Statement of Environmental Effects - Upper Lachlan Shire · GSC Greater Sydney Commission HIS...

Statement of Environmental Effects

Proposed Dog Breeding Facility

Melaleuca Park

148 Bigga Road, Crooked Corner

Prepared for: Ms Alex Hammond April 2018

PO Box 230 Pennant Hills NSW 1715 | P 02 9980 6933 | www.dfpplanning.com.au

http://www.dfpplanning.com.au/

11 Dartford Road, Thornleigh NSW 2120

207/506 Miller Street, Cammeray NSW 2062

PO Box 230 Pennant Hills NSW 1715

t: 02 9980 6933 f: 02 9980 6217 e: [email protected]

DFP Planning Pty Limited ACN 002 263 998 www.dfpplanning.com.au

Printed: 18 April 2018 File Name: P:\PROJECTS\20155A Dog Breeding facilities in Upper Lachlan Shire\Reports\20155A 148 Bigga Road

Crooked Corner SEE.docx Project Manager: Warwick Gosling Client: Ms Alex Hammond Project Number: 20155A Document Control

Version Prepared By Reviewed By Issued To Date Rev_1, Draft Warwick Gosling Hugh Rigney Client 6 April 2018 Rev_2, Draft Warwick Gosling Hugh Rigney Client 10 April 2018 Final Warwick Gosling Hugh Rigney Council 18 April 2018

http://www.dfpplanning.com.au/

dfp | Statement of Environmental Effects | 148 Bigga Road, Crooked Corner | April 2018 ii

Contents

1 Introduction 1

1.1 Commission 1

1.2 Purpose of this Statement 1

1.3 Material Relied Upon 1

2 Background 2

2.1 Pre DA Meeting 2

3 Site Context 3

3.1 Location 3

3.2 Site Description 3

3.3 Surrounding Development 6

4 Proposed Development 7

4.1 Proposed Development 7

5 Environmental Planning Assessment 9

5.1 Planning Controls 9

5.1.1 State Environmental Planning Policy 44 – Koala Habitat 9

5.1.2 Upper Lachlan Local Environmental Plan 2010 9

5.1.3 Upper Lachlan Development Control Plan 2010 10

5.2 Likely Impacts of the Development 12

5.3 Suitability of the Site for Development 13

5.4 Public Interest 13

6 Conclusion 14 Figures Figure 1 Site Location 3

Figure 2 Aerial Photograph 3

Figure 3 Existing Residence 4

Figure 4 Whelping Shed 4

Figure 5 Fenced Dog Runs 5

Figure 6 Example of the proposed kennels 5

Figure 7 Surrounding Development 6

Tables Table 1 Assessment against Relevant Provisions of LEP 9

Table 2 Assessment against Relevant Provisions of DCP 11

Contents

dfp | Statement of Environmental Effects | 148 Bigga Road, Crooked Corner | April 2018 iii

Appendices 1. Distances to adjoining properties

2. Architectural Plans

3. Calaire Civil Report

4. Rodney Stevens Acoustic Report

5. Plan of Management

Abbreviations

AHIP Aboriginal Heritage Impact Permit AS Australian Standard ASS acid sulfate soils BC Act Biodiversity Conservation Act 2016 BCA Building Code of Australia BTA bushfire threat assessment CC construction certificate CIV capital investment value Council Upper Lachlan Shire Council DA development application DCP development control plan DFP DFP Planning Pty Limited DPE NSW Department of Planning and Environment DVT daily vehicle trip EP&A Act Environmental Planning and Assessment Act 1979 EP&A Regulation Environmental Planning and Assessment Regulation 2000 EPI environmental planning instrument ESCP erosion and sedimentation control plan ESD ecologically sustainable development FPL flood planning level FSR floor space ratio GFA gross floor area GSC Greater Sydney Commission HIS heritage impact statement IPC Independent Planning Commission JRPP Joint Regional Planning Panel LEP local environmental plan LGA local government area LPP Local Planning Panel NPW Act National Parks and Wildlife Act 1974 NPWS NSW National Parks and Wildlife Service PA planning agreement OEH NSW Office of Environment and Heritage PAD potential archaeological deposit PVT peak hour vehicle trip REP regional environmental plan RFI Act Rivers and Foreshore Improvement Act 1948 RFS NSW Rural Fire Service RF Act Rural Fires Act 1997

RL reduced level

Contents

dfp | Statement of Environmental Effects | 148 Bigga Road, Crooked Corner | April 2018 iv

Abbreviations

RMS NSW Roads and Maritime Services SEE Statement of Environmental Effects SEPP state environmental planning policy SIS species impact statement WM Act Water Management Act 2000

dfp | Statement of Environmental Effects | 148 Bigga Road, Crooked Corner | April 2018 1

1 Introduction

1.1 Commission DFP has been commissioned by Ms Alex Hammond to prepare a Statement of Environmental Effects (SEE) for the proposed dog breeding facility for 40 breeding dogs at 148 Bigga Road Crooked Corner, “Melaleuca Park” (the site).

This report is to accompany a development application (DA) to Upper Lachlan Shire Council (Council).

The proposed development comprises:

• Use of premises for a dog breeding facility to accommodate 40 breeding dogs;

• Construction of dog kennels and fenced dog runs

• Internal alterations to the existing shed for a whelping shed (dog nursery) including central heating and cooling; and

• Installation of a septic waste system connected to the whelping shed;

1.2 Purpose of this Statement The purpose of this report is to provide Council and relevant NSW State Government Agencies with all relevant information necessary to assess the subject development proposal and to determine the DA in accordance with section 4.16 of the Environmental Planning and Assessment Act 1979 (EP&A Act) and the Environmental Planning and Assessment Regulation 2000 (the Regulation).

