evaporation with distilled water.
52
4.2.2 Casein micelle hydration rate and mass balance
Accurately weighed samples of skimmed milk concentrates were added to pre-weighed
centrifuged tubes and ultracentrifuged at 35,000 rpm (75,940 g average) for 1 hour at
40 °C for concentrated samples and 20 °C for re-diluted samples (Ultra 90, 90 Ti rotor,
Beckman Instruments Inc., Palo Alto, CA). The supernatant was carefully removed and
the mass of the wet pellet determined. The pellet was dried at 105 °C for 24 hours in the
oven and the mass for the dry pellet recorded.
4.2.3 SDS-PAGE
Casein micelles were separated from the milk serum by ultracentrifugation (as described
in section 4.2.2). The protein content of the supernatants was analysed by SDS-PAGE
using a BioRad Criterion Cell electrophoresis unit (BioRad Laboratories, Richmond,
CA, USA). The SDS-PAGE was performed by diluting sample in 1 mM EDTA (pH 8)
buffer. First, 20 µl of diluted samples were mixed with 20 µl of BioRad Laemmli buffer
containing 5% beta mercaptoethanol and placed in a boiling water bath for 5 min. Next
aliquots (10 µl) of samples were loaded into 8-16% linear gradient precast Tris-HCl
criterion 18 well gels and run at 100 V for 130 min. Gels were stained with Biosafe
Coomassie Blue (BioRad, Laboratories, Richmond, CA, USA) and digitally scanned
and quantified using a BioRad Gel Dox XR + Imager (BioRad Laboratories, Richmond,
CA, USA).
4.2.4 Calcium measurement
Proteins remaining in the supernatants from ultracentrifuation were precipitated by
mixing 0.5 g supernatant with 5.5 g of 24% (w/w) trichloroacetic acid (TCA) and 4.5 g
distilled water. Precipitated protein was removed by vacuum filtration through
Whatman No. 1 filter paper with the filtrate collected in a pre-weighed flask. The
proteins on the filter paper were washed with 2 g of 12% (w/w) TCA solution and the
total mass of filtrate recorded. Filtrate samples (4 g) were then mixed with LaCl3
suppressant (2 g) and water (16 g). The calcium content was determined accompanied
with commercially available AAS calcium standards (Fluka, Sigma-Aldrich) by AAS at
422.7 nm using a Varian AA 140 (Agilent Technologies, Santa Clara, CA) with an air
acetylene flame.
53
4.2.5 Turbidity and viscosity measurements
Turbidity was measured by transmission of light (860 nm) through a 2 mm pathlength
quartz cuvette using Cary 3E UV-Visible spectrophotometer. The relative turbidity was
determined by dividing the turbidity of re-diluted milk concentrates by the turbidity of
the original skimmed milk sample. Since only alterations to the casein micelles were of
interest, variation resulting from differences in the fat content of different samples was
avoided by subtracting the turbidity of the fat globules. To measure the turbidity
contributed by the fat globules, samples were diluted 10 fold in 10 g·L-1
EDTA buffer
adjusted to pH 7. The relative turbidity was therefore calculated as follows:
(4.1)
Where: τsample and τskim are the turbidity of the re-diluted milk concentrate sample and
the original skim milk respectively,
τsample fat and τskim fat are the turbidity of the re-diluted milk concentrate sample
and the original skim milk diluted in EDTA multiplied by 10 to account for the dilution.
Viscosity data was obtained by capillary viscometry (type 531-03/0c, Schott AG),
performed in triplicate at 25 °C.
4.2.6 Particle size analysis
Hydrodynamic particle size analysis was performed by photon correlation spectroscopy
using a Malvern Autosizer 4700 PCS (Malvern instruments Ltd., Malvern,
Worcestershire, United Kingdom) with a 488 nm laser. Light was measured at
scattering angle of 90 ° and the temperature was maintained at 25 °C. Data presented
are the intensity weighted average particle size calculated by the method of cumulants.
Samples were diluted to approximately 1/10,000 of the concentration of the original
skim milk in a simplified simulated milk ultrafiltrate buffer (as described in section 3.4).
54
4.3 Results
4.3.1 Direct measurements of concentrated milk
Three different samples of skim milk were evaporated to different solids concentration
at 50 °C under vacuum. It took approximately 20, 35, 40 and 43 min to reach 14%, 25%,
35% and 40% TS, respectively. To prevent lactose crystallisation, samples of
concentrates were kept at 50 °C until ultracentrifugation and were maintained at 40 °C
during ultracentrifugation. Supernatants were carefully removed and an analysis of the
total mass of the pellet and the amount of solid material in the pellet was performed by
oven drying overnight (24 h). The hydration of the pellets (mass of water per mass of
total solids) was seen to decrease steadily from approximately 2.5 g/g for fresh
skimmed milk to about 1.2 g/g for skimmed milk concentrated to 42% (w/w) solids
(Figure 4.2A). A change in the mass fraction of total milk solids included in the pellets
as a function of concentration could not be observed within the limits of accuracy of the
data (Figure 4.2A). From this data the relative removal of water from the supernatant
and pellet fractions was determined. Removal of water from the supernatant accounts
for the majority of water removed and is approximately in line with the overall amount
of water removed from the milk (Figure 4.2B). Despite the scatter in the data, it is clear
that the removal of water from the pellet was considerably lower than that removed
from the supernatant across the entire range of concentrations. Water was therefore
removed from the serum in preference to removal from the micelles.
55
Figure 4.2 Hydration and water content of casein micelles during evaporation.
Hydration of the pellets (closed symbols) and mass fraction of total solids that are
pelleted (open symbols) during ultracentrifugation of concentrates kept at 40 °C as a
function of solids content (A). Percentage of original water in the supernatant (closed
symbols) and pellet (open symbols) fractions that remain after evaporative
concentration (B). Dashed line represents the overall percentage of water that is
removed as a function of solids concentration. Solid line is a guide for the eye. Different
symbols are the results from three separate fresh skim milk samples.
56
The concentration of calcium and casein in the supernatants from concentrates
ultracentrifuged at 40 °C were measured. This information was combined with the
known volume of supernatants so that the total amount of calcium and casein in the
supernatants could be determined. As the concentration of calcium increased during
evaporative concentration, the relative amount of total calcium in the supernatant
decreased as a function of water removal (Figure 4.3). At about 34% TS, less than 40%
of the serum calcium present in the fresh skim milk samples remained in the supernatant.
The relative amount of total casein in supernatants, as determined by SDS-PAGE
analysis, also decreased upon evaporative concentration. In contrast to the serum
calcium, the casein concentration appeared to decrease to below 40% of the original
immediately upon concentration to 12% solids and then remained between 40% and 50%
above 25% solids (Figure 4.3). The low concentration samples (12% and 16% solids)
were kept at 50 °C for an additional 1-1.5 h compared to the high concentration samples
(28% and 33% solids), which may explain the lower level of soluble casein in these
samples.
Figure 4.3 Total serum calcium and casein in the supernatant during evaporation.
Total amount of serum calcium () and casein () in the supernatant relative to the
supernatant of original skim milk. Error bars are the standard deviation of duplicate
SDS-PAGE analysis. Measurement error was negligible for the calcium data.
57
4.3.2 Measurements of re-diluted concentrated milk
The results above suggest that a number of important changes to the casein-mineral
system occur during evaporative concentration. To obtain a more complete
understanding of this behaviour, including insight into the reversibility, analyses were
preformed on concentrates rediluted to the solids concentration of the original skimmed
milk samples by addition of distilled water. The first of these analyses was an
examination of pellet hydration to understand whether or not the micelles can be fully
and rapidly rehydrated. The total amount of water and solids associated with the pellet
returned to 92% and 99%, respectively, of that in the original skim milk within the time
constraints of measurement (i.e. ca 1h) (Table 4.1). The micelle in the rediluted
concentrates were mostly but not completely rehydrated (ca 2.6 g water/g solids) relative to
those in the original milk (ca 2.8 g water/g solids).
Table 4.1 Rehydration of casein micelles upon redilution of concentrated skim milk.
Comparison of pelleted solids, pelleted water, and pellet hydration for ultracentrifuged
skim milk and a corresponding sample of concentrate (34% TS) rediluted to 8.7% TS.
Sample Pellet hydration (g
water/g solids)
Pelleted solids1
(g/100 g skim)
Pelleted water1
(g/ 100 g skim)
Original skim milk 2.78±0.025 3.01±0.005 8.37±0.09
34% Concentrate2 2.60±0.002 2.97±0.01 7.73±0.02
1 Mass of solids pelleted per 100 g of original skim milk used to produce concentrate.
2 rediluted to 8.7% and immediately ultracentrifuged
Error represents the standard deviation of triplicate measurements.
The size of casein micelles in the concentrated samples could not be measured directly
by conventional dynamic light scattering as they are too optically dense. Turbidity and
dynamic light scattering measurements were performed immediately upon redilution of
concentrate samples, giving information about the immediate reversibility of alteration
caused by concentration. The considerable amount of water removed from the micelles
(Figure 4.2) indicates the micelles must be in a contracted state in the concentrates. As
58
the micelles were almost fully rehydrated upon redilution (Table 4.1) a somewhat
similar micelle size would be expected. Measurements of casein micelle size were
performed with about 3 min of diluting the concentrates to about 1/10,000 of the
original skim milk concentration in simplified simulated ultrafiltrate buffer (described
in section 3.4). The average micelle size in rediluted samples initially decreased slightly
(ca 5%) as a function of evaporative concentration up to about 25% solids, above which
the size started to increase. The turbidity of samples diluted back to the original
concentration (8.7% TS) by addition of water were higher than the original milk and
showed a steady increase as a function of solids concentration (Figure 4.4).
Figure 4.4 Turbidity and average micelle size of rediluted evaporative concentrated milk.
Turbidity (open symbols) and average micelle size (closed symbols) of concentrated
skim milk samples diluted to the original solids concentration relative to the un-
concentrated skim milk samples. The different symbols represent data obtained from
different batches of skim milk. Error bars represent the standard deviation of at least
duplicate PCS measurements. Measurement error was negligible for the turbidity data.
Turbidity was corrected for the presence of fat globules.
59
Due to experimental constraints imposed by ultracentrifugation it was not possible to
acquire supernatant samples immediately upon redilution. Instead, supernatant samples
were obtained for a range of concentrate samples 2.5 h after redilution to original
concentration. The concentration of calcium and casein in the supernatants were
measured. After redilution for 2.5 h, the amount of calcium in the supernatant had
returned to its initial values for both the 12% and 20% samples and was very close for
the 45% samples (Figure 4.5). The amount of casein however, remained considerably
below the initial values for all samples.
Figure 4.5 Total serum calcium and casein in the supernatants of rediluted evaporative
concentrates. Total amount of serum calcium () and casein (CN) () in the
supernatants of rediluted concentrates relative to those of the original skim milk.
Concentrated samples were rediluted with distilled water back to 8.7% solids and left to
equilibrate for 2.5 h before ultracentrifugation. Error bars are the standard deviation of
duplicate SDS-PAGE analyses. Measurement error was negligible for the calcium data.
To further investigate post dilution reversibility, detailed kinetic studies were performed
on samples concentrated to ca 40% solids. The average particle size, turbidity, viscosity
60
and pH of a sample concentrated to 39% solids were measured as a function of time
after re-dilution to the original concentration. The average particle size was initially
higher than that of the original milk and dropped to close to that of the original milk
with the first hour after redilution (Figure 4.6A). The viscosity, however, remained
relatively constant and slightly below that of the original skim milk. The turbidity of
rediluted milk decreased particularly rapidly during the first 20 min or so and then
continued to drop more slowly, eventually dropping below the turbidity of the original
skim milk (Figure 4.6B). The turbidity presented here did not match the results in
Figure 4.4, owing to the fact that a correction for the presence of fat globules was not
applied. It is not entirely clear why the initial particle size of the 39% solid sample
examined in the kinetic study (Figure 4.6A) was higher than that previously observed
for similar samples (Figure 4.4). This could be due to a slight difference in experimental
procedure-the kinetic study sample was initially rediluted with water before dilution in
buffer for DLS measurement, whereas the other samples were immediately diluted in
DLS buffer containing minerals.
The pH initially increased in a similar manner to the decrease in turbidity, but instead
appeared to stabilise close to the original pH after about 2 h (Figure 4.6B). The amount
of soluble casein in the supernatants was determined for two samples concentrated to
similar solids content and shown to slowly increase from about 40% to about 50% of
that in supernatants of the original skim milk (Figure 4.6C).
61
Figure 4.6 Relative alterations of average micelle size, viscosity, pH, turbidity and
soluble caseins of rediluted evaporative concentrates.
Relative average micelle size () and viscosity () of skim milk rediluted to original
concentration (8.7 % solids w/w) from concentrates of 39% solids (w/w) as a function
of time after redilution (A). Relative alterations of turbidity () and pH () of skim
milk rediluted to original concentration (8.7 % solids w/w) from concentrates of 45%
+/- 1% solids (w/w) () as a function of time after redilution (B). Turbidity was not
corrected for fat globules. The concentration of casein in the supernatants of a 42% ()
and a 44% () concentrate relative to that of the original skim milk as a function of
time after re-dilution to 8.7% solids (C). Error bars are the standard deviation of
duplicate SDS-PAGE analyses.
62
4.4 Discussion
4.4.1 Hydration of casein micelles
Water in milk is found in two important stores, as inter-micellar water of the serum and
the intra-micellar water associated with the micelles. In the serum of native skim milk,
much of the water can be considered unstructured bulk water with only a portion of the
molecules associated with the lactose, whey proteins and various milk salts (Fox et al.,
1998a). The micellar water occupies the internal ‘channels’ (Dalgleish, 2011a) as well
as being associated with both the internal and external hydrophilic components,
including the CCP, internal casein, and hairy layer. While it has long been recognised
that water removal could cause shrinkage of micelles (Morr, 1975) direct quantification
of the extent of micelle dehydration as a function of evaporation does not appear to have
been performed. The fundamental effect of evaporative concentration of skim milk is
simply the removal of water. It is clear from these results (Figure 4.2) that both intra-
and inter-micellar water were removed and that water was removed preferentially from
the serum. It appears reasonable that the free water in the bulk serum will be more
mobile and available for evaporation than the water bound within micelles. This has the
effect that water within the micelles is only removed after much of the bulk water has
been evaporated. As a result of this, the inter-micelle distance must be less, and the
micelle size must be greater, than would be expected if water was removed equally from
within and outside the casein micelles. This observation should help explain the
rheological behaviour of concentrated milk systems.
The redilution results show that the micelles rapidly regained most of their original
water content upon dilution to the original concentration. There was a lower micelle
hydration of the rediluted milk samples, which is presumably due to a denser micelle
structure that includes a greater proportion of both CCP and casein (Figure 4.3). The
viscosity results confirm this interpretation as the rediluted samples show a lower
viscosity, indicative of a lower volume fraction, than the original skim milk even after
dilution for 5 h (Figure 4.6A). This shows that irreversible changes to the hydration and
structure of casein micelles occurred during evaporative concentration. The rapid
rehydration would suggest that the micelles behave somewhat like a sponge, quickly
absorbing water when it becomes available. This is in agreement with previous
observations in which fully dehydrated micelle in skim milk powder were indirectly
found to immediately rehydrate upon reconstitution (Martin et al., 2007). The
63
incomplete rehydration suggests that changes to the structure of the micelles must occur
to diminish the overall water holding capacity of the micelles. The fact that the
hydration data was obtained by ultracentrifuation suggests this change is not due solely
to a contraction of the hairy layer, since this layer would be compressed in the pellet.
Whether the decrease is associated with the water bound directly to the internal
components of the micelles or the water in the open internal spaces within the micelle is
not clear. It is possible that new protein associations are formed on water removal that
permanently collapse some of the open micelle structure as discussed in the sponge
model in Chapter 2.
4.4.2 Composition of casein micelles
In native skim milk only a small proportion of the casein is present in the serum. The
partitioning of casein between the micelles and the serum is highly temperature
dependent, with the amount of soluble casein decreasing with increasing temperature
(Ali et al., 1980; Creamer et al., 1977; Davies et al., 1983; Downey et al., 1970; Rose,
1968). Evaporative concentration invariably involves increasing the temperature of milk,
typically to 40-50 °C. It is therefore not surprising to have seen a decrease in the amount
of casein in the supernatants of concentrate samples (Figure 4.3). No direct attempt was
made in this chapter to separate the effects of heating and concentration and it is not
clear whether or not the increased temperature can entirely account for the observed
behaviour, in particular the irreversibility of the casein partitioning (Figure 4.5).
Irreversibility of protein partitioning was previously observed with reconstituted
skimmed milk powder (SMP) (Martin et al., 2007).
During evaporative concentration serum calcium will be driven from the serum to the
micelle via at least two mechanisms:
(1) The capacity of the mineral system to maintain serum calcium and phosphate
species will be reduced due to removal of water.
(2) The increased temperature lowers the solubility of calcium phosphate. The water
removal process clearly caused a reduction in the amount of serum calcium (Figure 4.3)
meaning an increase in the amount calcium associated with the micelles.
64
This has also been observed previously (Le Graët et al., 1982; Vujicic et al., 1966). It is
still unclear exactly how and where the additional calcium is deposited on the micelles.
It is not known for instance whether or not it associates directly with existing CCP
nanoclusters. In addition, as the mineral concentration in the serum rises due to
evaporation, the dynamics of the mineral equilibrium between CCP and the soluble
phase will be affected; however, information is incomplete and further investigation is
still required (Holt, de Kruif, Tuinier & Timmins, 2003; Nair, Alexander, Dalgleish &
Corredig, 2014). The increase in pH (Figure 4.6B) upon dilution is consistent with the
reversal of calcium back into the serum (Figure 4.5). The reversibility of the calcium
partitioning was seen for SMP, however the kinetics appeared to be much slower
(Martin et al., 2007).
