tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans...

59
TED 1

Transcript of tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans...

Page 1: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

TED

1

Page 2: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

TED

2

Page 3: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

http://www.arwen-undomiel.com/images/saruman.php http://img.timeinc.net/ew/img/review/011214/lord_l.jpg

3

Page 4: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

http://www.arwen-undomiel.com/images/saruman.php http://ljk.imag.fr/membres/Jocelyn.Etienne/avalanches.html

4

Page 5: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

We love the idea that words pronounced, little more than pure information, can evoke actions in the physical world.

Great (but lazy) hackers

And of course, given programmablecomputers and robots, they can.

Sorcerer's ApprenticeLinus Torvalds

5

Page 6: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

I only have "execute" permissions for such spell-programson your brain-computers for the duration of my talk.

http://www.bbc.co.uk/herefordandworcester/content/image_galleries/hereford_morecambe_fans_gallery.shtml

Leader/Politicians are much better. They are good at gettingarbitrary programs run almost all of the time:"Build a pyramid" or "Go to war!"

or, sometimes, "Drop the price of AIDS drugs."

6

Page 7: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

1110110110001001100011010010011000001010011011110100111110000100110100011110000011101010111011100110010010010000110100001000100010000010100000011110000010111011011011110100011111000...

7

Page 8: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

1110110110001001100011010010011000001010011011110100111110000100110100011110000011101010111011100110010010010000110100001000100010000010100000011110000010111011011011110100011111000...

"pronounced"with a computer

8

Page 9: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Hello TED!

1110110110001001100011010010011000001010011011110100111110000100110100011110000011101010111011100110010010010000110100001000100010000010100000011110000010111011011011110100011111000...

"pronounced"with a computer

9

Page 10: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Hello TED!Hello TED!

1110110110001001100011010010011000001010011011110100111110000100110100011110000011101010111011100110010010010000110100001000100010000010100000011110000010111011011011110100011111000...

"pronounced"with a computer

10

Page 11: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Hello TED!

Hello TED!Hello TED!

1110110110001001100011010010011000001010011011110100111110000100110100011110000011101010111011100110010010010000110100001000100010000010100000011110000010111011011011110100011111000...

"pronounced"with a computer

11

Page 12: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Hello TED!

Hello TED!Hello TED!

#include <stdio.h>#include <stdlib.h>

int main(void){ int i; for (i = 1; i < 4; i++) { printf("Hello TED!\n"); }}

1110110110001001100011010010011000001010011011110100111110000100110100011110000011101010111011100110010010010000110100001000100010000010100000011110000010111011011011110100011111000...

"pronounced"with a computer

compiled from a high level language

12

Page 13: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

So computer programs are spells, and verbal or written directions to humans are spells,but this is unsatisfying.

13

Page 14: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

So computer programs are spells, and verbal or written directions to humans are spells,but this is unsatisfying.

The wonderful fact is that there are spells that workwithout a computer (or human robot).

14

Page 15: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

So computer programs are spells, and verbal or written directions to humans are spells,but this is unsatisfying.

The wonderful fact is that there are spells that workwithout a computer (or human robot).

The fact is, that at the molecular level, when spells are pronounced as molecules,physics can directly interpret information and run programs.

15

Page 16: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

The fact is, that at the molecular level, when spells are pronounced as molecules,physics can directly interpret information and run programs.

PLPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAALLQQFAELTSIPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRF...

16

Page 17: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

The fact is, that at the molecular level, when spells are pronounced as molecules,physics can directly interpret information and run programs.

PLPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAALLQQFAELTSIPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRF...

Strings of sequence informationpronounced as amino acid chains fold into 3D protein nanomachines.

(Roughly, different combinationsof letters stick to other combinations of letters in complex, context-dependent ways.)

17

Page 18: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

The fact is, that at the molecular level, when spells are pronounced as molecules,physics can directly interpret information and run programs.

A green and purple enzymethat attacks a poor little DNA,and cuts it.

PLPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAALLQQFAELTSIPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRF...

Strings of sequence informationpronounced as amino acid chains fold into 3D protein nanomachines.

18

Page 19: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

The fact is, that at the molecular level, when spells are pronounced as molecules,physics can directly interpret information and run programs.

ANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAGRLPCRKEWVADCQQRK...

Changing the sequence...

19

Page 20: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

The fact is, that at the molecular level, when spells are pronounced as molecules,physics can directly interpret information and run programs.

ANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAGRLPCRKEWVADCQQRK...

Changing the sequence...changes the spell and the 3D folding.

20

Page 21: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

The fact is, that at the molecular level, when spells are pronounced as molecules,physics can directly interpret information and run programs.

ANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAGRLPCRKEWVADCQQRK...

Changing the sequence...changes the spell and the 3D folding.

The resulting nanomachineis now a ligase that connectstwo DNA strands together likea DNA stapler.

21

Page 22: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

In the end the total action of all of these molecule programs and the nano-machines they create is to build a person like you, with its buggy and insecure neural computer.

ANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAGRLPCRKEWVADCQQRK...

Changing the sequence...changes the spell and the 3D folding.

The resulting nanomachineis now a ligase that connectstwo DNA strands together likea DNA stapler.

22

Page 23: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Erik Winfree Bernie Yurke

Len Adleman Ned Seeman

DNA nanotechnologists cast molecular spells with DNA.

Father of DNA nanotech.First DNA computer

Algorithmic self-assembly

DNA tweezers and motors

23

Page 24: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Erik Winfree Bernie Yurke

Len Adleman Ned Seeman

DNA nanotechnologists cast molecular spells with DNA.

Father of DNA nanotech.First DNA computer

Algorithmic self-assembly

DNA tweezers and motors

DNA is cheaper, easier to handle,and easier to understandthan proteins.

24

Page 25: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Erik Winfree Bernie Yurke

Len Adleman Ned Seeman

DNA nanotechnologists cast molecular spells with DNA.

Father of DNA nanotech.First DNA computer

Algorithmic self-assembly

DNA tweezers and motors

DNA is cheaper, easier to handle,and easier to understandthan proteins.

We want to build stuff.

Smaller faster computers.

Black boxes in cells.

DNA analogs of protein motors.

25

Page 26: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Erik Winfree Bernie Yurke

Len Adleman Ned Seeman

DNA nanotechnologists cast molecular spells with DNA.

Father of DNA nanotech.First DNA computer

Algorithmic self-assembly

DNA tweezers and motors

We want to build stuff.

Smaller faster computers.

Black boxes in cells.

DNA analogs of protein motors.

DNA may be handicapped;perhaps less functional thanprotein.But we have a head start.And we have a hope ofwriting compilers...

26

Page 27: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

How can one make any arbitrary shape or patternout of DNA strands?

27

Page 28: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

How can one make any arbitrary shape or patternout of DNA strands?

Perform a type of "DNA origami":Fold a single long strand of DNA (the paper)into the desired shape.

28

Page 29: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nanometers

Given a shape:

29

Page 30: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nanometers

Given a shape:

1. s10t15f, A1, AAAGACAAGCAAGGCCGGAA ACGT 2. s10t17f, B1, AGAGAGAACCACAAGA ATTGAGTTCCAGCGCC 3. s11t14e, C1, AGCACCATTACCATTAAAGGGCGA ...250. s11t16e, D1, CATTCAACA TATCAGAGAGA TAACTAAC ATAA

A computer program designsa set of 250 short DNA sequences,on average each is about 32 letters:

Their job will be to fold the long strand.

30

Page 31: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nanometers

Given a shape:

1. s10t15f, A1, AAAGACAAGCAAGGCCGGAA ACGT 2. s10t17f, B1, AGAGAGAACCACAAGA ATTGAGTTCCAGCGCC 3. s11t14e, C1, AGCACCATTACCATTAAAGGGCGA ...250. s11t16e, D1, CATTCAACA TATCAGAGAGA TAACTAAC ATAA

A computer program designsa set of 250 short DNA sequences,on average each is about 32 letters:

Sequences are "pronounced" using a DNA synthesizer

(The "opposite" of a sequencer.)

Their job will be to fold the long strand.

31

Page 32: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nanometers

Given a shape:

1. s10t15f, A1, AAAGACAAGCAAGGCCGGAA ACGT 2. s10t17f, B1, AGAGAGAACCACAAGA ATTGAGTTCCAGCGCC 3. s11t14e, C1, AGCACCATTACCATTAAAGGGCGA ...250. s11t16e, D1, CATTCAACA TATCAGAGAGA TAACTAAC ATAA

A computer program designsa set of 250 short DNA sequences,on average each is about 32 letters:

Sequences are "pronounced" using a DNA synthesizer

Each letter is replaced by a 30-atomcluster, a different one for eachDNA base A, C, G, or T.

(The "opposite" of a sequencer.) Fedex!

Their job will be to fold the long strand.

32

Page 33: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

All 250 different DNA strands are mixed together.

33

Page 34: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Mg2+

Add a little magnesium salt.

34

Page 35: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

M13mp18 viral genome 7249 bases

Mg2+

35

Page 36: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

36

Page 37: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nanometers

37

Page 38: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nanometers

38

Page 39: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nanometers

Atomic force micrograph(AFM) image.

Gray is DNA, black is themineral mica on which it sits.

39

Page 40: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nm

Change the sequence of staples and one can make a shape with precise holes.

40

Page 41: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nm

Change the sequences of staples and one can make a shape with precise holes. Who likes to stick to friends.

72% are well-formed

41

Page 42: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

100 nm

The technique is not limited to raster-filled shapes. Rigid domains can be combined at defined angles.

88% are well-formed

42

Page 43: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

With still different staple sequences, arbitrary patternsof dots (DNA bumps) can be made on top of rectangles---200 pixels with a resolution of 6 nanometers.

43

Page 44: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

A small change to thesequences does the trick.Better, higher yieldways must be found (2%)

How can we combine pattern covered shapes into larger objects?