This application is a local Development Application and accordingly Upper Lachlan Shire Council is the sole consent authority. An application pursuant to Section 68 of the Local Government Act will be lodged with this application for the onsite septic waste system.

1.3 Material Relied Upon This SEE has been prepared by DFP based on information referred to herein and/or appended to this report and a site inspection undertaken on 25th October 2017.

• Development application plans prepared by DFP Planning Pty Ltd

• Acoustic report prepared by Rodney Stevens Acoustics

• Effluent disposal investigation report prepared by Calaire Civil

• Aerial mapping from Six Maps and Near Maps


2 Background

2.1 Pre DA Meeting A pre-DA meeting was held at Upper Lachlan Council on 25 October 2017 that was attended by Roland Wong Manager Development Assessment, Alex Hammond, Charlotte Hammond, Jess Hammond and Warwick Gosling of DFP Planning. At the pre-DA meeting the following matters were discussed:

• The proposed use would be defined as an animal boarding or training establishment.

• 148 Bigga Road is zoned RU2 Rural Landscape zone where animal boarding or training establishments are permissible with development consent.

• The location of the dog breeding facility is clear of the bushfire prone land.

• The subject site has a bore licence to extract ground water.

• The site is identified as containing Sensitive Land –Soil and accordingly the whelping shed would need to be connected to a septic system.

• The site is identified as biodiversity sensitive land.

• The existing dams located on the site are not classified as water bodies and accordingly the application is not integrated development.

• The development application will need to address SEPP 44-Koala Habitat, as SEPP 44 applies to the former Crookwell Shire. The site does not contain any Koala Habitat as the site has been cleared.

• The application will need to provide information relating to a number of staff, number of deliveries, waste management and any noise attenuation measures.


3 Site Context

3.1 Location The site is located approximately 28 Kilometres North West of Crookwell and 1.3 kilometres west of the intersection of Junction Point road and Bigga Road Crooked Corner. (see Figure 1).

Figure 1 Site Location

3.2 Site Description The site is legally described as Lot 4 in Deposited Plan (DP) 1052848. An aerial photo of the site is provided below.

Figure 2 Aerial Photograph

The site has an area of approximately 82 hectares and a frontage to Bigga Road of approximately 950 metres.

3 Site Context


The site is currently being used as a residence, a breeding facility and for cropping. The site contains a dwelling house (Figure 3), a shed which is being used for whelping purposes (dog nursery) (Figure 4) and fenced outdoor runs (Figure 5). Figure 6 below is a photo of the dog kennels.

Figure 3 Existing Residence

Figure 4 Whelping Shed

3 Site Context


Figure 5 Fenced Dog Runs

Figure 6 Example of the proposed kennels

The land has been cleared and contains a number of paddocks that are under cultivation. The dwelling house, dog runs and shed are located approximately 580 m from the frontage of the site at Bigga Road.

The site contains a number of farm dams and ephemeral creeks however the dogs will be located more than 40 metres from any of the watercourses on the site.

The site is relatively flat with a cross fall from the south eastern corner to the north-western corner land to the south of the site is steeper.

3 Site Context


3.3 Surrounding Development The subject site is located within the rural area of crooked corner. The locality is generally used for grazing and cropping purposes.

Appendix 1 contains a number of screenshots taken from six maps which demonstrates the proximity of the nearest dwelling houses to the proposed dog breeding facility. The aerial mapping indicates that 213 Bigga Road is located 682 m from the facility, the dwelling house located at 2951 Junction point Road is located 1.437 km from the facility however there is a shed located at 2951 Junction point Road which is located approximately 700 m from the facility. Figure 7 below is a photograph of 213 Bigga Road as viewed from the subject site

Figure 7 Surrounding Development


4 Proposed Development

4.1 Proposed Development Development consent is sought to operate a dog breeding facility to accommodate 40 breeding dogs at the subject site. In order to facilitate the proposed dog breeding facility, development consent is sought for the following:

• 18 kennels and associated fenced dog runs. Each dog run is fenced by a 1.8m high chain mesh fence with dimensions of 10 metres by 5 metres. The dog kennels are elevated approximately 1 m above ground access to the kennel via a ramp to provide an air gap between the ground and the kennel for which assists in control of fleas and lice. It also acts as an insulator preventing the cold ground radiating through the floor of the kennel in the winter.

• Use of the existing shed as a whelping area i.e. nursery. The shed is divided into eight runs each containing a second isolation area. Each whelping area has direct access to outdoor space via a gate. The shed will be modified to contain a food preparation area, a vet inspection table and grooming table. Reverse cycle central heating is proposed to ensure climate control for this space.

• A central dog socialisation enrichment area. This area will be fenced into 3 areas. Each socialisation area has a dimension of 30 metres by 30 metres. It is proposed to plant scattered trees for shade and interest. The socialisation area is located adjacent to the dog kennels to enable easy access from the dog runs into the social enrichment area. Each dog run contains an entry gate into the central area adjacent to the enrichment area.

• It is proposed to plant trees around the dog kennel runs and the socialisation enrichment area to create a tree lane. The tree lane will act as a wind break and provide additional shading in the summer.

• The existing dwelling house will continue to be occupied by Alex Hammond, her husband and family. Alex is the dog breeding manager and as such will be able to attend to the dogs at all times.

• Installation of a sub-surface irrigation effluent disposal system. (Approval is also required under Section 68 of the Local Government Act).

Development application plans showing the proposal have been prepared by DFP Planning which are attached at Appendix 2 of this SEE.