Although it is evident that the contraction of micelles is almost immediately reversible
upon re-dilution, the reversibility of the calcium and caseins shows quite different
behaviours. The serum calcium returns to the serum completely over 1 h, while only a
small amount of the original soluble caseins return to the serum within 5 h. The slow
reversibility of the soluble casein may be due to increased associations that results from
both the contraction of the micelles due to water removal and the uptake of casein and
calcium resulting from the increased temperature.
4.4.3 Size of casein micelles
According to dynamic light scattering results on rediluted concentrates (Figure 4.4), the
micelle size appeared to decrease as a function of concentration up to about 25% TS and
then increase at higher concentrations. The reason for the decrease is likely to be an
overall contraction or shrinkage of the micelles due to the incomplete rehydration. This
is consistent with a lower viscosity as observed in this chapter (Figure 4.6A). The
increase in particle size at higher concentration, as measured by DLS, can be explained
by the presence of a small number of larger particles, perhaps formed from aggregation
of micelles. It has previously been observed that the size of the casein micelles in
concentrated milk can be affected by the holding time. One previous study looked at
particle size on diluted skim milk concentrates (45% TS) as a function of storage at
50 °C (Bienvenue et al., 2003). Samples immediately measured after concentration had
only one peak characteristic of casein micelles, whereas additional larger peaks (>500
65
nm) appeared after 6 h of storage, indicating aggregation of micelles. The increased
micelle size observed in the previous study on SMP (Martin et al., 2007) may have
resulted from the time kept under concentrated conditions. The concentrated samples in
that study were not able to be immediately analysed. Concentrates are often held for a
period of time before spray-drying, which could be the reason that the reconstituted
SMP micelles were larger compared to the results in this investigation here. Based on
these understandings, temperature effects on casein micelle were studied in the next
chapter.
The observed increase in turbidity (Figure 4.4) is most likely primarily due to an
increase in the micelle refractive index resulting from the increase in optically dense
CCP and casein. Any increase in particle size due to aggregation would also contribute
to the increase; however the overall decrease in volume fraction due to micelle
contraction would reduce it. The observed decrease in turbidity after redilution (Figure
4.6B) is consistent with the solubilisation of CCP, which would decrease the refractive
index. The eventual decrease of the turbidity below that of original skim milk (without a
continue increase in pH) would be consistent with a population of micelles that occupy
less total volume due to the micelles not being fully rehydrated. This could result in a
lower turbidity despite having a higher average size according to DLS results (Figure
4.6A) and an equivalent refractive index. The rapid initial decrease in turbidity appears
in part due to the initial decrease in micelle size (Figure 4.6A).
These results would suggest that the size of casein micelles is affected by two separate
mechanisms (shown in Figure 4.7). Firstly the micelles undergo contraction due to
water removal, which is not completely reversible upon redilution. This results in
micelles that must be considerably contracted in the concentrated state, and while
expanding upon rehydration, occupy a lower volume fraction than in fresh skim milk.
Secondly, at higher concentration micelles undergo some aggregation (or reformation
into larger micelles), that continues as a function of holding time at high concentration.
66
Figure 4.7 Casein micelle alterations during skim milk evaporative concentration and
re-dilution.
(Shading indicates the water content of the micelles, dark: less water, light: more water).
4.5 Conclusions
During evaporative concentration of skim milk, casein micelles were dehydrated; but
water was removed from the serum preferentially to removal from within the micelles.
The partitioning of both calcium and casein was shifted from the serum towards the
micellar phase. On reversal of the concentration process by re-dilution the micelles were
immediately rehydrated, although incompletely. The micelles remained somewhat
contracted, although the formation of some larger micelles was evident at higher solids
content. The alteration to the mineral balance and the presence of larger micelles were
less permanent, while loss of soluble casein was more permanent.
67
5 Temperature-dependent dynamics of bovine casein micelle in the
range 10-40 °C
(This Chapter has been published as Liu, D. Z., Weeks, M. G., Dunstan, D. E., &
Martin, G. J. O. (2013). Temperature-dependent dynamics of bovine casein micelles in
the range 10 – 40 °C. Food Chemistry, 141 (4), 4081-4086.)
5.1 Introduction
During the processing of milk, temperature is an important variable that affects a wide
range of physicochemical properties (Fox et al., 1998a). Whilst the native temperature
of bovine milk is 37 °C, it is usually stored cold (<10 °C) to control microbial growth.
The temperature can then be varied over a wide range during processing. Whilst heat
treatment of milk at temperatures above 70 °C can considerably alter the properties of
milk (Livney, Corredig & Dalgleish, 2003), changes in temperature below 50 °C also
have a significant effect on the various components of milk, including the casein.
Casein represents approximately 80% of the protein in milk and is predominantly
present in the form of large hydrated assemblies called casein micelles (CM) (Dalgleish,
2011a). CMs consist of four different species of casein proteins and calcium phosphate,
and are in dynamic equilibrium with the milk serum (Walstra, 1990). In particular,
calcium phosphate and casein are exchanged between the micelles and the serum, with
the partitioning of these components being influenced by temperature (Davies et al.,
1960; Rose, 1968).
The amount of calcium in the serum is known to decrease as a function of increasing
temperature, with calcium shifting from the serum into the micelles as CCP (Davies et
al., 1960; Rose et al., 1959). In a comprehensive study of the effect of temperature on
mineral balance in milk serum calcium was shown to decrease very rapidly (<2 min) as
a function of temperature on heating milk from 4 to 20-90 °C (Pouliot, Boulet & Paquin,
1989a). The reversibility on cooling of milk heated to 85 °C was considerably slower,
taking up to 60 min to reach 90-95% reversal; however, the reversibility of milk
warmed to 40 °C was not investigated (Pouliot et al., 1989b). Whilst the rate of
reversibility on cooling was attributed to the complex equilibrium between calcium
phosphate and citrate salts, it has also been shown that the rate of exchange of calcium
68
and phosphate between diffusible and colloidal phases is increased at higher
temperature (Zhang, Fujii & Aoki, 1996).
It is generally understood that casein dissociates from micelles at low temperature, and
that β-casein is the predominant protein released (Creamer et al., 1977; Downey et al.,
1970; Rose, 1968). Whilst the equilibrium between soluble and micellar casein is
known to be affected by temperature, the rate at which equilibrium is reached after
temperature change has not been properly investigated. In one study in which milk was
cooled from 37 to 0 or 5 °C, β-casein release was shown to occur over within about 60
min (Creamer et al., 1977). In contrast, the concentration of soluble casein was found to
continue to change at least 3 days after cooling milk from 20 °C to temperatures in the
range 4-15 °C (Ali et al., 1980). Casein released during storage at 4 °C has been shown
to be completely reversible after 18 h of incubation at 20 °C (Davies et al., 1983),
however the kinetics were not investigated.
In addition to affecting the partitioning of calcium and casein, the size and hydration of
casein micelles are also influenced by temperature. At high temperature (i.e. >70 °C)
attachment of denatured whey proteins and heat induced aggregation are known to
increase the hydrodynamic size of casein micelles (Anema et al., 2003; Tran Le, Saveyn,
Hoa & Van der Meeren, 2008). In the range 0-50 °C, casein micelle size is also affected
by temperature, but not due to interactions with whey protein. This temperature range is
particularly important for processing such as evaporative concentration and membrane
filtration of milk. Dynamic light scattering measurements performed at 6, 20, and 50 °C
showed the effect of temperature on micelle size to be different depending on the
dilution solvent used (milk ultrafiltrate, SMUF, or water) (Beliciu & Moraru, 2009). In
water or SMUF micelles were larger at increasing temperature. In UF permeate the
micelles were approximately the same size at 6 or 20 °C but considerably smaller at
50 °C. Whilst UF permeate should be closest to the native environment of the casein
micelles in undiluted milk, the permeates used in this study were not obtained at the
same temperature as the measurements and would therefore have an altered mineral
content (Beliciu et al., 2009). According to results obtained by differential
centrifugation, cooling of milk to 4 °C decreases the population of larger micelles and
increases the population of smaller micelles (Davies et al., 1983; Ono et al., 1990). This
effect was shown to be fully reversible upon re-warming to 20 °C after 18 h; however
no indication of the kinetics of this reversal was provided (Davies et al., 1983). It has
69
also been found that the apparent voluminosity of casein micelles decreases with
increasing temperature (Dewan, Bloomfield, Chudgar & Morr, 1973; Snoeren et al.,
1984; Walstra, 1979).
Detailed kinetic information on the effect of temperature on casein micelle has so far
been limited by difficulties in measuring changes to casein micelles occurring over
short time periods in native milk samples. In particular, direct real-time measurements
of soluble casein, serum calcium, micelle size and micelle hydration are not possible
using conventional methods. To obtain close to real-time information about changes to
casein micelles, pH and turbidity measurements were employed in this chapter. These
measurements have very short response times, are sensitive to small changes in casein
micelle properties and able to be applied in-situ on milk samples at native concentration.
As these methods give indirect information about changes that are occurring within the
skim milk system, the results need to be interpreted in the context of more
comprehensive information on the equilibrium relationship underlying the various
alterations as a function of temperature and an understanding of the physico-chemical
properties of the skim milk system. The pH of skim milk results from the mineral
system in the serum. Although complex, the predominant alteration effecting pH that
will result from changes in the temperature is the exchange of calcium between the CCP
in the casein micelles and the soluble calcium in the serum (Fox et al., 1998a):
2
4
2 HPOCa HCCP
In this way, pH can be used as an indirect indicator of the equilibration of the mineral
system, including the partitioning of calcium between the micelle and the serum. As
discussed in previous chapters, in skim milk the casein micelles are responsible for the
majority of the measured turbidity and therefore any variation in turbidity can be
attributed to changes in the casein micelles (Martin et al., 2007). In this chapter, a
comprehensive study of temperature dependent equilibrium changes to casein micelles
in skim milk is combined with real-time measurement of dynamics between 10 and
40 °C (as the upper limit for ultracentrifugation is 40 °C).
Whilst much is already known about the general effect of temperature on casein
micelles in bovine milk, most studies have examined only one selected aspect of the
casein system (e.g. casein partitioning or micelle size). In addition, information on the
cooling
heating
70
dynamics of the casein system in response to temperature changes is lacking. A detailed
comparison of kinetic response to heating and cooling within the low temperature range
has not been performed and highly time resolved information is yet to be obtained. In
this chapter, a comprehensive investigation was performed on the effect of temperature
on casein and calcium partitioning between the micelle and the serum as well as the size
and hydration of casein micelle. This study examines both the equilibrium and kinetic
aspects of calcium and casein alterations in response to temperature. By examining
whether there is temporal correlation between calcium and casein alterations in response
to temperature, a better understanding of the level of physical interconnection between
these two phenomena can be gained.
5.2 Materials and methods
A systematic approach was required to get new information relating to the kinetics of
the temperature dependence of casein micelles. Detailed summary of the analyses
performed on fresh milk as a function of temperature is shown in Figure 5.1.
Figure 5.1 Analysis performed on fresh skim milk as a function of temperature
71
5.2.1 Skim milk samples
Pasteurised fresh skim milk containing 33 g·L-1
protein, 1.5 g·L-1
total fat and 52 g·L-1
carbohydrate was purchased from a local supermarket and stored at ca 10 °C and
analysed within 2 days. For equilibrium studies, milk samples were held to the desired
temperature for at least one hour before commencing analysis.
5.2.2 Fraction of casein by centrifugation
Centrifugation of skim milk samples was performed using an Ultra 90 ultracentrifuge
fitted with 90 Ti rotor (Beckman Instruments Inc., Palo Alto, CA, USA). According to
Ono et al., (1990), to account for differences in sedimentation velocity resulting from
the dependence of viscosity on temperature, centrifugation times (shown in Table 5.1)
were adjusted based on the equations previously described in section 3.5. The casein
concentration in the supernatants was determined by densitometric analysis of SDS-
PAGE gels as described in section 4.2.3.
Table 5.1 Fractionation of definite sized micelles
Casein and Casein
Micelles maintained
in supernatant
Medium, Small
casein micelle,
Soluble1
Small casein
micelle, Soluble
Soluble
Centrifugation Force 5700 g 25000 g 75940 g
10 °C 78 min 78 min 78 min
20 °C 60 min 60 min 60 min
40 °C 39 min 39 min 39 min 1Large micelle is in the pellet
5.2.3 Casein micelle hydration and serum calcium measurement
Skim milk samples maintained at 10, 20, and 40 °C were centrifuged at 75,940 g for 78,
60, or 39 min respectively. The hydration of casein micelles was determined by
gravimetric analysis of supernatants and pellets as described in section 4.2.2, and the
calcium content of the supernatants determined by AAS as previously described in
section 4.2.4.
72
5.2.4 Determination of casein micelle volume fraction
Skim milk UF permeates were generated from skim milk equilibrated and maintained at
10, 20 and 40 °C±0.1 °C using Lab-scaleTM
TFF system (Millipore, Billerica, MA)
fitted with cutoff of 10 kDa regenerated cellulose membrane. The viscosity of skim
milk and the corresponding UF permeates were measured in triplicate at 10, 20 and
40 °C±0.1 °C by capillary viscometry (type 531-10, Schott AG). The volume fraction of
casein micelles was calculated on the basis of the relative viscosity of the skim milk and
UF permeates at each temperature according to Eiler’s equation as described in section
3.2.
5.2.5 Dynamic light scattering
Milk contains about 1.62 mg/kg riboflavin which fluoresces strongly on excitation by
light of wavelengths from 400 to 500 nm. This can affect the fluorescence and dynamic
light scattering (DLS) measurements in that wavelength range when milk ultrafiltration
permeates involved as riboflavin goes through the membrane during milk ultrafiltration.
Particle size analysis of the casein micelles was performed by photon correlation
spectroscopy of skim milk samples diluted 75 fold in UF permeates obtained at 10, 20
and 40 °C. The temperature during DLS measurements was maintained at 10, 20 and
40 °C respectively. Scattered light was measured at an angle of 90 ° using a Brookhaven
BI-9000AT autocorrelator with a BI-200M goniometer (Brookhaven Instruments
Corporation, Holtsville, NY) fitted with a 633 nm laser (to avoid the effect of
riboflavin). The intensity weighted average hydrodynamic particle size was determined
using the method of cumulants as previously described (Martin et al., 2007).
5.2.6 Turbidity and pH measurement
0.6 ml aliquot of skim milk sample was transferred into a 2 mm path length quartz
cuvette and the turbidity was measured as described in section 4.2.5. pH was measured
using Aqua-pH pH-mv-temperature meter (TPS Pty Ltd., Brisbane Australia) and a
temperature probe was fitted for automatic adjustments of temperatures involved in the
pH tests.
73
5.2.7 Temperature kinetic studies
For the kinetic studies, small samples (ca 30 ml) of skim milk were warmed to the
desired starting temperature and pre-equilibrated for at least 1 h, before being cooled or
further warmed in a thin walled plastic cylinder immersed in a water bath held at 10, 20
or 40 °C. Temperature and pH probes were immersed in the samples during
warming/cooling to allow simultaneous real-time measurements. To maximise
warming/cooling rate and the response time of the probes, samples were mixed using a
magnetic stirrer bar. For turbidity measurements, samples were quickly transferred to
the temperature equilibrated quartz cuvettes and immediately measured (<1 min).
5.3 Results and discussion
5.3.1 Micelle equilibrium as a function of temperature
Soluble calcium and pH both decreased as a function of increasing temperature between
10 to 40 °C (Figure 5.2A), in agreement with previous observations (Davies et al., 1960;
Pouliot et al., 1989a; Rose et al., 1959). This is consistent with the known tendency for
calcium to shift from the serum to the micelle as temperature is increased (Fox et al.,
1998a) and shows that pH can be used to indicate changes to the mineral balance, in
particular the partitioning of calcium between the micelle and the serum. Soluble casein
also decreased at increased temperature (Figure 5.2B), again in general agreement with
previous studies (Creamer et al., 1977; Downey et al., 1970; Rose, 1968). Although not
quantified, the predominant soluble casein observed in SDS-PAGE gels was expectedly
β-casein (shown in Figure 5.3).
74
Figure 5.2 Equilibrium state of skim milk as a function of temperature.
(A) Serum calcium (sCa) (,) relative to that of skim milk at 10 °C and pH (,).
(B) Turbidity (,) and soluble casein (sCN) (,) relative to that of skim milk at
10 °C. (C) Micelle hydration (,) and micelle volume fraction (,) relative to that
of skim milk at 10 °C, and average diameter (,). Error bars represent the standard
deviation of duplicate (serum calcium, pH, turbidity, soluble casein, hydration, and
volume fraction) or triplicate measurements (average diameter) of a single sample.
Square and triangles represent individual experiments performed on two different skim
milk samples.
75
Figure 5.3 SDS-PAGE image of soluble milk proteins in ultracentrifugation (75940 g)
supernatants at different temperatures.
Both the hydration of the casein micelles as determined by centrifugation, and the
voluminosity of casein micelles determined by viscometry, were lower at higher
temperature (Figure 5.2C). This is again consistent with previous observations (Dewan
et al., 1973; Snoeren et al., 1984; Walstra, 1979). The data suggest that micelles are
contracting due to dehydration resulting from increased temperature. The DLS
measurements show there was not a simple relationship between the size of the casein
micelles and temperature, with largest average diameter observed at 40 °C and the
lowest at 20 °C (Figure 5.2C). The data set obtained by Beliciu et al. (2009) also
showed a complex relationship between average micelle size and temperature, which
was dependent on the diluents used in the light scattering measurements. In their study
they did not use controlled permeates obtained at the measurement temperatures as they
were not specifically interested in determining changes to micelles in response to
temperature. In this chapter, temperature matched permeates were used to provide a
native environment for the micelles during these measurements, giving a better
indication of the effects of temperature on average micelle size. The effects of other
temperature related changes on the light scattering measurements were considered.