44

Page 45: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

An atomic forcemicroscope "feels" the heightof DNA structures with a microscopic finger.Thus these false color3D topographic images are appropriate.

Many scientistsare working toturn this DNAartwork intofunctioning devices and circuits.

45

Page 46: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Eventually we want to learn how to self-assemble anything...

A desalination plant

Solar farm

Bizarro Erik

Why attempt to make self-assembly an exercise in programming?

(I don't really pretend to know what the real applicationswill be; what will we want to make?)

46

Page 47: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

Erik Winfree

Inventor of algorithmic self-assembly This is the very coolest approach,

is truly programming DNA, (in the computer science sense)but I don't have time to talk about it!!!

I work in this guy's lab.

Paul [email protected]/~pwkr

Real soon now (as soon as I get a job)I will release my crappy MATLABcode for DNA origami.6-12 months from now, a company willrelease 3D WSIWYG free, open sourcepython for DNA origami. Yay!Send me email to join the release list.

A 2nd year grad student in China has reproduced thiswork and made China--Lulu Qian.

47

Page 48: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

10000111111110101110100100001000101000100111101001101000100101010010010100101110101001101010100101001010101000101010100110101001001010110010101110010010010100011101011110101000101000010101111001101110100101001000011010111001111010111000011101101101010001000111100111011001111101101000110001110101001010011011011101010110111110011010010110011101010111100101111100100010100101001001011111101000010001111110011110010101011111110101001001010110100011110111101010001101011111010101110111100010010100000100110111101010110101111001011111011000010001010001010101000010100111110101110001011111100110111001...

48

Page 49: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

49

Page 50: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

Wri tten using ~30 atomsper A, C, T or G base.

The writing is "molecular".

http://www.web-books.com/Mobio/Free/Ch3B.htm

2 nm

50

Page 51: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

"pronounced" in a fertilized egg cell,through the processes of RNA transcription,protein translation, and biological development

51

Page 52: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

"pronounced" in a fertilized egg cell,through the processes of RNA transcription,protein translation, and biological development

52

Page 53: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

"pronounced" in a fertilized egg cell,through the processes of RNA transcription,protein translation, and biological development

53

Page 54: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

"pronounced" in a fertilized egg cell,through the processes of RNA transcription,protein translation, and biological development

54

Page 55: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

"pronounced" through biological development ?

evolved code, we don't know biology'shigh level language very well.

55

Page 56: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

"pronounced" through biological development ?

Clearly, molecular information can direct the spontaneousself-organization of amazingartifacts.

How can we write such programs?

56

Page 57: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

GACTTTGGTGGCAAGAGGAGCTGGCGGAGCCCAGCCAGTGGGCGGGGCCAGGGGAGGGGCGGGCAGGTAGGTGCAGCCACTCCTGGGAGGACCCTGCGTGGCCAGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGATCCTTCCCTCTGAGCCAACATCTGGGTCCTGCCTTCGACACCACCCCAAGGCTTCCTACCTTGCGTGC...

Homo Sapiens

57

Page 58: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

AACCGCTGCCGGTCTACAAACCTGCTGCCAGCCGTATGCAGATCGAAAAAGCTGTAGAAATGTTAATCCAGGCCGAACGTCCGGTGATTGTTGCCGGAGGCGGGGTAATCAATGCTGACGCAGCTGCACTGTTACAACAGTTTGCTGAACTGACCAGCATTCCGGTGATCCCAACGCTGATGGGCTGGGGCTGTATCCCGGACGATCATGAACTGATGGCCGGGATGGTGGGCCTGCAAACCGCGCATCGTTACGGTAATGCAACGTTGCTGGCGTCCGACATGGTGTTTGGTATCGGTAACCGTTTTGCTAACCGTCATACCGGTTCGGTAGAGAAATACACTGAAGGGCGCAAAATCGTTCATATCGAT...

2 microns

E. ColiHomo Sapiens

58

Page 59: tedpwkr/talks/TED2007.pdfSo computer programs are spells, and verbal or written directions to humans are spells, but this is unsatisfying. The wonderful fact is that there are spells

AATGCTACTACTATTAGTAGAATTGATGCCACCTTTTCAGCTCGCGCCCCAAATGAAAATATAGCTAAACAGGTTATTGACCATTTGCGAAATGTATCTAATGGTCAAACTAAATCTACTCGTTCGCAGAATTGGGAATCAACTGTTATATGGAATGAAACTTCCAGACACCGTACTTTAGTTGCATATTTAAAACATGTTGAGCTACAGCATTATATTCAGCAATTAAGCTCTAAGCCATCCGCAAAAATGACCTCTTATCAAAAGGAGCAATTAAAGGTACTCTCTAATCCTGACCTGTTGGAGTTTGCTTCCGGTCTGGTTCGCTTTGAAGCTCGAATTAAAACGCGATATTTGAAGTCTTTCGGGCTTCCTCTTAATCTTTTTGATG...

2 microns

0.2 microns

E. ColiHomo Sapiens

M13 bacteriophage

59