The development application seeks consent for 40 breeding dogs, consisting of 5 males and 35 females. It is proposed to breed poodle and spaniel crosses on the site, however this may change over time.

The proposed facility seeks to raise well socialised puppies that have experienced love and care at the site and have been properly trained prior to sale to private individuals. All dogs will be trained away from the main activities where one-on-one dog training is provided. Each dog will be provided with training so that they become able to walk on a lead easily and allow for veterinary inspection.

Once a fortnight usually on a weekend pups are available for inspection and sale. Typically this may be 2 visits per fortnight.

The facility is designed to comply with the Animal Welfare Code Practice Breeding Dogs and Cats which is used by the RSPCA Inspectors. In this regard all dogs will be properly vaccinated, microchipped and registered. In this regard the dog welfare standards include:

1. The breeding dogs are treated as someone’s future pet and will be trained and socialised accordingly.

4 Proposed Development


2. The breeding mums will be de-sexed and rehomed 4 to 5 and a half years of age and only be allowed to whelp no more than 5 times. All breeding males will be de-sexed and rehomed by the age of 7 years.

3. Daily socialisation, training and grooming will exceed NSW standards and there will be significant environmental enrichment available for all breeding dogs.

4. Nutrition will be well in accordance or exceed industry standards.

5. The entire facility will be a quarantined area and no other dogs or unauthorised personnel will be permitted on the facility.

6. Staff to dog ratios will be 1 full time employee staff member for each 25 dogs.


5 Environmental Planning Assessment

This section provides an environmental assessment of the proposed development in respect of the relevant matters for consideration under section 4.15(1) of the Environmental Planning and Assessment Act, 1979 (EP&A Act).

5.1 Planning Controls The following subsections assess the proposal against the relevant provisions of applicable Environmental Planning Instruments (EPIs), Draft EPIs, Development Control Plans (DCPs), Planning Agreements and matters prescribed by the Regulation in accordance with section 4.15(1)(a) of the EP&A Act.

5.1.1 State Environmental Planning Policy 44 – Koala Habitat State Environmental Planning Policy – Koala Habitat (SEPP 44) applies to the former Crookwell Local Government Area. At the pre-DA meeting it was determined that no know Koala sightings have been made on the site. It was agreed that the site does not contain any trees and therefore no Koala Habitat.

Notwithstanding it is one of the aims of SEPP 44 to promote new habitat for Koala populations.

In this regard it is important to minimise the potential interaction between the dog breeding facility and koalas. This can be achieved in the following ways:

• Planting of non-koala feed trees in the dog breeding facility. The 1.8m high dog run fences will form a physical barrier to koalas.

• Should a koala be seen in the vicinity of the site, dogs should be excluded from that particular kennel and WIRES should be called and the location of the koala monitored until such time as it is safely relocated by a wildlife preservation organisation.

5.1.2 Upper Lachlan Local Environmental Plan 2010 Table 1 provides a summary assessment of the proposed development against the relevant provisions of the LEP.

Table 1 Assessment against Relevant Provisions of LEP

Provision Assessment Consistent

Clause 2.2 - Zoning - RU2 Rural Landscape

The proposed development is for the purposes of a dog breeding facility and is defined in the LEP below: “animal boarding or training establishment means a building or place used for the breeding, boarding, training, keeping or caring of animals for commercial purposes (other than for the agistment of horses), and includes any associated riding school or ancillary veterinary hospital.” Animal boarding or training establishments are permitted with consent under this Clause.

Yes

Clause 6.2 - Biodiversity - Sensitive Land: Biodiversity Council must be satisfied that the use of the land for a dog breeding facility will not result in any unacceptable adverse impacts on: (a) a native ecological community, and (b) the habitat of any threatened species, populations or ecological community, and

The site does not contain any trees will and is cleared pasture and cropping land. The dogs will be contained either within the socialisation enrichment area or within their dog kennel runs with the exception of mothers will in the whelping nursery within the shed. Therefore there will be no opportunity for the dogs to interact with any native fauna that may traverse the site. The effluent disposal investigation report prepared by Calaire Civil (Appendix 3) has

Consistent



5.1.3 Upper Lachlan Development Control Plan 2010 Table 2 provides a summary assessment of the proposed development against the relevant provisions of the DCP.

(c) a regionally significant species of fauna and flora or habitat, (d) a habitat element providing connectivity. The application will have to demonstrate the development is designed, sited and will be managed to avoid any adverse environmental impact.

assessed the proposal and determined that a 3000 L septic tank should be installed on the site. The report has assessed the ground conditions and found the site to be suitable for the effluent disposal

Clause 6.3 - Land - Sensitive Land: Soils The site is identified as containing sensitive land relating to soils. Council will consider any adverse impact from the proposed development in relation to: (a) the geotechnical stability of the site, and (b) the probability of increased erosion or other land degradation processes.

The Calaire Civil report that has undertaken an assessment of the subsurface conditions and determined that no groundwater was encountered to a depth of 1.1 m. It is an objective of the operator to minimise the amount of bare ground and the dog runs and socialisation areas are considered to be large enough to prevent the grass from being worn down to the dirt therefore soil erosion will not be an issue with the proposal

Consistent

Clause 6.9 - Essential Services Pursuant to Clause 6.9, the consent authority must be satisfied that the following essential services are available at the site, or that adequate arrangements have been made to make them available when required: (a) the supply of water, (b) the supply of electricity, (c) the disposal and management of sewage, (d) stormwater drainage or on-site conservation, (e) suitable vehicular access. Details to be provided to demonstrate that the site has existing and adequate services to accommodate the proposed development

Each dog run and kennel will be connected to a water supply from the on-site bore. The site is connected to electricity. The dwelling house is connected to rainwater tanks for potable water use. Appendix 3 contains the effluent disposal investigation report which shows the proposed septic system for the breeding facility

Consistent



Table 2 Assessment against Relevant Provisions of DCP

Provision Assessment

Section 3.14 - Notification Council is required to notify the proposed development in accordance with their notification policy and consider any submissions received during the notification period.