76
Whilst changes in the refractive index of the micelles and the serum had negligible
influence on the average size, the viscosity difference of the serum at the two
temperatures had to be directly accounted for. Whilst attempts were made, it was not
possible to obtain reliable and meaningful size distribution data from DLS
measurements of the highly polydisperse skim milk system. Consequently, only
intensity-weighted average diameter (Figure 5.2C) and polydispersity results are
reported here. The average micelle diameter was within a typical range of 170-200 nm
(Martin et al., 2007) across the temperatures tested, with the minimum size of 177 nm at
20 °C and the highest value of 200 nm at 40 °C. The polydispersity trended with the
average diameter, highest at 40 °C (0.149±0.008), lowest at 20 °C (0.124±0.017), with
an intermediate value at 10 °C (0.130±0.017). The intensity weighted average size value
gives an indication of relative changes in micelle size, but is strongly influenced by
larger particles and does not give information about changes throughout the broad size
distribution of casein micelles. To examine the effect of temperature on casein micelle
size in more detail, differential centrifugation was used to fractionate the micelle
population on the basis of sedimentation velocity (as discussed in section 3.5). The
amount of soluble casein decreased whilst the population of small casein micelles was
found to increase as temperature increased from 10 to 40 °C (Figure 5.4). This could be
explained by micellization of the soluble casein, which has been shown to be greater at
higher temperatures due to increased hydrophobic effect (Mikheeva et al., 2003). Less
simple trends in the populations of medium and large micelles were observed.
Nonetheless, the minimum amount of larger micelle material was obtained at 20 °C
which is compatible with average diameter results obtained by dynamic light scattering.
The combination of hydration, voluminosity, average diameter, and micelle
fractionation data suggests a relatively complex rearrangement of the casein micelles
occurs as a function of temperature. Despite the overall contraction of the casein
micelles indicated by the hydration and voluminosity results, the size of the larger
micelles appears to be greater at 40 °C than at 10 or 20 °C.
77
Figure 5.4 Relative amount of casein present as soluble casein, ‘small’ casein micelles
(CM), ‘medium’ CM, or ‘large’ CM in skim milk as a function of temperature as
determined by different centrifugation.
Error bars represent the standard deviation of duplicate measurements of samples from
duplicate experiments.
The turbidity of skim milk was found to increase as a function of increased temperature
(Figure 5.2B). The turbidity of skim milk is predominantly due to casein micelles, and
was not affected by microbial activity. Whilst the relationship between turbidity and the
physico-chemical properties of the casein micelle population is complex, a number of
observations can be made. Larger and more optically dense casein micelles scatter more
light. Therefore increases in the size and refractive index (RI) of the micelles will result
in an increase in turbidity assuming other parameters are constant. The observed
decreased in soluble calcium at higher temperatures is due to an increase in CCP which
increases the RI and hence turbidity. The dehydration and contraction of the micelles
will increase the RI, but will decrease the total volume fraction occupied by the casein
micelles which will have the opposite effect, making it difficult to predict the exact
effect on the turbidity. The effect of the complicated changes in casein micelle size
determined by dynamic light scattering and differential centrifugation on the turbidity
are also difficult to be accurately predicted.
78
Overall, it can be surmised that the pH of skim milk is indicative of alterations to the
mineral system, whilst the turbidity is a function of alterations to both the mineral and
micelle systems, including soluble casein, micelle voluminosity and size. The real-time
measurements of pH and turbidity can therefore be used to investigate the dynamics of
this system. These results can be interpreted on the basis of these equilibrium results
which showed that the soluble casein, soluble calcium and pH of skim milk all
decreased as a function of increasing temperature (Figure 5.2A and B) and that the
hydration and volume fraction of the casein micelles also decreased as a function of
increasing temperature (Figure 5.2C).
5.3.2 Micelle dynamics
A number of kinetic experiments were performed both warming and cooling milk. Two
examples sets of data are shown in Figure 5.5. Real-time measurements of the
temperature showed that the milk samples were heated or cooled to about 80% of the
total temperature difference with 5 min and to 95% within 15 min. On warming from 10
to 20 °C the relative pH increase tracked instantaneously with that of the temperature
increase, suggesting that the rate of pH change was instantaneous within the limits of
measurement. Similarly, the relative pH change on warming from 10 to 40 °C and
cooling from 40 or 20 to 10 °C also occurred within the time resolution of the
measurement (Figure 5.5).
The response of the milk turbidity to changes in temperature were somewhat different to
that of pH. On warming from 10 to 20 °C there was a slight lag (2-5 min) in the relative
increase in turbidity to that of temperature (Figure 5.5). However, on warming from 10
to 40 °C no lag was evident. This suggests that the kinetics of turbidity change are
temperature dependent, with the alterations that give rise to a portion of the turbidity
change occurring more rapidly at higher temperature. On cooling from 20 to 10 °C the
lag was even more pronounced, and on cooling from 40 to 10 °C the reduction in
turbidity was much slower, recovering only 50% of the turbidity change in 40 min,
whilst eventually returning to the original turbidity (i.e. the equilibrium turbidity at
10 °C) overnight. The rate of casein rearrangement may have been higher on warming
than cooling due to increased kinetics associated with the final temperature (20 or 40 °C
compared to 10 °C).
79
Figure 5.5 Dynamics of skim milk warmed and cooled between 10 and 20 °C (A), and
10 and 40 °C (B). Relative change in temperature ((), pH () and turbidity () as a
function of warming (left to right) and cooling (right to left) time. For clarity the data
presented are single measurements of one representative sample. Consistent results were
obtained from similar experiments performed with five other separate samples.
80
Since the pH response to temperature change was essentially instantaneous, any
contributions to the turbidity alterations resulting from the perturbations in the mineral
system such as partitioning of calcium between the micelle and the serum would also be
instantaneous. Therefore the observed lag in turbidity must be due to alterations to
casein such as the soluble casein, micelle size or hydration. It has previously been
shown that removal of calcium by EDTA addition results in the release of soluble
casein from the micelles (Griffin et al., 1988; Lin et al., 1972). The equilibrium results
presented here are compatible with this understanding, whilst the kinetic experiments
suggest that the rate of mineral re-equilibration is greater than that of protein release.
The mineral rearrangement consistently appeared to be very rapid whereas under some
circumstance (i.e. cooling from 40 to 10 °C) the protein rearrangement was much
slower (milk turbidity and soluble casein concentrations returned back to original states
after overnight storage at 10 °C). As the casein micelles become less hydrated and have
a denser structure (Trejo et al., 2011), migration and rearrangement of the protein
components would be expected to be slower than the transportation of calcium and
other mineral ions.
5.4 Conclusions
Casein micelles and the mineral distribution in skim milk are both dependent on
temperature in the range 10-40 °C. The dynamic response of the mineral system to
changes in temperature appears almost instantaneous where as re-equilibration of the
casein micelles is much slower, particular upon cooling. This temporal separation is
evidence that these two processes are somewhat independent and that it is possible to
induce changes in the properties of casein micelles through warming of the milk that are
not immediately reversed upon cooling. Consequently, for milk that has been re-cooled
after warming or heating, the length of time spent after cooling is likely to affect
subsequent processing operations, such as ultrafiltration, that are influenced by micelle
properties.
81
6 Alterations to the composition of casein micelles and retentate serum
during ultrafiltration of skim milk at 10 °C and 40 °C
(This Chapter has been published as Liu, D. Z., Weeks, M. G., Dunstan, D. E., &
Martin, G. J. O. (2014). Alterations to the composition of casein micelles and retentate
serum during ultrafiltration of skim milk at 10 °C and 40 °C. International Dairy
Journal, 35 (1), 63-69.)
6.1 Introduction
Ultrafiltration (UF) is a dairy processing unit used in the manufacture of cheese and
dairy ingredients and in milk standardization (Gésan-Guiziou, 2013). During UF, water,
soluble minerals and lactose are removed from milk system and consequently milk
proteins are concentrated in the retentates (Mistry et al., 2004). Temperature is an
important parameter in milk processing that affects a wide range of physicochemical
properties (Fox et al., 1998a; Liu, Weeks, Dunstan & Martin, 2013). The importance of
temperature on skim milk UF has been recognised since its inception, and a number of
early studies investigated the effect of temperature on permeation flux rates and the
microbial quality of retentates (Kapsimalis et al., 1981; St-Gelais, Haché & Gros-Louis,
1992). It was understood that low temperature can control microbial growth but results
in lower flux rates than UF performed at higher temperatures, regardless of the
membrane pore size. As a result of this trade-off and to avoid temperatures most suited
to microbial growth, UF of milk is performed either at or below 10 °C or between 40 to
50 °C (Gésan-Guiziou, 2013).
Casein and casein micelles, as discussed in previous sections, is an important
component in skim milk. During UF of skim milk, the casein micelles are known to be
responsible for processing efficiency (Bouzid et al., 2008; Rabiller-Baudry et al., 2008;
Rabiller-Baudry et al., 2005) and a better understanding of casein micelle behaviour
during UF would therefore improve the efficiency (David et al., 2008; Rabiller-Baudry
et al., 2005) and the quality of products. However, as mentioned in Chapter 2, only
limited research appears to have been performed to investigate the effect of UF on the
composition, size or structure of casein micelles (Singh, 2007).
82
Casein micelles are affected by temperature (Davies et al., 1983; Liu et al., 2013; Rose,
1968) and these effects remain to be understood in the context of UF processing of skim
milk. Of particular importance to UF processing is the exchange of calcium phosphate
and casein between the micelles and the serum that is directly influenced by temperature
(Davies et al., 1960; Liu et al., 2013; Rose, 1968). While the temperature of UF has
been shown to affect the bulk composition and properties of UF retentates and
permeates (McKenna, 2000; Pouliot et al., 1989a; Pouliot et al., 1989b; Renner & Abd
El-Salam, 1991; Rose et al., 1959; St-Gelais et al., 1992), a detailed study of the effects
of UF temperature on the composition of casein micelles and retentate serum has yet to
be performed. In addition, the effect of UF on the size and hydration of casein micelles
is still not clear, and the influence of temperature on these properties has not been
elucidated. The aim of this chapter was to investigate and compare the effect of UF
concentration at different processing temperatures on the hydration, composition and
size of casein micelles and the composition of the retentate serum. This information will
increase the understanding of the effect of temperature on the operational behaviour of
skim milk UF and the properties of the resulting retentates.
6.2 Materials and methods
To get knowledge into the casein micelle alterations during UF, a systematic approach
had been developed. Detailed summary of the analyses performed on UF retentates and
permeates is shown in Figure 6.1.
83
Figure 6.1 Analyses performed on UF retentates and permeates
6.2.1 Skim milk samples
Pasteurised fresh skim milk containing 40 g·L-1
protein, 1.5 g·L-1
total fat and 47 g·L-1
carbohydrate was purchased from a local supermarket and all experiments and analyses
were performed within two days and repeat experiments were performed on separate
batches of milk.
6.2.2 Ultrafiltration and pH measurements
Skim milk samples were concentrated to different concentrations (volume concentration
factor 2, 3 and 4) at 10 °C or 40 °C using a LabscaleTM
TTF system (Millipore, Billerica,
MA, USA) fitted with a 10 kDa cut-off polyethersulfone membrane at a constant
transmembrane pressure of 137.9 kPa. All skim milk samples were equilibrated at the
required temperature for 1 h before commencing UF. For experiments examining the
effects of altering the temperature during ultrafiltration, skim milk was initially
concentrated two fold at 40 or 10 °C, and then further concentrated to a concentration
factor of 3 (CF3) at 10 or 40 °C respectively (equilibration between these temperatures
occurred in less than 13 min).
pH of the original milk and UF retentate was measured using an Aqua-pH pH-mv-
temperature meter (TPS Pty Ltd., Brisbane, Australia) at UF processing temperature
(10 °C and 40 °C) and a temperature probe was fitted for automatic adjustments of
temperatures involved in the pH tests.
84
6.2.3 Casein micelle separation and hydration
Samples of skim milk and retentate were accurately weighed and added to pre-weighed
centrifuge tubes and ultracentrifuged at desired temperature as discussed in section 3.5.
The hydration was measured as described in section 4.2.2.
6.2.4 Protein and calcium quantification
The protein content of milk samples and supernatants obtained by ultracentrifugation
was analysed by SDS-PAGE as described in section 4.2.3. The concentration of the
caseins (α-, β- and κ-casein) was quantified densitometrically after scanning the stained
gels using BioRad Gel Dox XR+ Imager (BioRad Laboratories, Richmond, CA, USA).
Native-PAGE was used to investigate the content of proteins including individual native
whey proteins in the UF permeate and retentate. Permeates were diluted 4 times with
native loading buffer (Biorad, Laboratories, Richmond, CA, USA) and 10 µl of mixture
was loaded into 8-16% linear gradient precast Tris-HCl criterion 18 well gels (Biorad,
Laboratories, Richmond, CA, USA) before running at 100 V for 130 min. Supernatants
of the ultracentrifuged original skim milk and UF retentates were diluted 8 times with
native loading buffer and 10 µl, 5 µl, 3.3 µl and 2.5 µl of mixture was loaded into the
gels for original, CF2, CF3 and CF4 UF milk respectively. Gels were stained with
Biosafe Coomassie Blue (BioRad Laboratories, Richmond, CA, USA) before imaging
and densitometric quantification of the individual protein bands.
Measurement of the calcium concentration was performed by atomic absorption
spectroscopy as described in section 4.2.4.
6.2.5 Dynamic light scattering
Dynamic light scattering was used to determine the intensity-weighted average
hydrodynamic diameter of casein micelles in skim milk and UF concentrated samples.
Measurements were performed on samples diluted 75 fold in either UF permeates
obtained at 10 °C and 40 °C or simplified simulated milk ultrafiltrate (Martin et al.,
2007). The temperature during light scattering measurements was maintained at 10 °C
or 40 °C respectively. Measurements were performed as described in section 5.2.5.
85
6.2.6 Determination of lactose content
Prior to lactose determination, protein was removed from samples of milk or
resuspended pellets from ultracentrifugation using Carrez reagent following the
international standard protocol (ISO, 2002). Lactose concentration was then measured
using a Lactose Assay Kit (Abcam, Cambridge, UK) according to the manufacturer
instructions.
6.3 Results and discussion
Skim milk samples were concentrated to different concentrations by UF at 10 °C and
40 °C respectively. 40 °C is at the upper limit of high temperature ultrafiltration, and
was selected as it was not possible to conduct these experiments beyond this
temperature. Native-PAGE was used to analyse the protein content in both permeate
and supernatants of ultracentrifuged UF retentates (ultracentrifugation was performed at
the UF processing temperature of 10 or 40 °C). As shown in Figure 6.2, no casein could
be observed in permeates at either 10 or 40 °C, with a small amount of α-lactalbumin
and trace bands of β-lactoglobulin evident. The total protein content of the permeate
accumulated up to CF4 was determined by total protein nitrogen measurement
(determined by external laboratory testing using standard method (DTS Food
Laboratories, Kensington, VIC, Australia)) to be 1.8 g·L-1
and 2.0 g·L-1
for the 10 °C
and 40 °C respectively. The relative amounts of both native α-lactalbumin and native β-
lactoglobulin did not change significantly in the supernatants of UF retentates at either
temperature (Figure 6.2 and Figure 6.3), indicating that minimal interaction between the
whey proteins and casein micelles resulted during UF.
86
Figure 6.2 Native-PAGE analysis of UF permeates and the supernatants of the
ultracentrifuged retentates (60 min ultracentrifugation).
Also according to Figure 6.2, β-casein was the predominant casein to be released from
the micelles into serum at 10 °C compared to 40 °C, with κ-casein and α-casein
relatively stable. This is consistent with previous observations (Creamer et al., 1977;
Davies et al., 1983; Downey et al., 1970; Liu et al., 2013; Rose, 1968).
87
Figure 6.3 Native-PAGE analysis of whey protein content in the serum of retentates
from ultrafiltered skim milk. Relative concentration of α-lactalbumin () and β-
lactoglobulin () in the serum of UF retentates at 10 °C (A) and 40 °C (B). Error bars
represent standard deviation of duplicate measurements of one single sample.
To investigate changes to the partitioning of milk components between the micelles and
the serum during UF, supernatants were carefully removed and the concentration of
soluble casein and calcium were measured. Consistent with previous observations in
this approximate temperature range (Creamer et al., 1977; Liu et al., 2013; Rose, 1968),
the proportion of soluble casein in the skim milk was higher at 10 °C than 40 °C (Figure
88
6.4A and 6.4B). Depending on the pH, the amount of soluble casein may decrease if the
temperature is increased beyond this range (Anema, 1998). Since all casein was retained
during UF (as shown in Figure 6.2), the total amount of casein in the retentates was the
same as that in the original milk samples (Figure 6.4A and B). The amount of soluble
casein in the retentates decreased slightly and the amount of micellar casein increased
correspondingly as a function of concentration at both temperatures (Figure 6.4A and B).
This indicates that some of the soluble casein shifted from the serum to the micelles
during UF. As permeate is removed during UF the total volume of serum decreases, so
although there is a shift of casein from the serum to the micelles, there is a large
increase in the concentration of soluble casein in the serum (Figure 6.4E and F). An
apparent increase in the amount of non-micellar casein has previously been observed,
and this was attributed to the release of casein from the micelles (McKenna, 2000).