Section 4.2.2 - Waterways and Waterbodies

The site is not identified as containing sensitive land (water) pursuant to Clause 6.4 of the LEP. The site does however contain waterways that drain into Mulgowrie Creek. The development does not involve works within 40m of a defined water course, and therefore the application will not trigger integrated development pursuant to Section 91 of the Environmental Planning and Assessment Act 1979. Irrespective, the application will need to consider the impact of the proposal on the functioning of waterways or overland flow paths.

Section 4.2.4 - Groundwater The site is connected to a licensed bore and rainwater tanks that will provide water for the breeding facility. The 40 breeding dogs on site will consume significantly less water than if the site was used for grazing purposes.

Section 4.2.6 - Biodiversity Management The site is identified as containing sensitive biodiversity land. Council will have to be satisfied that the use of the land for a dog breeding facility will not result in any unacceptable adverse impacts on: (a) a native ecological community, and (b) the habitat of any threatened species, populations or ecological community, and (c) a regionally significant species of fauna and flora or habitat, (d) a habitat element providing connectivity. The application will have to demonstrate the development is designed, sited and will be managed to avoid any adverse environmental impact.

No trees are proposed to be removed, It is proposed to plant a significant number of trees within the socialisation enrichment area and establish a tree Lane around the facility. The site is currently devoid of any trees. As discussed previously the dogs are contained within fenced areas so there will be no interaction with former that may traverse the site. There is no opportunity for the dogs to interact with any koalas as there are no koala habitat areas within the vicinity of the site.

Section 4.3.2 - Landscaping The proposal shall use natural screening and trees and provide landscaping of sufficient height and density adequate to screen the development.

There plans at Appendix 2 of this SEE demonstrating the areas where landscaping is proposed.

Section 4.4.2 - Indigenous Heritage and Archaeology

The site is identified as a place of Aboriginal significance. The proposal is unlikely to require an Aboriginal heritage impact assessment as there is minimal excavation or ground disturbance.

Section 4.5.2 - Stormwater Management The whelping shed drainage system shall be constructed so as to ensure the collection of all roof water.

Section 4.6.1 - Traffic and Parking The facility does not generate many vehicle movements. Supplies for the dogs are sourced during normal shopping trips. Once a fortnight usually on a weekend pups are available for inspection and sale. Typically, this may be 2 visits per fortnight. A veterinarian will visit the site as required but on average would be less than once per week. Dog faeces is collected by Alex Hammond and disposed of at the landfill on a weekly basis.



Table 2 Assessment against Relevant Provisions of DCP

Provision Assessment

Section 9.2 - Animal boarding or training establishment, including boarding and/or breeding kennels for dogs and cats in rural areas Objectives - To ensure new kennel development

implements best practice design. - To ensure applicants undertake all

necessary measures to minimise the impacts on adjoining land uses.

Controls Minimum 200m from adjoining dwellings - Exercise areas to be in a purpose-built enclosure and supervised. - Acoustic considerations. Noise levels emitted from the premises are not to exceed 5dB(A) above the existing background levels. - All feed is to be stored and prepared in a properly constructed building capable of being easily cleaned and maintained. - Animals to be confined to the kennel and exercise yards at all times. - Excrement Management to be suitably stored and disposed of. - Drainage: see Section 4.5.2 above. - Landscaping: See section 4.3.2 above

More than 600m from the nearest dwelling An acoustic report has been prepared by Rodney Stevens acoustics which is attached at Appendix 4 of this SEE. The acoustic report indicates that the facility for 40 breeding dogs that noise emissions to the surrounding nearest residential receivers are being calculated to be within the noise criteria as established in accordance with the noise policy for industry. It has been demonstrated that the development will not have an adverse impact on the nearest residential receivers based on the proposed operations. The development application plans at Appendix 2 demonstrate that the food preparation and food storage area will be located within the whelping shed. Dogs will be confined to the kennels, socialisation yard and whelping shed at all times Dog faeces be collected will as a minimum twice daily from each yard and disposed of that a licensed landfill

5.2 Likely Impacts of the Development The following subsections assess the likely impacts of the development in accordance with section 4.15(1)(b) of the EP&A Act.

Fauna

The proposed dog breeding facility will not have any impacts on the natural environment as the dogs will always be contained within kennel and yards and accordingly there will be no interaction with native fauna that may traverse the site.

Water Quality

It is proposed to connect the helping shared to a septic system as proposed in the Calaire civil report at Appendix 3.

The dog yards and socialise social enrichment area is large enough to ensure that groundcover can be maintained so as to prevent any soil erosion.

Acoustic Impact

The acoustic report prepared by Rodney Stevens acoustics has indicated that the proposed facility for 40 breeding dogs will not result in any adverse acoustic impacts on the nearest residential receivers. A copy of the acoustic report is attached at Appendix 4 of this report.



Scenic Quality

The scenic quality of the locality will be enhanced as it is proposed to plan a number of trees on the site and to establish a tree Lane around the facility. The tree lane will assist with microclimates to act as a windbreak and provide shade in summer.