However, the results here show that although the concentration of soluble casein
increased during UF, there was a net shift of casein from the serum to the micelles.
89
Figure 6.4 Alterations to the casein micelle and serum compositions of UF retentates as
a function of volumetric concentration factor (CF). UF at 10 °C (A, C, E) and 40 °C (B,
D, F). A and B: Amount of soluble casein (), micellar casein () and total casein ()
remaining in UF retentates and original unconcentrated skim milk. C and D: Amount of
serum calcium (), micellar calcium () and total calcium () remaining in UF
retentates and original unconcentrated skim milk. E and F: Relative concentration of
soluble casein () and serum calcium () present in the serum of UF retentates
relative to that of unconcentrated skim milk at 10 °C and the retentate pH (). Error
bars represent standard deviation of duplicate measurements of samples from triplicate
experiments.
0.0
0.5
1.0
1.5
2.0
2.5
3.0R
ete
nta
te c
asein
(g p
er
L o
f o
rig
inal m
ilk)
0.0
0.5
1.0
1.5
2.0
2.5
3.0
Rete
nta
te c
asein
(g p
er
L o
f o
rig
inal m
ilk)
0.0
0.2
0.4
0.6
0.8
1.0
Rete
nta
tecalc
ium
(g p
er
L o
f o
rig
inal
mil
k)
0.0
0.2
0.4
0.6
0.8
1.0
Rete
nta
te c
alc
ium
(g p
er
L o
f o
rig
inal m
ilk)
6.5
6.6
6.7
6.8
6.9
7.0
0.0
0.5
1.0
1.5
2.0
2.5
1 2 3 4
Rete
nta
te p
H
Rela
tive c
on
cen
trati
on
in
seru
m
Concentration Factor
6.5
6.6
6.7
6.8
6.9
7.0
0.0
0.5
1.0
1.5
2.0
2.5
1 2 3 4
Rete
nta
te p
H
Rela
tive c
on
cen
trati
on
in
seru
m
Concentration Factor
A B
FE
DC
90
The concentration of calcium in the original skim milk, the UF retentates, and in the
supernatants resulting from ultracentrifugation of the retentates, was measured by AAS.
The relative amount of micellar calcium was determined from the difference between
the total calcium in the retentate and the amount of calcium in the supernatants. After
concentration to CF2 the amount of micellar calcium was relatively unchanged for milk
ultrafiltered at both 10 and 40 °C (Figure 6.4C and D). A slightly higher percentage of
the calcium was removed on concentration to CF2 at 10 °C (14%) than at 40 °C (12%)
(Table 6.1). As little calcium had been removed from the micelles at either temperature
at CF2 (Figure 6.4 C and D), the calcium removed from the milk to this point originated
primarily from the serum. The differences in the rate of calcium removal could be
expected to result from the higher concentration of serum calcium at lower temperature
(Figure 6.4E and F), and a possible temperature dependence of the calcium rejection
coefficient. On further concentration to CF3 the behaviour of milk at different
temperatures diverged, with removal of calcium from the micelles evident at 10 °C, but
not 40 °C (Figure 6.4C and D). Correspondingly, an increase in the removal of calcium
from the retentate was evident at 10 °C due to release of micellar calcium, whereas
calcium removal was relatively low at 40 °C between CF2 and CF3 (Table 6.1). At
10 °C the removal of calcium from the micelles appeared to cease between CF3 and
CF4 (Figure 6.4C), as did the removal of calcium from the retentate (Table 6.1). At
40 °C, the calcium continued to remain with the micelles (Figure 6.4D) and the amount
of calcium removed from the retentate was low (Table 6.1). As shown in Figure 6.3E
and 6.3F the pH of both the retentates was reasonably stable during UF, with slight
variations reflective of mineral re-equilibration between the micelles and serum at the
different temperatures (Fox et al., 1998a).
The hydration of the casein micelles was determined by measuring the water content of
the pellets gravimetrically by 24 hours oven drying. The micelle hydration was seen to
increase from about 2.79 g water/g solids for fresh skim milk to approximately 3.16 g water/g
solids for milk concentrated four-fold at 10 °C, and from 1.99 g water/g solids to 2.23 g water/g
solids at 40 °C (Table 6.1). This behaviour is in contrast to concentration by evaporation,
during which the casein micelles were progressively dehydrated (Liu, Dunstan &
Martin, 2012). The marked difference in hydration at two different temperatures is
consistent with previous observations of casein micelles at different temperature
(Snoeren et al., 1984), and could be expected to affect of UF processing such as
91
resistance to flux caused by concentration polarization and gel layer formation. The
increase in micelle hydration could reflect an increase in micellar water, a decrease in
micellar solids, or a combination of the two. For the two major non aqueous micelle
components, micellar calcium was reduced during UF at 10 °C but not obviously at
40 °C (Figure 6.4C and 6.4D) and the micellar casein was increased at both
temperatures (Figure 6.4A and 6.4B). The partitioning of the other non aqueous micelle
components, lactose, was also investigated. While the total amount of lactose in the
retentate was reduced due to removal into the permeate, the amount of lactose
associated with the micelles remained low and relatively constant during UF (Table 6.1).
This suggests that the increase in micelle hydration is primarily reflective of an increase
in micellar water, which is consistent with previous observations of micelle swelling
during UF that became more prominent on subsequent diafiltration (McKenna, 2000).
Table 6.1 Micelle and mineral alterations during UF.
CF
Removal
of calcium1
Micelle
Hydration2
(g water/g solid)
Average effective diameter3 (nm)
Total lactose
in retentate4
(g/Loriginal milk)
Micellar lactose4
(g lactose/g wet pellet)
Buffer
Permeate
10 °C Original
2
3
4
N/A
14%
31%
31%
2.79 ± 0.10
2.96± 0.20
3.00 ± 0.10
3.16 ± 0.05
188.9±10.5
187.4±10.5
193.6±2.3
191.9±1.4
193.5±10.0
191.5±11.6
183.7±1.8
188.4±5.3
45.9 ± 0.6
n.d.
n.d.
12.5 ± 0.5
0.035 ± 0.003
n.d.
n.d.
0.043 ± 0.003
40 °C Original
2
3
4
N/A
12%
17%
19%
1.99 ± 0.04
1.97 ± 0.12
2.14 ± 0.08
2.23 ± 0.05
197.2±6.1
186.4±2.3
182.9±4.6
199.5±10.7
200.9±12.0
186.4±9.7
195.3±11.5
195.9±5.3
47.2 ± 0.6
n.d.
n.d.
13.2 ± 0.5
0.042 ± 0.001
n.d.
n.d.
0.039 ± 0.003
1 % of total calcium (serum + micellar) in the original milk that was removed from the
UF retentates i.e. lost to the UF permeates.
2 Errors represent the standard deviation of duplicate measurements of duplicate
experiments.
3 Errors represent the standard deviation of triplicate measurements of a single
experiment.
4Errors represent the standard deviation of quadruplicate measurements of a single
experiment.
92
The hydration of the micelles gives an indication of the relative compactness or
voluminosity of the micelles during UF, with the data indicating less hydrated, more
compact micelles were present at 40 °C than at 10 °C. The hydration of the micelles can
be considered a temporary property (Martin et al., 2007). To investigate more
permanent alterations to the average size of casein micelles, dynamic light scattering
measurements of fresh skim milk and UF retentate samples were preformed. As casein
micelles very rapidly re-hydrate, differences in the hydration of the micelles (Martin et
al., 2007) are not seen using this method (which requires dilution before measurement)
and only more permanent structural changes are observed. As shown in Table 6.1, only
minor variations in the average size were observed at 10 °C. At 40 °C there appeared to
be a slight decrease in average micelle size on concentration to CF 2 which was
reversed on further concentration to CF 4. The similar size of micelles in rediluted UF
concentrates as measured by DLS here is consistent with previous observations of
rehydrated MPC powder (Martin et al., 2010), and suggest permanent alterations to
casein micelle size caused by UF are minor. The slight increase in micelle size due to
increased hydration is temporary and only observable in UF retentates in their
concentrated state. Previous investigations of casein micelle size alterations during UF
processing have employed electron microscopy, which requires dehydrating and cross-
linking the micelles (McKenna, 2000; Srilaorkul et al., 1991) and may be affected by
the higher concentrations of soluble casein in the retentates that have been observed in
this chapter.
93
Figure 6.5 Alterations to skim milk after UF concentration to CF2 at 10 °C or 40 °C
followed by concentration to CF3 at 40 °C or 10 °C. The amount of calcium removed
from the retentates, the total amount of soluble casein in the retentates, and the
hydration of the casein micelles in the retentates are presented relative to the values for
retentates obtained at 10 °C. Error bars represent the standard deviation of duplicate
measurements of samples from duplicate experiments.
According to the results above, the major difference in the removal of calcium resulting
from UF performed at different temperatures occurred between CF2 and CF3 (Table 6.1,
Figure 6.4C and D). While the removal of calcium from the milk system was similar
when concentrated to CF2 by UF at both 10 °C and 40 °C, the processing time was
almost doubled at 10 °C. To further investigate the effects of temperature on processing
efficiency and calcium removal, skim milk samples were concentrated to CF2 at either
10 or 40 °C and then concentrated further to CF3 at 40 or 10 °C respectively. The
results show that the amount of calcium removed from the CF3 retentate obtained from
a two-step UF process at 40 °C then 10 °C was greater than that from concentrated at
40 °C, but lower than those at 10 °C. The reverse two-stage UF was also tested by
concentrating to CF2 at 10 °C followed by 40 °C UF to CF3. More calcium was
removed from the system than at 40 °C but less than the 40 °C to 10 °C two-stage UF
process. The redistribution of calcium between the micelles and serum has been shown
0.0
0.2
0.4
0.6
0.8
1.0
Ca removed Soluble Casein Hydration
Am
ou
nt
Rela
tive t
o 1
0 °
C
10 °C
40 → 10 °C
10 → 40 °C
40 °C
94
to be extremely rapid in response to temperature change (as discussed in Chapter 5),
which explains why intermediate levels of calcium removal can be obtained when the
temperature is changed during UF. Chapter 5 also indicates that as the effect of
temperature on the minerals in skim milk is effectively instantaneous; changes to the
casein were observed to occur more slowly, especially during cooling. Further analyses
were performed on samples obtained by the two-step UF processes to examine the
effects on the casein micelles. The amount of soluble casein in the retentates was
highest in order of UF performed at 10 °C, 40-10 °C, 10-40 °C, then 40 °C (Figure 6.5).
This is similar to the trend in calcium removed (Figure 6.5), indicating that the
temperature between CF2 and CF3 had a greater influence on the final level of soluble
casein than the temperature between CF1 and CF2. Although, as discussed in Chapter 6,
casein re-equilibrates less rapidly in response to temperature than calcium, little
difference in the behaviours of the two components was observed during the two-step
UF process, presumably because the processing time was sufficiently long. While the
calcium removal and the partitioning of casein between the micelles and serum were
intermediate to the two processing temperatures and dependent on the order in which
they performed, the micelle hydration in CF3 retentates (Figure 6.5) was only
dependent on the temperature of the final processing step (CF2 to CF3). This is
consistent with previous observations that micelle rehydration is a rapid process (Martin
et al., 2007) and the hydration state of micelles can be considered a temporary property.
These results show that the temperature of UF processing influence both permanent
alterations such as the removal of calcium, and temporary effects such as the hydration
of the micelles.
95
Figure 6.6 Casein micelle alterations during UF
6.4 Conclusions
The casein micelle alterations during UF at 10 and 40 °C were summarised in Figure
6.6. During UF concentration of skim milk the progressive removal of calcium was
affected by the partitioning of calcium between the micelles and the serum which was
influenced by processing temperature. Performing UF at different temperatures
therefore altered the final calcium content of the retentates. The composition of casein
micelles including the hydration, calcium and casein content were all altered to some
extent during UF and affected by the temperature of operation. These findings have
practical consequences relating to both filtration performance and the use of UF
retentates. The influence of temperature on casein micelle hydration and the partitioning
of micellar components will affect the retentate viscosity and the fouling behaviour
which determine the overall membrane flux. Understanding how the partitioning of
calcium and casein between the micelle and the serum are affected by temperature is
important for the use of UF retentates for MPC manufacture and cheese standardization.
96
7 Lactose effects on casein micelles: The regulator of micelle hydration
7.1 Introduction
Lactose is a dissacharide of β-1,4-linked glucose and galactose that is an important
component of milk. As early as in the 1920s, Whitaker et al. (1927) reported that lactose
is partly responsible for the density and viscosity of skim milk having a higher
temperature dependency than water. It has also been found that lactose is responsible for
around half of the osmotic pressure of milk (Jenness & Sloan, 1970) and there is a
negative correlation of lactose concentration with total salt osmolarity (Holt, 1993).
During milk secretion, lactose formation and casein phosphorylation both take place in
the Golgi region. Current theories suggest that lactose is the principal regulator of the
final ratio of water and caseins in milk (Farrell Jr et al., 2006; Jenness, 1974) and that
the concentration of casein and lactose have an inverse correlation during secretion
(Jenness et al., 1987). The presence of lactose in milk system alters the properties of the
serum and casein micelles (Farrell Jr et al., 2006). It has high efficiency of binding with
calcium (Abrams, Griffin & Davila, 2002; Charley & Saltman, 1963; Gaiani, Ehrhardt,
Scher, Hardy, Desobry & Banon, 2006) and also regulates the water content in and
around proteins (Farrell Jr et al., 2006). Mozersky, et al. (1991) reported that the overall
colloidal protein mass of reformed casein micelles decreased by 45 to 90%, as
calculated by sedimentation field flow fractionation, on addition of 300 mM lactose.
Decrease in pH, conductivity, water activity (Gao, van Leeuwen, Temminghoff, van
Valenberg, Eisner & van Boekel, 2010), casein micelle voluminosity (Dewan et al.,
1973) have also been observed to be dependent on the concentration of sugars in milk
(Mora-Gutierrez, Kumosinski & Farrell, 1997).
During dairy processing, the concentration of lactose can be altered significantly. While
it is clear that lactose concentration can have various effects on the physicochemical
properties of milk, there is limited information on the effects of post-secretion alteration
in lactose concentration on the properties and structure of casein micelles. As discussed
in the previous chapters, although both evaporation and ultrafiltration concentrate
proteins in milk system; the effect on micelle hydration is different. During evaporation,
the micelle hydration decreases as a function of concentration, whilst in the UF, the
hydration increases during processing. The reason for that might be because of the
changes of lactose concentration in the milk system: as evaporation removes only water;
97
while lactose passes through membrane during UF. However, detailed information
about lactose effect on casein micelles during milk processing has so far been limited.
Milk protein concentrate (MPC) is manufactured by removing minerals and lactose
from skim milk system by ultra- and dia-filtration. The retentate is further concentrated
by evaporation and then spray dried. It contains whey proteins and caseins in the same
proportions as the original milk, but with less lactose. Solubilised MPC can provide a
casein micelles suspension in solutions with an artificially low lactose concentration,
which extends the range over which the effects of lactose on casein micelles can be
studied. In this chapter, the lactose effects on casein micells were investigated in both
skim milk and MPC systems.
7.2 Materials and methods
7.2.1 Skim milk and MPC solutions
Pasteurized fresh skim milk was purchased from local supermarket with a composition
as described in section 6.2.1. MPC 85 powder (MG Natra. Pro., Australia) was
resuspended in SMUF or distilled water respectively to the final concentration of 37.7
g·L-1
. MPC 85 solutions were stored at ca 10 °C overnight for full hydration. Milk
samples and MPC solutions were brought to the desired temperature and then allowed
to equilibrate for at least 1 h with different amount of lactose (AnalaR ®, England)
added.
7.2.2 Volume fraction and pH
The viscosity of different samples and the corresponding SMUF or water with different
concentration of lactose was measured as described in section 5.2.4. The volume
fraction of casein micelles was calculated as described in section 3.2 and 5.2.4. The pH
was measured as described in section 5.2.6.
7.2.3 Casein micelle hydration
MPC solutions and skim milk were ultracentrifuged at desired temperature and the
hydration of casein micelles was measured and calculated as described in section 4.2.2.
98
7.2.4 Dynamic light scattering
Dynamic light scattering was used to determine the average diameter of casein micelles
in different samples. Milk samples were diluted 75-fold in SMUF with corresponding
lactose concentration. The temperature during light scattering measurements was
maintained at 20 °C. Measurements were performed as described in section 5.2.5.
7.2.5 Casein and Calcium quantification
The soluble protein concentration in milk serum was analysed by SDS-PAGE as
described in section 4.2.3. Measurement of the calcium concentration was performed by
atomic absorption spectroscopy as described in section 4.2.4.
7.2.6 Determination of lactose content
The lactose concentration in milk samples and micelle pellets was measured as
described in section 6.2.6.
7.3 Results and discussion
7.3.1 Lactose effects on casein micelles in MPC solutions
MPC 85 powder was dissolved in distilled water or SUMF and different amounts of
lactose were added to the solution to reach concentrations of 1.5 g·L-1
, 15 g·L-1
, 30 g·L-1
,
45 g·L-1
, 60 g·L-1
, 75 g·L-1
, 85 g·L-1
, 100 g·L-1
. The pH of the MPC85 solutions was
measured directly and the supernatants from ultracentrifugation were carefully removed
for serum calcium measurement. As shown in Figure 7.1A and C, both the pH and
serum calcium concentration decreased as a function of lactose concentration in MPC
85 solutions at 20 °C. This indicates that some of the serum calcium shifted from the
serum to the micelles at high lactose concentrations, which is consistent with previous
observations (Gao et al., 2010). As a result of the increasing lactose concentration in the
MPC system, the casein micelles were dehydrated and a gradual increase in the amount
of lactose associated with micelles was also observed (as shown in Figure 7.1 B and D
and Table 7.1). This is again consistent with the known tendency for the decrease of
micelle voluminosity when adding sugar (Dewan et al., 1973), which might be due to
99
micelle dehydration and contraction. In addition, during this re-arrangement, calcium-
lactose complexes might form (Charley et al., 1963) and the balance of calcium might
be shifted from the serum to the colloidal phase.
Figure 7.1 Pelletization of casein micelles and composition of the serum of MPC 85
disolved in water (A, B) and SMUF (C, D) as a function of lactose concentration.
A and C: Serum calcium (sCa) () relative to the amount in original solution without
adding extra lactose and the pH of the solution (). B and D: The amount of water ()
and solids () pelleted from ultracentrifugation. Error bars represent standard deviation
of duplicate measurements of samples from duplicate experiments.
100
Table 7.1 Micellar lactose and micelle hydration in MPC 85
Total lactose
(g·L-1
)
Micellar lactose 1
(g lactose/g wet pellet)
Micelle hydration 1
(g water/g solid)
MPC 85 in water
1.5 0.0020±0.0001 2.77±0.05
15 0.0045±0.0001 2.66±0.04
45 0.0242±0.0003 2.60±0.03
85 0.0396±0.0006 2.44±0.05
MPC 85 in SMUF
1.5 0.0017±0.0001 2.85±0.03
15 0.0056±0.0001 2.74±0.04
45 0.0255±0.0005 2.60±0.01
85 0.0341±0.0005 2.44±0.03
1 Errors represent the standard deviation of duplicate measurements of samples from
duplicate experiments.
The turbidity was observed to be inversely proportional to the overall lactose
concentration (Figure 7.2). Casein micelles are the predominant contributor to milk
turbidity and the relationship between turbidity and the physico-chemical properties of
casein micelle is complex. Due to the increased amount of lactose and minerals
associated with micelles, the casein micelles are more optically dense and hence have an
increased refractive index relative to the serum and will scatter more light. On the other
hand, the dehydration-induced contraction of the micelles will decrease the total volume
fraction occupied by the casein micelles, which leads to the decrease in the scattering
volume and turbidity. Therefore, the exact relationship between the observed changes in
turbidity and changes to the casein micelles is difficult to accurately predict.
101
Figure 7.2 Relative turbidity of MPC 85 solutions as a function of lactose concentration.
(), MPC 85-SMUF; (), MPC 85-Water. Error bars represent standard deviation of
duplicate measurements of samples from duplicate experiments.
7.3.2 Lactose effects in skim milk
To further investigate the lactose effect on casein micelles, different amount of lactose
were dissolved into skim milk at room temperature to a final concentration of 46 g·L-1
,
60 g·L-1
, 73 g·L-1
, 85 g·L-1
, 100 g·L-1
. The concentration of soluble casein was
measured by SDS-PAGE and serum calcium concentration was measured by AAS. As
shown in Figure 7.3A, the pH was relatively stable and the serum calcium concentration
decreased slightly at high lactose concentrations. The concentration of the soluble
casein decreased about 7% when the lactose concentration was above 73 g·L-1
indicating that a minor shift of casein from serum to micelle phase occurred. Similar to
MPC85, skim milk showed a similar trend of decreasing micelle hydration and
increasing of micellar solids as a function of increasing lactose concentration (shown in
Figure 7.3B). According to the dynamic light scattering results the average micelle size
decreased as a function of lactose concentration. And the micelle voluminosity was also
shown to decrease when adding lactose (Figure 7.3C), which confirmed the micelle
contraction due to loss of micellar water. The increase of the ultracentrifugation pelleted
lactose (Table 7.2) suggested that casein micelles are able to accommodate extra lactose.
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
0 15 30 45 60 75 90 105
Re
lati
veTu
rbid
ity
Lactose concentration (g/L)
102
Table 7.2 Micellar lactose and micelle hydration in Skim milk
Total lactose
(g/L)
Micellar lactose 1
(g lactose/g wet pellet)
Micelle hydration 1
(g water/g solid)
46 0.0393±0.0019 2.33±0.01
60 0.0432±0.0022 2.31±0.01
85 0.0476±0.0025 2.14±0.03
100 0.0496±0.0031 2.07±0.02
1 Errors represent the standard deviation of duplicate measurements of samples from
duplicate experiments.
103
Figure 7.3 Alterations of casein micelles and serum of skim milk as a function of
lactose concentration.
A: pH () of skim milk samples, serum calcium () and soluble casein () relative to
original milk without adding lactose. B: The amount of water () and solids ()
pelleted from ultracentrifugation. C: Average micelle size () and relative volume
fraction of casein micelles () as a function of lactose concentration. Error bars
represent standard deviation of duplicate measurements of samples from duplicate
experiments.
104
7.3.3 Lactose effects during milk processing
The hydration of casein micelles was determined by measuring the water content of the
ultracentrifugation pellets gravimetrically by overnight oven drying. As the data shown
in Table 7.1 and 7.2, the micelle hydration decreased as a function of lactose
concentration. This result confirmed that lactose can regulate the water content of casein
micelles in milk system. To further investigate this effect, skim milk samples with
different lactose concentration (46 g·L-1
, 60 g·L-1
, 85 g·L-1
and 100 g·L-1
for tests
performed at 10 °C, and 46 g·L-1
, 60 g·L-1
, 85 g·L-1
, 100 g·L-1
, 150 g·L-1
and 200 g·L-1
for tests performed at 40 °C) were stored at ca 10 °C for equilibration and then kept at
10 °C and 40 °C for at least 1 h before ultracentrifugation. The hydration of the casein
micelles as a function of lactose concentration at different temperature is summarized in
Figure 7.4 alongside other previously obtained micelle hydration data from evaporative
concentration on the basis of the lactose concentration. During evaporative
concentration, the lactose concentration increased and the casein micelles were
dehydrated as water was removed. In contrast, during ultrafiltration both lactose and
water are removed from the milk system and micelles remain fully hydrated (Table 6.1).
While UF and evaporative concentration have other factors that could influence micelle
hydration (chiefly altered protein concentration), the lactose addition experiments do
not. Also, the resuspension of MPC in SMUF and water can account for any deviation
in behaviour that could result from altered mineral content, in particular calcium and
phosphate. As a whole these results suggest that the lactose concentration is primary
major factor (along with temperature) that determines the hydration, and therefore the
volume faction occupied by the casein micelles; and their contribution to the bulk
viscosity. In addition, early study comparing the effect of lactose and sucrose on the
size of casein micelles in reconstituted bovine milk, the results indicated that the
presence of lactose decreased the apparent micellar protein mass in all samples while
the effects of sucrose were strongly dependent on sample preparation (Mozersky et al.,
1991). These results suggest that the effects of lactose on casein micelles are due to
different mechanisms to those resulting from the presence of sucrose; in particular
lactose may cause effects involving calcium chelation (Charley et al., 1963).
105
Figure 7.4 Micelle hydration alterations in response to lactose concentration.
7.4 Conclusions
Casein micelle are dehydrated and contracted on addition of lactose. The lactose content
of micelles increases as a function of the total lactose concentration in milk, and the
internal micellar lactose can be removed by diafiltration. These observations indicated
that lactose is able to exchange between serum and micelle phase. On addition of
lactose, a shift of calcium from the serum to the micelles was observed in MPC 85
solutions; whilst in skim milk the serum mineral concentration was relatively stable.
The concentration of soluble casein decreased slightly in skim milk as a function of
lactose concentration. Overall, this study has shown that the lactose concentration
influences the hydration and voluminosity of casein micelle as well as the viscosity of
the whole system.
0.0
0.5
1.0
1.5
2.0
2.5
3.0
0 50 100 150 200 250 300
Mic
elle
hyd
rati
on
(g
wat
er/
g so
lid)
Lactose concentration (g/L)
MPC85 in water
MPC85 in SMUF
Skim milk 10 °C
Skim milk 20 °C
Skim milk 40 °C
Evaporation 50 °C
106
8 Conclusions and recommendations
8.1 Conclusions
The objectives of this thesis were to obtain a greater understanding of the casein micelle
alterations during processing, in particular during milk evaporative concentration and
ultrafiltration (UF). The key alterations that were uncovered as a result of this research
are summarised in Figure 8.1. Further, the response of casein micelles to temperature
and lactose concentration alterations was also explored. A brief overview is outlined
here.
Figure 8.1 A schematic overview of the effect of evaporative concentration and
ultrafiltration on casein micelles as revealed through this study
Evaporation inducted casein micelle alterations
Concentration of skim milk by evaporation is an important unit in a number of dairy
processes. Therefore, the effects of the combination of heat and water removal on casein
micelles during skim milk evaporative concentration were observed. The mass balance
and hydration results revealed that during the evaporation process, while micelles were
107
dehydrated, water was removed preferentially from the serum. The amount of soluble
casein and calcium in the serum decreased as a function of increasing solids content,
indicating a shift of these components to the micelles. Furthermore, the reversibility of
these alterations was examined by re-dilution of milk concentrates with water. It was
discovered that casein micelles were immediately rehydrated upon re-dilution. In
addition, serum calcium and pH returned to their original state over a number of hours;
however, only a small percentage of original soluble casein returned to the serum over
the 5 h period investigated. These results showed that casein micelles are significantly
affected by evaporative concentration and that the alterations are not completely and
rapidly reversible. This helps explain previous observations on reconstituted SMP
(Martin et al., 2007) as well as the rheological properties of concentrated milk (Vélez-
Ruiz et al., 1998), which is of high importance for milk processing.
Temperature induced casein micelle alterations
To gain additional insight into the casein micelle alteration during milk processing,
further studies were performed in temperature induced changes. In this study, a
comprehensive physico-chemical investigation of casein micelles in skim milk was
performed between 10 °C and 40 °C. When fully equilibrated, the amount of soluble
casein, serum calcium, the hydration and volume fraction of the casein micelles and the
pH of skim milk all decreased as a function of increasing temperature.
Real-time measurements of turbidity and pH were used to investigate the dynamics of
the system during warming and cooling of milk. Changes in pH are indicative of
changes to the mineral system and the turbidity is a measure of alterations to the casein
micelles. The pH and turbidity showed that alterations to both the casein micelles and
the mineral system occurred very rapidly on warming. However, while mineral re-
equilibration occurred very rapidly on cooling, changes to the casein micelle structure
(reflected by turbidity) continued after 40 min of measurement, returning to equilibrium
after 16 h equilibration.
These results indicate that casein micelle structure and the mineral system of milk were
both dependent on temperature in the range 10-40 °C. The dynamic response of the
mineral system to changes in temperature appeared almost instantaneous whereas
108
equilibration of caseins was considerably slower, particularly upon cooling. In addition,
the length of time spent on warming or cooling is likely to affect the subsequent
processing operations.
UF induced casein micelle alterations
UF is widely used in the dairy industry for recovering, fractionating and concentrating
proteins in milk process streams. Based on the information about the temperature effects,
alterations to the hydration, composition and size of casein micelles and the distribution
of calcium during membrane separation were investigated during UF at 10 °C and 40 °C
respectively. The observation indicated that the hydration of casein micelles increased
during UF process to a four-fold concentration due to the increase of micellar water.
More micellar calcium was removed from skim milk during UF at low temperature.
To further investigate the effects of temperature on processing efficiency and calcium
removal, skim milk samples were concentrated to CF2 at either 10 or 40 °C and then
concentrated further to CF3 at 40 or 10 °C respectively. The amount of calcium
removed from the retentates was highest in order of UF performed at 10 °C, 40-10 °C,
10-40 °C, then 40 °C, and the processing time used was shortest in order of UF
performed at 40 °C, 10-40 °C, 40-10 °C then 10 °C. The micelle hydration in CF3
retentates was only dependent on the temperature of the final processing step.
The understanding of the casein micelle alterations during UF has practical influence on
filtration operations, the composition and hydration of casein micelles determine the
viscosity and fouling behaviours of the UF retentates and ultimately the processing
efficiency. Furthermore, this helps improve the use of UF retentates for cheese and
MPC manufacture.
Lactose effects on casein micelle hydration
As discussed above, the removal of water during evaporative concentration of skim
milk was found to dehydrate casein micelles. Conversely, during milk UF, casein
micelles remained highly hydrated, although proteins were concentrated. The results
109
suggested that temperature and lactose concentration are the important factors affecting
hydration and volume fraction of casein micelles and hence the viscosity of the milk.
Casein micelle models
The casein micelle models discussed in Chapter 2 all present the micelle as a dynamic
entity. From the conclusions of evaporation and ultrafiltration of skim milk, it appears
that the sponge model, which describes the casein micelle as a compressible particle
(Bouchoux et al., 2010), can most readily accommodate the observed alterations to the
casein micelles, specifically the hydration, size and volume fraction changes. This is
also consistent with recent TEM results (Dalgleish, 2011b; Dalgleish et al., 2012;
McMahon et al., 2008). However, it fails to describe the underlying mechanisms behind
the shift of minerals and caseins between serum and micelle phase. On the other hand,
the hydrophobic interactions and CCP nanocluster links proposed in the dual-binding
model and nano-cluster model, are better able to explain the observed changes in the
partitioning of caseins and minerals, which was also confirmed by recent studies (de
Kruif & Huppertz, 2012a; Holt et al., 2013). Decreasing the temperature is known to
increase the solubility of calcium phosphate and decrease the strength of hydrophobic
interactions, which result in the shift of caseins and calcium mineral towards the serum.
Accordingly, a combination of these models may help in developing improved
understanding of the overall structure of casein micelles. Consequently, the casein
micelle can be described as a highly hydrated sponge-like particle with partly
compressible inner structure. The caseins inside associated with hydrophobic
interactions and other weak bonds as well as CCP links, respond to environmental
changes contemporaneously.
In summary, it is concluded from this work that the state of casein micelles and the
partitioning of caseins and calcium between serum and micelle phase are influenced
considerably during processing and temperature alteration. The conclusions resulting
from this thesis have important implications for improving processing efficiency and
products properties.
110
8.2 Recommendations for Future Research
While the work in this thesis has provided new insights into the behaviour of casein
micelles during processing, it also indicates areas of opportunity for further research.
Detailed investigation of internal structure of casein micelles
The focus of this thesis was on understanding alterations of casein micelles during
processing, and detailed information of the internal structure of casein micelles was not
obtained. Such investigation would develop a better understanding of the casein
micelles and their response to environmental changes. This could be done by
discovering the changes to the state and structural organisation of the caseins and CCP.
According to early studies, the micellar calcium falls into two categories, namely easily
exchanged and difficult to exchange (Wahlgren et al., 1990; Yamauchi et al., 1969;
Zhang et al., 1996). As discussed in this thesis, some micellar calcium was proved to be
difficult to remove during UF. A focused study examining the colloidal minerals would
facilitate the understanding of casein micelle internal structures. Based on previous
study of the equilibrium thermodynamic model of mineral-casein interactions (Holt,
2004) and recent analysis of CCP nanocluster distribution inside casein micelles (de
Kruif et al., 2012b), this study would concentrate on measuring and comparing the
amounts of major ionic species in different casein micelle systems, such as UF/DF
retentates, skim milk, MPC in different buffers at different pH. A further study
comparing the distribution of CCP nano-clusters in casein micelles in these different
milk system using small angle X-ray scattering would provide more insight into this.
This could be combined with cryo-TEM investigation of the internal structural changes
of the casein micelles in response to environmental and processing conditions.
Further study of casein micelles in UF polarisation and fouling layer
As mentioned above, casein is an important component of the concentration
polarization and the gel layer during UF. However, there is currently only limited
knowledge about casein micelle structure and UF fouling. To gain major insight into
this, comparison of the structure of the casein micelles in the bulk milk system and the
111
gel layer need to be done. The particle-particle interactions and effects of temperature
and minerals on casein micelles also need to be taken into account. Ultimately, this will
lead to better membrane performance and higher processing efficiency.
Diafiltration induced alterations and further study of lactose effects on casein micelles
There is also an opportunity to increase the understanding of diafiltration effects on
casein micelles in future study. With the combination of UF and DF, most of the CCP
and micellar lactose will be removed from casein micelles due to extensive addition of
water. While there is literature covering the effect of UF/DF effects on cheese
processing, concentrated milk fermentation and milk coagulation (Alvarez et al., 1998;
Caron, St-Gelais & Pouliot, 1997; Covacevich & Kosikowski, 1977; Ernstrom,
Sutherland & Jameson, 1980), information on the casein micelle structure and lactose
effects were not examined. A further understanding could ultimately lead to
optimisation of processing parameters and improvement of the functional properties of
the end products.
112
References
Abrams, S. A., Griffin, I. J., & Davila, P. M. (2002). Calcium and zinc absorption from
lactose-containing and lactose-free infant formulas. American Journal of Clinical
Nutrition, 76, 442-446.
Ali, A. E., Andrews, A. T., & Cheeseman, G. C. (1980). Influence of storage of milk on
casein distribution between micellar and soluble phases. Journal of Dairy Research, 47,
371-382.
Alvarez, F., Argüello, M., Cabero, M., Riera, F. A., Alvarez, R., Iglesias, J. R., &
Granda, J. (1998). Fermentation of concentrated skim-milk. Effects of different
protein/lactose ratios obtained by ultrafiltration–diafiltration. Journal of the Science of
Food and Agriculture, 76(1), 10-16.
Anema, S. G. (1998). Effect of milk concentration on heat-induced, pH-dependent
dissociation of casein from micelles in reconstituted skim milk at temperature between
20 and 120 °C. Journal of Agricultural and Food Chemistry, 46, 2299-2305.