Traffic

The facility will result in negligible impacts on traffic flow as the majority of deliveries to the site will be undertaken by Alex Hammond as part of the normal domestic trips. Once a fortnight usually on a weekend pups are available for inspection and sale. Typically, this may result in 2 visits per fortnight. It is likely that a veterinarian will visit the site on average less than once per week.

Plan of Management

The facility will operate in accordance with the Animal Welfare Code Practice Breeding Dogs and Cats a copy of this is provided in Appendix 5 of this report.

5.3 Suitability of the Site for Development The following subsections assess the suitability of the site in accordance with section 4.15(1)(c) of the EP&A Act.

The assessment provided against the Upper Lachlan LEP and DCP demonstrate if the facility operates in a manner consistent with the subconsultant reports that the site can adequately be accommodated on the site.

5.4 Public Interest In accordance with section 4.15(1)(e) of the EP&A Act, the proposed development is considered to be in the public interest as the dog breeding facility will operate in accordance with the Code and practice breeding dogs and cats. The facility will train the dogs to ensure they are suitably trained to become a loved and valued pet.

The breeding stock will be sold on and rehomed at the age of 5 for the females and 8 for the males.


6 Conclusion

The proposal for a 40-dog breeding facility has been assessed in accordance with the requirements of the EP&A Act, the Upper Lachlan Local Environmental Plan and Development Control Plan. This SEE has also had regard to SEPP Koala Habitat to ensure that the facility does not have any impact on koala populations.

The proposed dog breeding facility has been assessed by Rodney Stevens Acoustics who have determined that the proposed facility will not have any negative impacts on the closest two dwelling houses.

The effluent disposal investigation prepared by Calare Civil indicates how it is proposed to dispose of effluent generated by dogs on the site.

Based on the accompanying plans and reports submitted with this Statement of Environmental Effects, it is the opinion of DFP Planning that development consent should be granted to this application with the following additional conditions:

• No koala feed trees should be planted within or in the vicinity of the facility;

• Should a koala be seen in the vicinity of the dog breeding facility that WIRES or other qualified animal welfare agency be called to relocate the koala. The koala should be monitored and any dogs removed from the vicinity of the koala until such time as the koala is removed;

• All dogs should be registered and microchipped with Council; and

• The operation of the facility should be in accordance with the Animal Welfare Code of Practice breeding dogs and cats.

APPENDIX 1

APPENDIX 2

Subject Site

Entry Road

BIGGA ROAD

See Insert

1:2,000 @ A3Whelping Area

Dwelling

Live in Kennel Area

Socialisation Enrichment Areas

Date: 09/05/18

Drawn: A.C.

Title:

SITE PLAN

At:Lot 4 DP 1052845148 Bigga Road, Crooked Corner

Drawing Prepared by:

DFP Planning Pty LtdPO BOX 230, Pennant Hills, 1715

02 9980 6933www.dfpplanning.com.au

planning consultants

Client:

Alex Hammond 148 Bigga Road, Crooked Corner

P. No: 20155A_Bigga

N

Rev: D

Sheet No: 1/4

Scale: 1:5,000 @A3

Project:

Dog Breeding Facility

Whelping Area

Dwelling


Water Tank

280m19m

550m

540m

223m

640m

20m

2m


Date: 09/05/18

Drawn: A.C.

Title:

SITE PLAN DETAILS





Client:


P. No: 20155A_Bigga

N

Rev: B

Sheet No: 2/4

Scale: 1:250 @A3

Project:


Live In Kennel Area

30m

Socialisation Enrichment Area

Entry Gate Entry GateEntry Gate

90m

Walkway Walkway

Entry Gate

Kennel

10 m

Socialisation Enrichment AreaSocialisation Enrichment Area

Scattered Trees

2m

30m

5m

Tree Lane Tree LaneTree Lane

Tree LaneTree Lane

Tree LaneTr

ee L

ane

Tree

Lan

eTr

ee L

ane

Tree Lane Tree LaneTree Lane Tree Lane


Dwelling

Live in Kennel Area



Date: 09/05/18

Drawn: A.C.

Title:

LIVE IN KENNEL & SOCIAL ENRICHMENT AREAS





Client:


P. No: 20155A_Bigga

N

Rev: D

Sheet No: 3/4

Scale: 1:250 @A3

Project:


FOO

D P

REPA

RATI

ON

STO

RAG

E

STO

RAG

E

GRO

OM

ING

VET

INSP

ECTI

ON

Kennel

Walkway

Main Entry

Person Door

Person Doorwith builtin dog door

Reception

12m

15.5

m

3m

3.85

m

3.5m

3.85

m

2.4m2.4m

2.4m2.4m

2.4m

3m

4m

1.8m

6m

6m


Date: 09/05/18

Drawn: A.C.

Title:

WHELPING AREA/NURSERY FLOOR PLAN





Client:


P. No: 20155A_Bigga

N

Rev: C

Sheet No: 4/4

Scale: 1:100 @A3

Project:



Dwelling

Live in Kennel Area


APPENDIX 3

20180014 19 February, 2018 DFP Planning Pty Limited PO Box 230 PENNANT HILLS NSW 1715 Attention: Hugh Rigney Dear Hugh RE: Effluent Disposal Investigation Dog Breeding Facility

148 Bigga Road, Crooked Corner NSW 2583 INTRODUCTION At your request we have carried out a Geotechnical investigation for the above project. The objectives of this work were to i) identify the subsoils generally underlying the area, and assess subsoil reactivity, ii) Design a method of on-site effluent disposal for the site in accordance with the following Current Recommended Practice (CRP) documents:

AS/NZS 1547:2012 On-site Domestic Wastewater Management (Standards Australia 2012)