Anema, S. G. (2008). Effect of milk solids concentration on whey protein denaturation,
particle size changes and solubilization of casein in high-pressure-treated skim milk.
International Dairy Journal, 18, 228-235.
Anema, S. G., & Klostermeyer, H. (1997). Heat induced, pH dependent dissociation of
casein micelles on heating reconstituted skim milk at temperature below 100 °C.
Journal of Agricultural and Food Chemistry, 45, 1108-1115.
Anema, S. G., & Li, Y. (2000). Further studies on the heat-induced, pH dependent
dissociation of casein from the micelles in reconstituted skim milk. Lebensmittel-
Wissenschaft und -Technologie, 33, 335-343.
Anema, S. G., & Li, Y. (2003). Association of denatured whey proteins with casein
micelles in heated reconstituted skim milk and its effect on casein micelle size. Journal
of Dairy Research, 70(1), 73-83.
Anema, S. G., Lowe, E. K., & Li, Y. (2004). Effect of pH on the viscosity of heated
reconstituted skim milk. International Dairy Journal, 14(6), 541-548.
Anema, S. G., Lowe, E. K., & Stockmann, R. (2005). Particle size changes and casein
solubilisation in high-pressure-treated skim milk. Food Hydrocolloids, 19(2), 257-267.
Beliciu, C. M., & Moraru, C. I. (2009). Effect of solvent and temperature on the size
distribution of casein micelles measured by dynamic light scattering. Journal of Dairy
Science, 92(5), 1829-1839.
Bienvenue, A., Jiménez-Flores, R., & Singh, H. (2003). Rheological Properties of
Concentrated Skim Milk: Importance of Soluble Minerals in the Changes in Viscosity
During Storage. Journal of Dairy Science, 86(12), 3813-3821.
Bingham, E. W. (1971). Influence of Temperature and pH on the Solubility of αs1-, β-
and κ-Casein. Journal of Dairy Science, 54(7), 1077-1080.
Bingham, E. W., & Farrell, H. M. (1974). Casein Kinase from the Golgi Apparatus of
Lactating Mammary Gland. Journal of Biological Chemistry, 249(11), 3647-3651.
Bingham, E. W., McGranaghan, M. B., Wickham, E. D., Leung, C. T., & Farrell Jr, H.
M. (1993). Properties of [Ca2+
+ Mg2+
]-Adenosine Triphosphatases in the Golgi
Apparatus and Microsomes of the Lactating Mammary Glands of Cows. Journal of
Dairy Science, 76(2), 393-400.
Bouchoux, A., Cayemitte, P.-E., Jardin, J., Gésan-Guiziou, G., & Cabane, B. (2009).
Casein micelle dispersions under osmotic stress. Biophysical Journal, 96, 693-706.
113
Bouchoux, A., Debbou, B., Gésan-Guiziou, G., Famelart, M.-H., Doublier, J.-L., &
Cabane, B. (2009). Rheology and phase behavior of dense casein micelle dispersions.
Journal of Chemical Physics, 131, 165106.
Bouchoux, A., Gésan-Guiziou, G., Pérez, J., & Cabane, B. (2010). How to Squeeze a
Sponge: Casein Micelles under Osmotic Stress, a SAXS Study. Biophysical Journal,
99(11), 3754-3762.
Bouzid, H., Rabiller-Baudry, M., Paugam, L., Rousseau, F., Derriche, Z., & Bettahar, N.
E. (2008). Impact of zeta potential and size of caseins as precursors of fouling deposit
on limiting and critical fluxes in spiral ultrafiltration of modified skim milks. Journal of
Membrane Science, 314(1-2), 67-75.
Caron, A., St-Gelais, D., & Pouliot, Y. (1997). Coagulation of milk enriched with
ultrafiltered or diafiltered microfiltered milk retentate powders. International Dairy
Journal, 7(6–7), 445-451.
Castillo, M., Lucey, J. A., & Payne, F. A. (2006). The effect of temperature and
inoculum concentration on rheological and light scatter properties of milk coagulated by
a combination of bacterial fermentation and chymosin. Cottage cheese-type gels.
International Dairy Journal, 16(2), 131-146.
Chandrapala, J., Martin, G. J. O., Zisu, B., Kentish, S. E., & Ashokkumar, M. (2012).
The effect of ultrasound on casein micelle integrity. Journal of Dairy Science, 95(12),
6882-6890.
Charley, P., & Saltman, P. (1963). Chelation of Calcium by Lactose: Its Role in
Transport Mechanisms. Science, 139(3560), 1205-1206.
Choi, J., Horne, D. S., & Lucey, J. A. (2007). Effect of insoluble calcium concentration
on rennet coagulation properties of milk. Journal of Dairy Science, 90, 2612-2623.
Choi, J., Horne, D. S., & Lucey, J. A. (2011). Determination of molecular weight of a
purified fraction of colloidal calcium phosphate derived from the casein micelles of
bovine milk. Journal of Dairy Science, 94(7), 3250-3261.
Clare, D. A., & Swaisgood, H. E. (2000). Bioactive Milk Peptides: A Prospectus.
Journal of Dairy Science, 83(6), 1187-1195.
Considine, T., Patel, H. A., Anema, S. G., Singh, H., & Creamer, L. K. (2007).
Interactions of milk proteins during heat and high hydrostatic pressure treatments -- A
Review. Innovative Food Science & Emerging Technologies, 8(1), 1-23.
Corredig, M., & Dalgleish, D. G. (1996). Effect of temperature and pH on the
interactions of whey proteins with casein micelles in skim milk. Food Research
International, 29(1), 49-55.
Corredig, M., & Dalgleish, D. G. (1999). The mechanisms of the heat-induced
interaction of whey proteins with casein micelles in milk. International Dairy Journal,
9(3-6), 233-236.
Covacevich, H. R., & Kosikowski, F. V. (1977). Skim milk concentration for cheese
making by alternative ultrafiltration procedures. Journal of Food Science, 42(5), 1359-
1361.
Creamer, L. K., Berry, G. P., & Mills, O. E. (1977). A study of the dissociation β-casein
from the bovine casein micelle at low temperature. New zealand journal of dairy
science and technology, 12(1), 58-66.
Creamer, L. K., & MacGibbon, A. K. H. (1996). Some recent advances in the basic
chemistry of milk proteins and lipids. International Dairy Journal, 6, 539-568.
DairyAustralia (2013). Dairy 2013 Situation and Outlook. Melbourne: Dairy Australia
Ltd.
114
Dalgleish, D. G. (1983). Coagulation of renneted bovine casein micelles: dependence on
temperature, calcium ion concentration and ionic strength. Journal of Dairy Research,
50(03), 331-340.
Dalgleish, D. G. (1998). Casein micelles as colloids surface structures and stabilities.
Journal of Dairy Science, 81, 3013-3018.
Dalgleish, D. G. (2011a). On the structural models of bovine casein micelles-review and
possible improvements. Soft Matter, 7, 2265-2272.
Dalgleish, D. G. (2011b). On the structural models of bovine casein micelles-review
and possible improvements. Soft Matter, 7(6), 2265-2272.
Dalgleish, D. G., & Corredig, M. (2012). The Structure of the Casein Micelle of Milk
and Its Changes During Processing. Annual review of food science and technology, 3(1),
449-467.
Dalgleish, D. G., Horne, D. S., & Law, A. J. R. (1989). Size related differences in
bovine casein micelles. Biochimica et Biophysica Acta, 991, 383-387.
Darling, D. F., & Dickson, J. (1979). Electrophoretic mobility of casein micelles.
Journal of Dairy Research, 46(03), 441-451.
David, C., Pignon, F., Narayanan, T., Sztucki, M., Gesan-Guiziou, G., & Magnin, A.
(2008). Spatial and Temporal in Situ Evolution of the Concentration Profile during
Casein Micelle Ultrafiltration Probed by Small-Angle X-ray Scattering. Langmuir,
24(9), 4523-4529.
Davies, D. T., & Law, A. J. R. (1983). Variation in the protein composition of bovine
casein micelles and serum casein in relation to micellar size and milk temperature.
Journal of Dairy Research, 50(01), 67-75.
Davies, D. T., & White, J. C. D. (1960). The use of ultrafiltration and dialysis in
isolating the aqueous phase of milk and in determining the partition of milk constituents
between the aqueous and disperse pahses. Journal of Dairy Research, 27, 171-190.
de Kruif, C. G. (1999). Casein micelle interactions. International Dairy Journal, 9, 183-
188.
de Kruif, C. G., & Grinberg, V. Y. (2002). Micellisation of β-casein. Colloids and
Surfaces A: Physicochemical and Engineering Aspects, 210(2–3), 183-190.
de Kruif, C. G., & Holt, C. (2003). Casein micelle structure, functions and interactions.
In: P. F. Fox, & P. L. H. McSweeney, Advanced Dairy Chemistry. Proteins (pp. 233-
276). New York: Kluwer Academic/Plenum Publishers.
de Kruif, C. G., & Huppertz, T. (2012a). Casein Micelles: Size Distribution in Milks
from Individual Cows. Journal of Agricultural and Food Chemistry, 60(18), 4649-4655.
de Kruif, C. G., Huppertz, T., Urban, V. S., & Petukhov, A. V. (2012b). Casein micelles
and their internal structure. Advances in Colloid and Interface Science, 171–172, 36-52.
Dewan, R. K., Bloomfield, V. A., Chudgar, A., & Morr, C. V. (1973). Viscosity and
Voluminosity of Bovine Milk Casein Micelles. Journal of Dairy Science, 56(6), 699-
705.
Dickinson, E. (1989). Surface and emulsifying properties of caseins. Journal of Dairy
Research, 56(03), 471-477.
Donato, L., Guyomarc'h, F., Amiot, S., & Dalgleish, D. G. (2007). Formation of whey
protein/[kappa]-casein complexes in heated milk: Preferential reaction of whey protein
with [kappa]-casein in the casein micelles. International Dairy Journal, 17(10), 1161-
1167.
Downey, W. K., & Murphy, R. F. (1970). The temperature-dependent dissociation of β-
casein from bovine casein micelles and complexes. Journal of Dairy Research, 37(03),
361-372.
115
Elfagm, A. A., & Wheelock, J. V. (1978). Heat interaction between α-lactalbumin, β-
lactoglobulin and casein in bovine milk. Journal of Dairy Science, 61, 159-163.
Ernstrom, C. A., Sutherland, B. J., & Jameson, G. W. (1980). Cheese Base for
Processing. A High Yield Product from Whole Milk by Ultrafiltration. Journal of Dairy
Science, 63(2), 228-234.
Ewbank, J. J., & Creighton, T. E. (1991). The molten globule protein conformation
probed by disulfide bonds. Nature, 350, 518-520.
Famelart, M. H., Le Graet, Y., & Raulot, K. (1999). Casein micelle dispersions into
water, NaCl and CaCl2: physicochemical characteristics of micelles and rennet
coagulation. International Dairy Journal, 9(3–6), 293-297.
Farrell, H., Jr., Cooke, P., Wickham, E., Piotrowski, E., & Hoagland, P. (2003).
Environmental Influences on Bovine κ-Casein: Reduction and Conversion to Fibrillar
(Amyloid) Structures. Journal of Protein Chemistry, 22(3), 259-273.
Farrell Jr, H. M., Jimenez-Flores, R., Bleck, G. T., Brown, E. M., Butler, J. E., Creamer,
L. K., Hicks, C. L., Hollar, C. M., Ng-Kwai-Hang, K. F., & Swaisgood, H. E. (2004).
Nomenclature of the Proteins of Cows’ Milk—Sixth Revision. Journal of Dairy Science,
87(6), 1641-1674.
Farrell Jr, H. M., Malin, E. L., Brown, E. M., & Qi, P. X. (2006). Casein micelle
structure: What can be learned from milk synthesis and structural biology? Current
Opinion in Colloid & Interface Science, 11(2–3), 135-147.
Fernández-Martín, F. (1972). Influence of temperature and composition on some
physical properties of milk and milk concentrates. II. Viscosity. Journal of Dairy
Research, 39(01), 75-82.
Ferrer, M. A., Alexander, M., & Corredig, M. (2011). Does ultrafiltration have a lasting
effect on the physico-chemical properties of the casein micelles? Dairy Science and
Technology, 91(2), 151-170.
Finsy, R. (1994). Particle sizing by quasi-elastic light scattering. Advances in Colloid
and Interface Science, 52, 79-143.
Ford, T. F., Ramsdell, G. A., & Alexander, T. G. (1959). Apparent Specific Volume of
the Calcium Caseinate–Calcium Phosphate Complex in Milk. Journal of Dairy Science,
42(3), 397-408.
Forge, V., Wijesinha, R. T., Balbach, J., Brew, K., Robinson, C. V., Redfield, C., &
Dobson, C. M. (1999). Rapid collapse and slow structural reorganisation during the
refolding of bovine α-lactalbumin. Journal of Molecular Biology, 288(4), 673-688.
Fox, P. F., & Brodkorb, A. (2008). The Casein micelle: Historicaol aspects, current
concenpts and significance. International Dairy Journal, 18, 677-684.
Fox, P. F., & Hoynes, M. C. T. (1975). Heat stability of milk: influence of colloidal
calcium phosphate and β-lactoglobulin. Journal of Dairy Research, 42(03), 427-435.
Fox, P. F., & McSweeney, P. L. H. (1998a). Dairy Chemistry and Biochemistry.
London: Blackie Academic & Professional.
Fox, P. F., & McSweeney, P. L. H. (1998b). Milk Proteins. In: P. F. Fox, & P. L. H.
McSweeney, Dairy Chemistry and Biochemistry. London: Blackie Academic &
Professional.
Fox, P. F., & Morrissey, P. A. (1977). The heat stability of milk. Journal of Dairy
Research, 44(03), 627-646.
Frateur, I., Lecoeur, J., Zanna, S., Olsson, C. O. A., Landolt, D., & Marcus, P. (2007).
Adsorption of BSA on passivated chromium studied by a flow-cell EQCM and XPS.
Electrochimica Acta, 52(27), 7660-7669.
Fukuzaki, S., Urano, H., & Nagata, K. (1995). Adsorption of protein onto stainless-steel
surfaces. Journal of Fermentation and Bioengineering, 80(1), 6-11.
116
Gaiani, C., Ehrhardt, J. J., Scher, J., Hardy, J., Desobry, S., & Banon, S. (2006). Surface
composition of dairy powders observed by X-ray photoelectron spectroscopy and
effects on their rehydration properties. Colloids and Surfaces B: Biointerfaces, 49(1),
71-78.
Gao, R., van Leeuwen, H. P., Temminghoff, E. J., van Valenberg, H. J., Eisner, M. D.,
& van Boekel, M. A. (2010). Effect of Disaccharides on Ion Properties in Milk-Based
Systems. Journal of Agricultural and Food Chemistry, 58(10), 6449-6457.
Gastaldi, E., Trial, N., Guillaume, C., Bourret, E., Gontard, N., & Cuq, J. (2003). Effect
of controlled κ-casein hydrolysis on rheological properties of acid milk gels. Journal of
Dairy Science, 86, 704-711.
Gaucheron, F., Famelart, M. H., Mariette, F., Raulot, K., Michela, F., & Le Graeta, Y.
(1997). Combined effects of temperature and high-pressure treatments on
physicochemical characteristics of skim milk. Food Chemistry, 59(3), 439-447.
Gebhardt, R., Doster, W., Friedrich, J., & Kulozik, U. (2006). Size distribution of
pressure-decomposed casein micelles studied by dynamic light scattering and AFM.
European Biophysics Journal, 35(6), 503-509.
Gésan-Guiziou, G. (2013). Liquid Milk Processing. In: A. Y. Tamime, Membrane
Processing: Dairy and Beverage Applications: Blackwell Publising Ltd.
Griffin, M. C., Lyster, R. L., & Price, J. C. (1988). The disaggregation of calcium-
depleted casein micelles. European Journal Of Biochemistry / FEBS, 174(2), 339-343.
Griffin, M. C. A., Price, J. C., & Martin, S. R. (1986). Effect of alcohols on the structure
of caseins: circular dichroism studies of κ-casein A. International Journal of Biological
Macromolecules, 8(6), 367-371.
Guyomarc'h, F., Law, A. J. R., & Dalgleish, D. G. (2003). Formation of soluble and
micelle-bound protein aggregates in heated milk. Journal of Agricultural and Food
Chemistry, 51(16), 4652-4660.
Hand, D. B., & Sharp, P. F. (1939). The riboflavin content of cow's milk. Journal of
Dairy Science, 22, 779.
Haug, A., Høstmark, A. T., & Harstad, O. M. (2007). Bovine milk in human nutrition-a
review. Lipids in Health and Disease, 6(25), 1-16.
Heldman, D. R., & Hartel, R. W. (1998). Liquid concentration. Principles of food
processing. Gaitherburg, MD: Aspen Publisher.
Henning, D. R., Baer, B. J., Hassan, A. N., & Dave, R. (2006). Major advances in
concentrated and dry milk products, cheese, and milk fat based spreads. Journal of
Dairy Science, 89, 1179-1188.
Holt, C. (1992). Structure and stability of the bovine casein micelle. In: C. B. Anfinsen,
J. D. Edsall, F. R. Richards, & D. S. Eisenberg, Advances in Protein Chemistry (pp. 63-
151). San Diego: Academic Press.
Holt, C. (1993). Interrelationships of the concentrations of some ionic constituents of
human milk and comparison with cow and goat milks. Comparative Biochemistry and
Physiology Part A: Physiology, 104(1), 35-41.