NSW Animal Welfare Code of Practice No 5 - Dogs and Cats in Animal Boarding Establishments

On-site Sewage Management for Single Households (Office of Local Government 1998)

Designing & Installing On-Site Wastewater Systems (Sydney Catchment Authority 2012)

The New South Wales Feedlot Manual (NSW DPI / Agriculture 1998)

Septic Tank and Collection Well Accreditation Guideline (NSW Health 2001) LOCATION The site is located on a rural lot located along the Bigga Road. The lot is approximately 80.27ha in size, and the existing dwelling site is not near any permanent surface waters. SUBSURFACE CONDITIONS One soil-observation pit was dug at the site using an excavator. The site stratigraphy at the proposed disposal site as revealed by the soil pit comprised typically of the following:

0mm-300mm: Light brown grey dry silty single grained topsoil 300mm-1100mm: Yellow orange, slightly moist moderately structured clay loam EOP 1100mm

Groundwater was not encountered during the fieldwork.

Image 1: Subsoil investigation at the proposed development site

DISPOSAL OF EFFLUENT General For the subject development, on-site disposal of effluent using conventional absorption beds is considered appropriate. Neutral effects on groundwater are predicted due to moderate percolation rates and large buffer zones. Restrictive Site and Soil Features In accordance with OSMSH the most limiting site or soil feature determines the capability of the subject site for land application of effluent, or the modifications to the site required to allow land application. Relevant sections of the CRP documents have been reviewed with respect to the subject site and reveal that the limiting feature for absorption disposal is soil permeability, imposing minor limitation. Potential restrictive site & soil features located relative to the proposed disposal site are:

Existing dwelling approximately 51m E. Minor limitation.

Closest dam approximately 167m W. Minor limitation.

Drainage depression approximately 41m SSE. Minor limitation.

Intermittent waterway approximately 72m S. Minor limitation.

Closest Bore GW702316 approximately 252m NNE. Minor limitation.

Closest property boundary approximately 15m SSE. Minor limitation.

Weakly structured Category 4 clay loam soil. Minor limitation. The following buffer distances should be adhered to:

6m from building or property boundary at higher elevation

12m from building or property boundary at lower elevation

40m from intermittent water course or dam

100m from permanent surface waters (eg rivers)

Design Effluent Flow The existing facility consists of 8 enclosed kennels 4 whelping areas, and 6 outdoor kennels. It is proposed that an additional 8 enclosed kennels and 4 whelping areas will be constructed in the future. Assumptions for calculation of design flow:

Water saving pressure washer at 5L/minute.

16 Kennels at 4 minutes each = 64 minutes. 64min x 5 = 320L.

8 Whelping areas at 6minutes each = 48 minutes. 48min x 5 = 240L.

Food preparation bowl at 1L per bowl. Allowance = 22L

General washing and cleaning 100L

Total peak flow = 320 + 240 + 16 + 100 = 682L/day, say 685L/day. Therefore: Qd = design daily peak flow rate = 685L/day Soil Properties The methods used to determine absorptive characteristics of site soils in this study were: 1) Visual/tactile assessment of site soil profile 2) Assessment of soil landscape sheets. In accordance with Table L1, we have identified the underlying soils as Category 4 (Clay Loam). Taking into account visual and tactile assessment of soils, in conjunction with documented soil landscape data, we conclude that on site disposal of effluent at the development is possible using conventional absorption beds. We have adopted an indicative permeability (ksat) of 1.5m/d with an associated Design Loading Rate (DLR) of 10 mm/d. Sizing of Bed In accordance with AS/NZS 1547:2012 (Appendix Q), the disposal area required is calculated using a water balance analysis. Rainfall and evaporation data from local gauging stations is used in the calculations. The spreadsheets below summarise calculations. It can be seen that a design disposal area of 63.3m2 is required, with a maximum effluent depth of 426mm.

Month E ET R Rr DLR/mth Disposal Rate Effluent Applied Size of area

mm mm mm mm mm mm per month (L) m2

January 177.00 133 165.00 124 310 319 21080 66

February 143.00 107 163.00 122 280 265 19040 72

March 141.00 106 144.00 108 310 308 21080 68

April 115.00 86 86.00 65 300 322 20400 63

May 82.00 62 73.00 55 310 317 21080 67

June 65.00 49 69.00 52 300 297 20400 69

July 71.00 53 55.00 41 310 322 21080 65

August 98.00 74 46.00 35 310 349 21080 60

September 129.00 97 46.00 35 300 362 20400 56

October 158.00 119 75.00 56 310 372 21080 57

November 172.00 129 99.00 74 300 355 20400 58

December 195.00 146 130.00 98 310 359 21080 59

DEPTH OF STORED EFFLUENT

DLR 10 mm/d

Month First trial m2

Application Rate

Disposal Rate

AR-DR (mm)

Increase in depth of

stored effluent

Depth of effluent for

month

Increase in depth of

effluent

Design depth per mth (mm)

December 63.31 January 333 319 14 47 0 47 47

February 301 265 36 119 47 119 166

March 333 308 25 84 166 84 250

April 322 322 0 2 250 2 251

May 333 317 16 54 251 54 305

June 322 297 25 84 305 84 390

July 333 322 11 37 390 37 426

August 333 349 -16 -53 426 -53 373

September 322 362 -40 -133 373 -133 239

October 333 372 -39 -131 239 -131 108

November 322 355 -33 -108 108 -108 0

December 333 359 -26 -86 0 -86 0

From AS1547:2012, the total required bed length is calculated as follows:

L = Ae/Be Where Ae = 63.31m2 (required area) Be = 2.4m (wetted base of 2.4m wide bed) n.b. a nominal depth of bed of 0.45m is adopted from 0.426m + 0.05m freeboard, rounded up to 0.45m. Then: L = 63.31/2.4 = 26.4m (say 27.0m) In summary, for the facility, adopt two beds each 13.5m long x 2.4m wide x 0.45m deep, adjacent to each other and 2.0m spacing between the beds side wall to side wall (see attached sketch). Effluent delivery to all beds should be even via a distribution box or similar and preferably delivered into the centre of the beds through the top of the self-supporting arches (see attached sketch). The septic tank shall be a minimum 3000L. If site conditions (ie slope restrictions) are greater than 10% then a 1200mm wide bed can be utilised ensuring that the same Required Area (Ae) is achieved (i.e. halving the width will double the required length of the bed) or regrade the site to achieve the required grade of 10%.