Holt, C. (2004). An equilibrium thermodynamic model of the sequestration of calcium
phosphate by casein micelles and its application to the calculation of the partition of
salts in milk. European Biophysics Journal, 33(5), 421-434.
Holt, C., Carver, J. A., Ecroyd, H., & Thorn, D. C. (2013). Invited review: Caseins and
the casein micelle: Their biological functions, structures, and behavior in foods. Journal
of Dairy Science, 96(10), 6127-6146.
Holt, C., Davies, D. T., & Law, A. J. R. (1986). Effects of colloidal calcium phosphate
content and free calcium ion concentration in the milk serum on the dissociation of
bovine casein micelles. Journal of Dairy Research, 53(04), 557-572.
117
Holt, C., de Kruif, C. G., Tuinier, R., & Timmins, P. A. (2003). Substructure of bovine
casein micelles by small-angle X-ray and neutron scattering. Colloids and Surfaces A:
Physicochemical and Engineering Aspects, 213(2–3), 275-284.
Holt, C., & Sawyer, L. (1988). Primary and predicted secondary structures of the
caseins in relation to their biological functions. Protein Engineering, 2(4), 251-259.
Holt, C., van Kemenade, M. J. J. M., Nelson, L. S. J., Sawyer, L., Harries, J. E., Bailey,
R. T., & Hukins, D. W. L. (1989). Composition and structure of micellar calcium
phosphate. Journal of Dairy Research, 56(03), 411-416.
Horne, D. S. (1998). Casein interactions: Casting light on the black boxes, the structure
in dairy products. International Dairy Journal, 8, 171-177.
Horne, D. S. (2002a). Casein structure, self-assembly and gelation. Current Opinion in
Colloid & Interface Science, 7(5–6), 456-461.
Horne, D. S. (2002b). Caseins Micellar Structure. Milk Proteins (pp. 1902-1909):
Elsevier Science Ltd.
Horne, D. S. (2003). Casein micelles as hard spheres: limitations of the model in
acidified gel formation. Colloids and Surfaces A: Physicochemical and Engineering
Aspects, 213(2–3), 255-263.
Horne, D. S., & Muir, D. D. (1990). Alcohol and Heat Stability of Milk Protein. Journal
of Dairy Science, 73(12), 3613-3626.
Huppertz, T., & de Kruif, C. G. (2007). High pressure-induced solubilisation of micellar
calcium phosphate from cross-linked casein micelles. Colloids and Surfaces A:
Physicochemical Engineering Aspects, 295, 264-268.
Huppertz, T., Fox, P. F., de Kruif, K. G., & Kelly, A. L. (2006). High pressure-induced
changes in bovine milk proteins: A review. Biochimica et Biophysica Acta (BBA) -
Proteins & Proteomics, 1764(3), 593-598.
Huppertz, T., Fox, P. F., & Kelly, A. L. (2004). Properties of casein micelles in high
pressure treated bovine milk. Food Chemistry, 87, 103-110.
Ikeguchi, M., Kuwajima, K., & Sugai, S. (1986). Calcium-induced alteration in the
unfolding behaviour of α-Lactalbumin. Journal of Biochemistry, 99(4), 1191-1201.
Ingram, C. E., Mulcare, C., Itan, Y., Thomas, M., & Swallow, D. (2009). Lactose
digestion and the evolutionary genetics of lactase persistence. Human Genetics, 124(6),
579-591.
Insel, P., Turner, R. E., & Ross, D. (2004). Nutrition. Sudbury, MA: Jones and Bartlett
Publishers.
ISO (2002). Dried milk, dried ice-mixes and processed cheese-Determination of lactose
content. Part2 Enzymatic method utilizing the galactose moiety of the lactose, vol. ISO
5766-2:2002(E). Switzerland: ISO and IDF.
Jang, H. D., & Swaisgood, H. E. (1990). Disulfide Bond Formation Between Thermally
Denatured β-Lactoglobulin and κ-Casein in Casein Micelles. Journal of Dairy Science,
73(4), 900-904.
Jauhiainen, T., & Korpela, R. (2007). Milk Peptides and Blood Pressure. The Journal of
Nutrition, 137(3), 825S-829S.
Jean, K., Renan, M., Famelart, M. H., & Guyomarc'h, F. (2006). Structure and surface
properties of the serum heat-induced protein aggregates isolated from heated skim milk.
International Dairy Journal, 16(4), 303-315.
Jeng, S. L., Lee, S. J., & Lin, S. Y. (1994). Determination of Cadmium and Lead in Raw
Milk by Graphite Furnace Atomic Absorption Spectrophotometer. Journal of Dairy
Science, 77(4), 945-949.
Jenness, R. (1974). Biosynthesis and composition of milk. The Journal of Investigative
Dermatology, 63, 109-118.
118
Jenness, R., & Holt, C. (1987). Casein and lactose concentrations in milk of 31 species
are negatively correlated. Experientia, 43(9), 1015-1018.
Jenness, R., & Koops, J. (1962). Preparation and properties of a salt solution which
simulates milk ultrafiltrate. Netherlands Milk and Dairy Journal, 16, 153-164.
Jenness, R., & Sloan, R. E. (1970). The composition of milks of various species: a
review. Dairy Science Abstracts, 32, 599-612.
Jeurnink, T. J. M., & de Kruif, K. G. (1993). Changes in milk on heating: viscosity
measurements. Journal of Dairy Research, 60, 139-150.
Jovanovic, S., Barac, M., Macej, O., Vucic, T., & Lacnjevac, C. (2007). SDS-PAGE
analysis of soluble proteins in reconstituted milk exposed to different heat treatments.
Sensors, 7(3), 371-383.
Kapsimalis, D. J., & Zall, R. R. (1981). Ultrafiltration of Skim Milk at Refrigerated
Temperatures. Journal of Dairy Science, 64(10), 1945-1950.
Karlsson, A. O., Ipsen, R., & Ardö, Y. (2007). Observations of casein micelles in skim
milk concentrate by transmission electron microscopy. LWT - Food Science and
Technology, 40(6), 1102-1107.
Kegeles, G. (1979). A shell model for size distribution in micelles. The Journal of
Physical Chemistry, 83(13), 1728-1732.
Kerker, M. (1969). The scattering of light, and other electromagnetic radiation New
York Academic Press.
Kleyn, D. H. (1985). Determination of lactose by an enzymatic method. Journal of
Dairy Science, 68, 2791-2798.
Korhonen, H., Pihlanto-Leppäla, A., Rantamäki, P., & Tupasela, T. (1998). Impact of
processing on bioactive proteins and peptides. Trends in Food Science & Technology,
9(8–9), 307-319.
Korhonen, H., & Pihlanto, A. (2007). Technological Options for the Production of
Health-Promoting Proteins and Peptides Derived from Milk and Colostrum. Current
Pharmaceutical Design, 13(8), 829-843.
Krisdhasima, V., Vinaraphong, P., & McGuire, J. (1993). Adsorption Kinetics and
Elutability of α-Lactalbumin, β-Casein, β-Lactoglobulin, and Bovine Serum Albumin at
Hydrophobic and Hydrophilic Interfaces. Journal of Colloid and Interface Science,
161(2), 325-334.
Krishnankutty Nair, P., Alexander, M., Dalgleish, D., & Corredig, M. (2014). Physico-
chemical properties of casein micelles in unheated skim milk concentrated by osmotic
stressing: Interactions and changes in the composition of the serum phase. Food
Hydrocolloids, 34(0), 46-53.
Kronman, M. J., Sinha, S. K., & Brew, K. (1981). Characteristics of the binding of Ca2+
and other divalent metal ions to bovine alpha-lactalbumin. Journal of Biological
Chemistry, 256(16), 8582-8587.
Kumosinski, T. F., Brown, E. M., & Farrell, H. M. (1993). Three dimensional molecular
modeling of bovine caseins: A energy minimized beta casein strucutre. Journal of Dairy
Science, 76, 931-945.
Kumosinski, T. F., & Farrell, H. M. (1994). Solubility of proteins: salt water
interactions. In: N. S. Hettiarachchy, & G. R. Ziegler, Functionallity in Food Systems
(pp. 39-77). New York: Marcel Dekker.
Kuwajima, K. (1996). The molten globule state of α-Lactalbumin. FASEB Journal, 10,
102-109.
Kuwajima, K., Mitani, M., & Sugai, S. (1989). Characterization of the critical state in
protein folding: Effects of guanidine hydrochloride and specific Ca2+
binding on the
folding kinetics of α-lactalbumin. Journal of Molecular Biology, 206(3), 547-561.
119
Law, A. J. R. (1996). Effects of heat treatment and acidification on the dissociation of
bovine casein micelles. Journal of Dairy Research, 63(01), 35-48.
Le Graët, Y., & Brule, G. (1982). Effect of concentration and drying on mineral
equilibria in skim milk and retentates in French. Lait, 62, 113-125.
Le Graët, Y., & Gaucheron, F. (1999). pH-induced solubilization of minerals from
casein micelles: influence of casein concentration and ionic strength. Journal of Dairy
Research, 66(02), 215-224.
Li, J., & Dalgleish, D. (2006). Mixed coagulation of milk: gel formation and mechanism.
Journal of Agricultural and Food Chemistry, 54, 4687-4695.
Lin, S. H. C., Leong, S. L., Dewan, R. K., Bloomfield, V. A., & Morr, C. V. (1972).
Effect of calcium ion on the structure of native bovine casein micelles. Biochemistry,
11(10), 1818-1821.
Liu, D. Z., Dunstan, D. E., & Martin, G. J. O. (2012). Evaporative concentration of
skimmed milk: Effect on casein micelle hydration, composition, and size. Food
Chemistry, 134(3), 1446-1452.
Liu, D. Z., Weeks, M. G., Dunstan, D. E., & Martin, G. J. O. (2013). Temperature-
dependent dynamics of bovine casein micelles in the range 10–40°C. Food Chemistry,
141(4), 4081-4086.
Liu, Y., & Guo, R. (2008). pH-dependent structures and properties of casein micelles.
Biophysical Chemistry, 136(2–3), 67-73.
Livney, Y. D., Corredig, M., & Dalgleish, D. G. (2003). Influence of thermal processing
on the properties of dairy colloids. Current Opinion in Colloid & Interface Science,
8(4–5), 359-364.
Lowe, E. K., Anema, S. G., Bienvenue, A., Boland, M. J., Creamer, L. K., & Jiménez-
Flores, R. (2004). Heat-Induced Redistribution of Disulfide Bonds in Milk Proteins. 2.
Disulfide Bonding Patterns between Bovine β-Lactoglobulin and κ-Casein. Journal of
Agricultural and Food Chemistry, 52(25), 7669-7680.
Lucey, J. A., & Fox, P. F. (1993). Importance of Calcium and Phosphate in Cheese
Manufacture: A Review. Journal of Dairy Science, 76(6), 1714-1724.
Marchin, S., Putaux, J.-L., Pignon, F., & Léonil, J. (2007). Effects of the environmental
factors on the casein micelle structure studied by cryo transmission electron microscopy
and small-angle x-ray scattering/ultrasmall-angle x-ray scattering. Journal of Chemical
Physics, 126, 045101.
Martin, G. J. O. (2008). Physico-chemical studies of milk proteins during powder
manufacture, reconstitution and rennet coagulation. Chemical and bio-molecular
engineering, vol. Ph. D. Melbourne: The University of Melbourne.
Martin, G. J. O., Williams, R. P. W., & Dunstan, D. E. (2007). Comparison of Casein
Micelles in Raw and Reconstituted Skim Milk. Journal of Dairy Science, 90(10), 4543-
4551.
Martin, G. J. O., Williams, R. P. W., & Dunstan, D. E. (2010). Effect of manufacture
and reconstitution of milk protein concentrate powder on the size and rennet gelation
behaviour of casein micelles. International Dairy Journal, 20(2), 128-131.
McGookin, B. J., & Augustin, M. (1991). Antioxidant activity of casein and Maillard
reaction products from casein sugar mixtures. Journal of Dairy Research, 58, 313-320.
McKenna, A. B. (2000). Effect of Processing and Storage on the Reconstitution
Properties of Whole Milk and Ultrafiltered Skim Milk Powders. vol. Ph.D. Palmerston
North: Massey University.
McMahon, D. J., & Brown, R. J. (1984). Composition, Structure, and Integrity of
Casein Micelles: A Review. Journal of Dairy Science, 67(3), 499-512.
120
McMahon, D. J., & McManus, W. R. (1998). Rethinking Casein Micelle Structure
Using Electron Microscopy. Journal of Dairy Science, 81(11), 2985-2993.
McMahon, D. J., & Oommen, B. S. (2008). Supramolecular Structure of the Casein
Micelle. Journal of Dairy Science, 91(5), 1709-1721.
McMahon, D. J., Yousif, B. H., & Kaláb, M. (1993). Effect of whey protein
denaturation on structure of casein micelles and their rennetability after ultra-high
temperature processing of milk with or without ultrafiltration. International Dairy
Journal, 3(3), 239-256.
Meisel, H., & FitzGerald, R. J. (2003). Biofunctional peptides from milk proteins:
Mineral binding and Cytomodulatory effects. Current Pharmaceutical Design, 9, 1289-
1295.
Mezzenga, R., Schurtenberger, P., Burbidge, A., & Michel, M. (2005). Understanding
foods as soft materials. Nat Mater, 4(10), 729-740.
Mikheeva, L. M., Grinberg, N. V., Grinberg, V. Y., Khokhlov, A. R., & de Kruif, C. G.
(2003). Thermodynamics of Micellization of Bovine β-Casein Studied by High-
Sensitivity Differential Scanning Calorimetry. Langmuir, 19(7), 2913-2921.
Mistry, V. V., & Maubois, J. L. (2004). Application of membrane separation technology
to cheese production. In: P. F. Fox, P. L. H. McSweeney, T. M. Cogan, & T. P. Guinee,
Cheese chemistry, physics, and microbiology, vol. 1 (p. 261−286). London, UK:
Elsevier Academic Press.
Mizuno, R., & Lucey, J. A. (2005). Effects of Emulsifying Salts on the Turbidity and
Calcium-Phosphate–Protein Interactions in Casein Micelles. Journal of Dairy Science,
88(9), 3070-3078.
Mora-Gutierrez, A., Kumosinski, T. F., & Farrell, H. M. (1997). Oxygen-17 Nuclear
Magnetic Resonance Studies of Bovine and Caprine Casein Hydration and Activity in
Deuterated Sugar Solutions. Journal of Agricultural and Food Chemistry, 45(12), 4545-
4553.
Morr, C. V. (1967). Effect of Oxalate and Urea upon Ultracentrifugation Properties of
Raw and Heated Skimmilk Casein Micelles. Journal of Dairy Science, 50(11), 1744-
1751.
Morr, C. V. (1975). Chemistry of Milk Proteins in Food Processing. Journal of Dairy
Science, 58(7), 977-984.
Morris, G. A., Foster, T. J., & Harding, S. E. (2000). Futher observation on the size,
shape, and hydration of casein micelles from novel analytical ultracentrifuge and
capillary viscometry approaches. Biomacromolecules, 1, 764-767.
Mozersky, S. M., Farrell Jr, H. M., & Barford, R. A. (1991). The Effects of Sucrose and
Lactose on the Sizes of Casein Micelles Reconstituted from Bovine Caseins. Journal of
Dairy Science, 74(8), 2382-2393.
Müller-Buschbaum, P., Gebhardt, R., Roth, S. V., Metwalli, E., & Doster, W. (2007).
Effect of Calcium Concentration on the Structure of Casein Micelles in Thin Films.
Biophysical Journal, 93, 960-968.
Mulvihill, D. M. (1992). Production, functional properties and utilization of milk
proteins. In: P. F. Fox, Advance Dairy Chemistry, vol. 1 (pp. 369-404). London:
Elsevier Applied Science.
Murthy, G. K., & Rhea, U. (1967). Determination of Major Cations in Milk by Atomic
Absorption Spectrophotometry. Journal of Dairy Science, 50(3), 313-317.
Murthy, G. K., & Rhea, U. (1968). Cadmium and Silver Content of Market Milk.
Journal of Dairy Science, 51(4), 610-613.
Musci, G., & Berliner, L. J. (1985). Physiological roles of zinc and calcium binding to
α-Lactalbumin in lactose biosynthesis. Biochemistry, 24, 6945-6948.
121
Nagy, K., Váró, G., & Szalontai, B. (2012). κ-Casein terminates casein micelle build-up
by its “soft” secondary structure. European Biophysics Journal, 41(11), 959-968.
Nair, K. P., Alexander, M., Dalgleish, D., & Corredig, M. (2014). Physico-chemical
properties of casein micelles in unheated skim milk concentrated by osmotic stressing:
Interactions and changes in the composition of the serum phase. Food Hydrocolloids,
34(0), 46-53.
Nasir, A., & McGuire, J. (1998). Sequential and competitive adsorption of bovine
serum albumin and β-lactoglobulin, and their resistance to exchange with α-lactalbumin
and β-casein. Food Hydrocolloids, 12(1), 95-103.
Nieuwenhuijse, J. A., Timmermans, W., & Walstra, P. (1988). Calcium and phosphate
partitions during the manufacture of sterilized concentrated milk and their relations to
the heat stability. Netherlands Milk and Dairy Journal, 42(4), 387-421.
Nöbel, S., Weidendorfer, K., & Hinrichs, J. (2012). Apparent voluminosity of casein
micelles determined by rheometry. Journal of Colloid and Interface Science, 386(1),
174-180.
O'Connell, J. E., Grinberg, V. Y., & de Kruif, C. G. (2003). Association behavior of β-
casein. Journal of Colloid and Interface Science, 258(1), 33-39.