MAINTENANCE OF BOARDING AREA General recommendations as per NSW Animal Welfare Code of Practice No 5: All collection & wash down drainage pits should contain a fine mesh wire basket to trap hair and waste. Drainage should be located on all four sides of the whelping shed and directed towards a suitably located septic tank. These baskets should be cleaned daily and particularly after the bays are washed down. The outdoor boarding facilities should have faeces removed at least once daily and disposed of in an environmentally sound manner into the septic tank on site or via collection. Cleaning and disinfecting agents should be chosen on the basis of their suitability, safety and effectiveness, and used to manufacturer’s guidelines. Chlorine based low phosphate cleansers or similar are recommended, and they be applied then wiped down with paper towel or similar and the toweling be disposed of as solid waste. Applying disinfectant or cleanser and immediately washing down the area is not recommended as this will have a negative effect on the septic tank microbial bacteria. Disinfecting should be performed weekly. Care should be taken with any cleansers used in the general washing or prep area as these will also have an effect on the performance of the septic tank. PREPARATION AND MAINTENANCE OF DISPOSAL AREAS General We note that the bed should not be constructed in an area subject to stormwater run-off or ground water concentrations. The upstream flow of stormwater run-off should be diverted from the disposal area. The disposal area is to be stock and vehicle free. Excavation Techniques The following excavation techniques recommended in AS1547:2012 shall be observed so as to minimize the risk of damage to the soil.

(a) Plan to excavate only when the weather is fine. (b) During wet seasons or when construction cannot be delayed until the weather becomes fine, smeared

soil surfaces may be raked to reinstate a more natural soil surface, taking care to use fine tines and only at the surface.

In particular for absorption beds:

(c) If rain is forecast then cover any open beds, to protect them from rain damage. (d) Excavate perpendicular to the line of fall or parallel to the contour of sloping ground. (e) Ensure that the inverts are horizontal.

Disposal Site Cover It is recommended that a fescue/fescue blend (Temperate and Mediterranean blend varieties) or similar be planted on the disposal area, which has year-round active growth, enhancing nutrient uptake (Ref. NSW Feedlot Manual 1998, NSW Department of Agriculture). Other recommended species providing similar data include Ryegrass. Also small trees with non-intrusive root systems planted below the disposal area will improve transpiration and uptake of nutrients (plants suitable for growing in wet soils can be recommended by local nurseries)

Further Considerations The implementation of wastewater and nutrient reduction initiatives such as the following will further improve the performance of the system:

Use of low phosphate/low SAR detergents, and low quantities where practicable.

Use water saving taps and appliances.

Avoid placing fats, oils or food waste into the system. Yours faithfully, CALARE CIVIL PTY LTD

Sean Johnson BE GradIEAust.

C O N S U L T I N G E N G I N E E R S

AutoCAD SHX Text

%%USITE PLAN

AutoCAD SHX Text

SCALE 1:3000

AutoCAD SHX Text

TEST HOLE LOCATION

AutoCAD SHX Text

%%uREFERENCE

AutoCAD SHX Text

Drawn:

AutoCAD SHX Text

Scales:

AutoCAD SHX Text

DWG. No.:

AutoCAD SHX Text

JOB No.:

AutoCAD SHX Text

Date:

AutoCAD SHX Text

Approved:

AutoCAD SHX Text

170 RANKIN STREET, BATHURST, N.S.W. 2795 Tel: (02) 63323343 Fax: (02) 63318210

AutoCAD SHX Text

Rev.

AutoCAD SHX Text

EFFLUENT DISPOSAL REPORT

AutoCAD SHX Text

148 BIGGA ROAD

AutoCAD SHX Text

CROOKED CORNER NSW 2583

AutoCAD SHX Text

DPF PLANNING & ALEX HAMMOND

AutoCAD SHX Text

20180014

AutoCAD SHX Text

E1

AutoCAD SHX Text

A

AutoCAD SHX Text

19/02/2018

AutoCAD SHX Text

AS SHOWN

AutoCAD SHX Text

AJ

AutoCAD SHX Text

E

AutoCAD SHX Text

W

AutoCAD SHX Text

S

AutoCAD SHX Text

%%UEVAPOTRANSPIRATION/ABSORPTION TRENCH DETAIL

AutoCAD SHX Text

NOT TO SCALE

AutoCAD SHX Text

SUITABLE FOR LEVEL SITE TO SLOPING SITE LESS THAN 10%%%

AutoCAD SHX Text

TOPSOIL BACKFILL

AutoCAD SHX Text

700

AutoCAD SHX Text

1000

AutoCAD SHX Text

700

AutoCAD SHX Text

2400

AutoCAD SHX Text

150 MAX.

AutoCAD SHX Text

NATURAL GROUND

AutoCAD SHX Text

450

AutoCAD SHX Text

230

AutoCAD SHX Text

1000 MIN.

AutoCAD SHX Text

TO WEATHERED ROCK

AutoCAD SHX Text

FILTER CLOTH

AutoCAD SHX Text

GRADE FROM CENTERLINE TO

AutoCAD SHX Text

SHED WATER OFF SURFACE

AutoCAD SHX Text

20mm - 40mm NOMINAL AGGREGATE

AutoCAD SHX Text

MIN

AutoCAD SHX Text

SURFACE WATER DIVERSION DRAIN

AutoCAD SHX Text

APPROVED PLASTIC TRENCH SYSTEM

AutoCAD SHX Text

LOCATION OF PROPOSED DEVELOPMENT AND DISPOSAL AREA ARE INDICATIVE ONLY.