Oldfield, D. J., Singh , H., & Taylor, M. W. (2005). Kinetics of heat induced whey
protein denaturation and aggregation in skim milks with adjusted whey protein
concentration. Journal of Dairy Research, 72, 369-378.
Oldfield, D. J., Singh, H., Taylor, M. W., & Pearce, K. N. (1998). Kinetics of
Denaturation and Aggregation of Whey Proteins in Skim Milk Heated in an Ultra-high
Temperature (UHT) Pilot Plant. International Dairy Journal, 8(4), 311-318.
Oldfield, D. J., Singh, H., Taylor, M. W., & Pearce, K. N. (2000). Heat-induced
interactions of β-lactoglobulin and α-lactalbumin with the casein micelle in pH adjusted
skim milk. International Dairy Journal, 10(08), 509-518.
Ono, T., Murayama, T., Kaketa, S., & Odagiri, S. (1990). Changes in the protein
composition and size distribution of bovine casein micelles induced by cooling.
Agricultural and Biological Chemistry, 54(6), 1385-1392.
Ono, T., Takagi, Y., & Kunishi, I. (1998). Casein phosphopeptides from casein micelles
by successive digestion with pepsin and trypsin. Bioscience, Biotechnology, and
Biochemistry, 62(1), 16-21.
Orlien, V., Knudsen, J. C., Colon, M., & Skibsted, L. H. (2006). Dynamics of casein
micelles in skim milk during and after high pressure treatment. Food Chemistry, 98,
513-521.
Panouillé, M., Nicolai, T., & Durand, D. (2004). Heat induced aggregation and gelation
of casein submicelles. International Dairy Journal, 14, 297-303.
Park, S.-Y., Nakamura, K., & Niki, R. (1996). Effects of β-lactoglobulin on the
rheological properties of casein micelle rennet gels. Journal of Dairy Science, 79, 2137-
2145.
Pessen, H., Kumosinski, T. F., & Farrell, H. M. J. (1989). Small-angle X-ray scattering
investigation of the micellar and submicellar forms of bovine casein. Journal of Dairy
Research, 56(03), 443-451.
Philippe, M., Le Graët, Y., & Gaucheron, F. (2005). The effects of different cations on
the physicochemical characteristics of casein micelles. Food Chemistry, 90(4), 673-683.
Pierre, A., & Brule, G. (1981). Mineral and protein equilibria between the colloidal and
soluble phases of milk at low temperature. Journal of Dairy Research, 48(03), 417-428.
Post, A. E., Arnold, B., Weiss, J., & Hinrichs, J. (2012). Effect of temperature and pH
on the solubility of caseins: Environmental influences on the dissociation of αS- and β-
casein. Journal of Dairy Science, 95(4), 1603-1616.
122
Pouliot, Y., Boulet, M., & Paquin, P. (1989a). Observations on the heat-induced salt
balance changes in milk I. Effect of heating time between 4 and 90°C. Journal of Dairy
Research, 56(02), 185-192.
Pouliot, Y., Boulet, M., & Paquin, P. (1989b). Observations on the heat induced salt
balance changes in milk 2. Reversibility on cooling. Journal of Dairy Research, 56,
193-199.
PricewaterhouseCoopers (2011). The Australian Dairy Industry.
PricewaterhouseCoopers International Limited.
Pyne, G. T. (1960). The colloidal phosphate of milk 2 Influence of citrate. Journal of
Dairy Research, 27, 9-17.
Rabiller-Baudry, M., Bégoin, L., Delaunay, D., Paugam, L., & Chaufer, B. (2008). A
dual approach of membrane cleaning based on physico-chemistry and hydrodynamics.
Application to PES membrane of dairy industry. Chemical Engineering and Processing:
Process Intensification, 47(3), 267-275.
Rabiller-Baudry, M., Gesan-Guiziou, G., Roldan-Calbo, D., Beaulieu, S., & Michel, F.
(2005). Limiting flux in skimmed milk ultrafiltration: impact of electrostatic repulsion
due to casein micelles. Desalination, 175(1), 49-59.
Rao, K. R., & Brew, K. (1989). Calcium regulates folding and disulfide-bond formation
in α-lactalbumin. Biochemical and Biophysical Research Communications, 163(3),
1390-1396.
Regnault, S., Thiebaud, M., Dumay, E., & Cheftel, J. C. (2004). Pressurisation of raw
skim milk and of a dispersion of phosphocaseinate at 9°C or 20°C: effects on casein
micelle size distribution. International Dairy Journal, 14(1), 55-68.
Renner, E., & Abd El-Salam, M. H. (1991). Application of ultrafiltration in the dairy
industry. London, UK.
: Elsevier LTD.
Rose, D. (1961). Factors Affecting the pH-Sensitivity of the Heat Stability of Milk from
Individual Cows. Journal of Dairy Science, 44(8), 1405-1413.
Rose, D. (1968). Relation between micellar and serum casein in bovine milk. Journal of
Dairy Science, 51, 1897-1902.
Rose, D., & Colvin, J. R. (1966). Internal Structure of Casein Micelles from Bovine
Milk. Journal of Dairy Science, 49(4), 351-355.
Rose, D., & Tessier, H. (1959). Composition of Ultrafiltrates from Milk Heated at 80 to
230° F. in Relation to Heat Stability. Journal of Dairy Science, 42(6), 969-980.
Rossi, P., Giansanti, F., Boffi, A., Ajello, M., Valenti, P., Chiancone, E., & Antonini, G.
(2002). Ca2+
binding to bovine lactoferrin enhances protein stability and influences the
release of bacterial lipopolysaccharide. Biochemistry and Cell Biology, 80(1), 41-48.
Sakono, M., Motomura, K., Maruyama, T., Kamiya, N., & Goto, M. (2011). Alpha
casein micelles show not only molecular chaperone-like aggregation inhibition
properties but also protein refolding activity from the denatured state. Biochemical and
Biophysical Research Communications, 404(1), 494-497.
Sandra, S., Cooper, C., Alexander, M., & Corredig, M. (2011). Coagulation properties
of ultrafiltered milk retentates measured using rheology and diffusing wave
spectroscopy. Food Research International, 44(4), 951-956.
Sandra, S., & Corredig, M. (2013). Rennet induced gelation of reconstituted milk
protein concentrates: The role of calcium and soluble proteins during reconstitution.
International Dairy Journal, 29(2), 68-74.
Sandra, S., & Dalgleish, D. G. (2007). The effect of ultra high-pressure homogenization
(UHPH) on rennet coagulation properties of unheated and heated fresh skimmed milk.
International Dairy Journal, 17(9), 1043-1052.
123
Sawyer, L., Barlow, P. N., Boland, M. J., Creamer, L. K., Denton, H., Edwards, P. J. B.,
Holt, C., Jameson, G. B., Kontopidis, G., Norris, G. E., Uhr nov , S., & Wu, S.-Y.
(2002). Milk protein structure—what can it tell the dairy industry? International Dairy
Journal, 12(4), 299-310.
Schaer, J.-J., Milos, M., & Cox, J. A. (1985). Thermodynamics of the binding of
calcium and strontium to bovine α-lactalbumin. FEBS Letters, 190(1), 77-80.
Schmidt, D. G. (1982). Association of caseins and casein micelle structure. In: P. F. Fox,
Developments in Dairy Chemistry (pp. 61–86). London: Elsevier Applied Science.
Sherbon, J. W. (1988). Physical properties of milk. In: N. P. Wong, R. Jenness, M.
Keeney, & E. H. Marth, Fundanmentals of Dairy Chemistry (pp. 409-460). New York:
Van Nostrand Reinhold.
Shimmin, P. D., & Hill, R. D. (1964). An electron microscope study of the internal
structure of casein micelles. Journal of Dairy Research, 31(01), 121-123.
Shipe, W. F., Bassette, R., Deane, D. D., Dunkley, W. L., Hammond, E. G., Harper, W.
J., Kleyn, D. H., Morgan, M. E., Nelson, J. H., & Scanlan, R. A. (1978). Off Flavors of
Milk: Nomenclature, Standards, and Bibliography. Journal of Dairy Science, 61(7),
855-869.
Singh, H. (2007). Interactions of milk proteins during the manufacture of milk powders.
Lait, 87(4-5), 413-423.
Singh, H., & Flanagan, J. (2006). Milk Proteins. In: Y. H. Hui, Handbook of food
science, technology and engineering, vol. 1. Boca Raton: Taylor & Francis Group.
Singh, H., & Fox, P. F. (1985). Heat stability of milk: pH-dependent dissociation of
micellar κ-casein on heating milk at ultra high temperatures. Journal of Dairy Research,
52(04), 529-538.
Singh, H., & Fox, P. F. (1987). Heat stability of milk: role of β-lactoglobulin in the pH-
dependent dissociation of micellar κ-casein. Journal of Dairy Research, 54(04), 509-
521.
Singh, H., McCarthy, O. J., & Lucey, J. A. (1997). Physicochemical properties of milk.
In: P. F. Fox, Advanced Dairy Chemistry, vol. 3 (pp. 469-518). London: Chapman &
Hall.
Snoeren, T., & Damman, H. J. (1984). The voluminosity of casein micelles.
Milchwissenschaft, 39(8), 461-463.
Snoeren, T., Damman, H. J., & Kolk, H. J. (1982). The viscosity of skim milk
concentrates. Netherlands Milk and Dairy Journal, 36, 305-316.
Sood, V. K., Graind, D. K., & Dewan, R. K. (1979). Correlation between micelle
solvation and calcium content. New zealand journal of dairy science and technology, 14,
32-34.
Sørensen, H., Pedersen, J. S., Mortensen, K., & Ipsen, R. (2013). Characterisation of
fractionated skim milk with small-angle X-ray scattering. International Dairy Journal,
33(1), 1-9.
Srilaorkul, S., Ozimek, L., Ooraikul, B., Hadziyev, D., & Wolfe, F. (1991). Effect of
Ultrafiltration of Skim Milk on Casein Micelle Size Distribution in Retentate. Journal
of Dairy Science, 74(1), 50-57.
St-Gelais, D., Haché, S., & Gros-Louis, M. (1992). Combined Effects of Temperature,
Acidification, and Diafiltration on Composition of Skim Milk Retentate and Permeate.
Journal of Dairy Science, 75(5), 1167-1172.
Strom, M. B., Svendsen, J. S., & Rekdal, O. (2000). Antibacterial activity of 15-residue
lactoferricin derivatives. The Journal of Peptide Research, 56(5), 265-274.
TetraPak (1995). Dairy Processing Handbook. Lund, Sweden: Tetra Pak Processing
Systems AB.
124
Thompson, A., Boland, M., & Singh , H. (2009). Milk Proteins: from expression to food.
Elsevier.
Tran Le, T., Saveyn, P., Hoa, H. D., & Van der Meeren, P. (2008). Determination of
heat-induced effects on the particle size distribution of casein micelles by dynamic light
scattering and nanoparticle tracking analysis. International Dairy Journal, 18(12),
1090-1096.
Tranchant, C. C., Dalgleish, D. G., & Hill, A. R. (2001). Different coagulation
behaviour of bacteriologically acidified and renneted milk: the importance of fine-
tuning acid production and rennet action. International Dairy Journal, 11(4–7), 483-494.
Trejo, R., Dokland, T., Jurat-Fuentes, J., & Harte, F. (2011). Cryo-transmission electron
tomography of native casein micelles from bovine milk. Journal of Dairy Science,
94(12), 5770-5775.
Tsioulpas, A., Lewis, M. J., & Grandison, A. S. (2007). Effect of Minerals on Casein
Micelle Stability of Cows' Milk. Journal of Dairy Research, 74(02), 167-173.
Udabage, P., McKinnon, I. R., & Augustin, M. A. (2003). The use of sedimentation
field flow fractionation and photon correlation spectroscopy in the characterization of
casein micelles. Journal of Dairy Research, 70(04), 453-459.
Van Hooydonk, A. C. M., Hagedoorn, H. G., & Boerrigter, I. J. (1986). pH-induced
physico-chemical changes of casein micelles in milk and their effect on renneting. 1.
Effects of acidification on physico-chemical properties. Netherlands Milk and Dairy
Journal, 40, 281-296.
Vélez-Ruiz, J. F., & Barbosa-Cánovas, G. V. (1998). Rheological properties of
concentrated milk as a function of concentration, temperature and storage time. Journal
of Food Engineering, 35(2), 177-190.
Vélez-Ruiz, J. F., & Barbosa-Cánovas, G. V. (2000). Flow and structural characteristics
of concentrated milk Journal of Texture Studies, 31(3), 315-333.
Visser, H. (1992). A new casein micelle model and its consequences for pH and
temperature effects on the properties of milk. In: H. Visser, Protein interactions.
Weinheim, Germany: VCH.
Visser, J., & Jeurnink, T. J. M. (1997). Fouling of heat exchangers in the dairy industry.
Experimental Thermal and Fluid Science, 14(4), 407-424.
Visser, J., Minihan, A., Smits, P., Tjan, S. B., & Heertje, I. (1986). Effects of pH and
temperature on the milk salt system. Netherlands Milk and Dairy Journal, 40(4), 351-
368.
Vujicic, I., & Deman, J. M. (1966). Soluble colloidal equilibria of constituents of
concentrated milk. Milchwissenschaft, 21, 346-349.
Wahlgren, N. M., Dejmek, P., & Drakenberg, T. (1990). A 43Ca and 31P NMR study of
the calcium and phosphate equilibria in heated milk solutions. Journal of Dairy
Research, 57(03), 355-364.
Walstra, P. (1979). The voluminosity of bovine casein micelles and some of its
implications. Journal of Dairy Research, 46(02), 317-323.
Walstra, P. (1990). On the Stability of Casein Micelles. Journal of Dairy Science, 73(8),
1965-1979.
Walstra, P. (1999). Casein sub-micelles: do they exist? International Dairy Journal,
9(3–6), 189-192.
Walstra, P., & Jenness, R. (1984). Dairy Chemistry and Physics. New York: Wiley.
Ward, B. R., Goddard, S. J., Augustin, M., & McKinnon, I. R. (1996). Distribution of
proteins in concentrated skim milk reconstituted from low- and high-heat milk powders.
Journal of Dairy Research, 63(4), 643-648.
125
Waugh, D. F. (1958). The interactions of [small alpha]s-[small beta]- and [small kappa]-
caseins in micelle formation. Discussions of the Faraday Society, 25(0), 186-192.
Welch, M. W., Hamar, D. W., & Fettman, M. J. (1990). Method comparison for
calcium determination by flame atomic absorption spectrophotometry in the presence of
phosphate. Clinical Chemistry, 36(2), 351-354.
Whitaker, R., Sherman, J. M., & Sharp, P. F. (1927). Effect of Temperature on the
Viscosity Of Skim milk. Journal of Dairy Science, 10(4), 361-371.
Yamauchi, K., Yoneda, Y., Koga, Y., & Tsugo, T. (1969). Exchangeability of colloidal
calcium in milk with soluble calcium. Agricultural and Biological Chemistry, 33(6),
907-914.
Zanna, S., Compère, C., & Marcus, P. (2006). XPS characterisation of BSA adsorption
on stainless steel. In: P. Marcus, & V. Maurice, Passivation of Metals and
Semiconductors, and Properties of Thin Oxide Layers (pp. 365-370). Amsterdam:
Elsevier Science.
Zhang, Z. P., Fujii, M., & Aoki, T. (1996). Behavior of Calcium and Phosphate in
Artificial Casein Micelles. Journal of Dairy Science, 79, 1722-1727.
126
Appendix: Physical properties of whole bovine milk (Sherbon, 1988;
Singh et al., 1997; Walstra et al., 1984)
Osmotic pressure
aw
Boiling point
Freezing point
Refractive index, nD20
Specific refractive index
Density (20 °C)
Specific gravity (20 °C)
Specific conductance
Ionic strength
Surface tension (20 °C)
Coefficient of viscosity
Thermal conductivity (2.9% fat)
Thermal diffusivity (15-20 °C)
Specific heat
pH (25 °C)
Titratable acidity
Coefficient of cubic expansion (273-333K)
Redox potential (25 °C, pH 6.6, in equilibrium with
air)
700 kPa
0.993
100.15 °C
-0.522 °C (approx.)
1.344-1.349
0.2075
1030 kg·m-3
1.0321
0.0050 ohm-1
·cm-1
0.08 M
52 N·m-1
2.127 mPa·s
0.559 W·m-1
·K-1
1.25×10-7
·m2·s
-1
3.931 kJ·kg-1
·K-1
6.6
1.3-2.0 meq OH- per 100 ml
(0.14-0.16% as lactic acid)
0.0008 m3·m
-3·K
-1
+0.25 to +0.35 V
Minerva Access is the Institutional Repository of The University of Melbourne
Author/s:
LIU, ZHE
Title:
Fundamental study of physical and biochemical alterations to casein micelles during milk
evaporation and ultrafiltration
Date:
2013
Citation:
Liu, Z. (2013). Fundamental study of physical and biochemical alterations to casein micelles
during milk evaporation and ultrafiltration. PhD thesis, Department of Chemical and
Biomolecular Engineering, The University of Melbourne.
Persistent Link:
http://hdl.handle.net/11343/39867
File Description:
Fundamental study of physical and biochemical alterations to casein micelles during milk
evaporation and ultrafiltration
Terms and Conditions:
Terms and Conditions: Copyright in works deposited in Minerva Access is retained by the
copyright owner. The work may not be altered without permission from the copyright owner.
Readers may only download, print and save electronic copies of whole works for their own
personal non-commercial use. Any use that exceeds these limits requires permission from
the copyright owner. Attribution is essential when quoting or paraphrasing from these works.
Top Related