AutoCAD SHX Text

FINAL LOCATION DETERMINED BY INSTALLER PENDING SUITABILITY.

AutoCAD SHX Text

EXISTING DWELLING

AutoCAD SHX Text

WHELPING FACILITY

AutoCAD SHX Text

OPEN BOARDING FACILITY

AutoCAD SHX Text

DAM

AutoCAD SHX Text

DRAINAGE DEPRESSION

AutoCAD SHX Text

LOW LYING SEASONAL WETLAND

AutoCAD SHX Text

SUITABLE AREA FOR EFFLUENT DISPOSAL TWO BED 13.5 x 2.4 x 0.45m DEEP

APPENDIX 4


148 Bigga Road, Crooked Corner NSW 2583

Noise Impact Assessment

REPORT R180009R1

Revision 0

Prepared for:

Alex Hammond

148 Bigga Road

CROOKED CORNER NSW 2583

28 March 2018

Rodney Stevens Acoustics Report Number R180009R1 Revision 0

Dog Breeding Facility 148 Bigga Road, Crooked Corner NSW 2583

Noise Impact Assessment Page 2


148 Bigga Road, Crooked Corner NSW 2583

Noise Impact Assessment

PREPARED BY:

Rodney Stevens Acoustics Pty Ltd Telephone: 61 2 9943 5057 Facsimile 61 2 9475 1019 Email: [email protected] Web: www.rodneystevensacoustics.com.au

DISCLAIMER Reports produced by Rodney Stevens Acoustics Pty Ltd are prepared for a particular Client’s objective and are based on a specific scope, conditions and limitations, as agreed between Rodney Stevens Acoustics and the Client. Information and/or report(s) prepared by Rodney Stevens Acoustics may not be suitable for uses other than the original intended objective. No parties other than the Client should use any information and/or report(s) without first conferring with Rodney Stevens Acoustics. The information and/or report(s) prepared by Rodney Stevens Acoustics should not be reproduced, presented or reviewed except in full. Before passing on to a third party any information and/or report(s) prepared by Rodney Stevens Acoustics, the Client is to fully inform the third party of the objective and scope and any limitations and conditions, including any other relevant information which applies to the material prepared by Rodney Stevens Acoustics. It is the responsibility of any third party to confirm whether information and/or report(s) prepared for others by Rodney Stevens Acoustics are suitable for their specific objectives.

DOCUMENT CONTROL

Reference Status Date Prepared Checked Authorised

R180009R1 Revision 0 28 March 2018 Thomas Carney Desmond Raymond Rodney Stevens

mailto:[email protected]




TABLE OF CONTENTS

1 INTRODUCTION 4

2 PROJECT OVERVIEW 4

3 EXISTING NOISE ENVIRONMENT 6

3.1 Surrounding Environment 6

3.2 Ambient Noise Survey 6

4 ASSESSMENT CRITERIA 7

5 NOISE ASSESSMENT 8

5.1 Mechanical Plant Noise Assessment 8

5.2 Predicted Animal Noise Impact 9

5.3 Predicted Animal Noise Impact from Holding Facility 9

6 CONCLUSION 10

Table 3-1 Measured Ambient Noise Levels Corresponding to NSW INP Assessment Time Periods 7 Table 4-1 Operational Project Trigger Noise Levels 8 Table 5-1 Typical Sound Power Level of Dogs 9 Table 5-2 Sound Power Levels of Collective Animal Noise – Lw (dBA) 9 Table 5-3 Animal Holding Facility Noise Assessment at Nearby Sensitive Receivers 9




1 INTRODUCTION

Rodney Stevens Acoustics Pty Ltd (RSA) has been engaged by Alex Hammond to assess the potential noise impact associated with the operation of dog breeding facility located at 148 Bigga Road, Crooked Corner NSW 2583.

This report presents the results of a prediction of the potential noise levels received at nearby potentially sensitive residences due to the operation of the kennel and an assessment of the impact of these emissions in relation to recognised criteria for environmental noise.

If necessary, recommendations are made for control measures to effectively ameliorate excessive noise emissions and enable the premises to operate without adverse impact upon the existing acoustical environment of the area.

This report forms part of the submission to Council and has been carried out in accordance with the requirements of the NSW Environment Protection Authority (EPA) and other relevant criteria.

Specific acoustic terminology is used in this report. An explanation of common acoustic terms is provided in Appendix A.

2 PROJECT OVERVIEW

The site is located at 148 Bigga Road, Crooked Corner NSW. The project area and surrounding environment are shown in Figure 2-1.

Figure 2-1 Project Area and Surrounding Environment

Aerial image courtesy of © 2018 nearmap ltd

Plans for the proposed development are shown in Figure 2-2 to Figure 2-4.

Proposed development site

Unattended logger location

Sensitive receiver: 213 Bigga Rd

Sensitive receiver: 2951 Junction Point Rd




Figure 2-2 Proposed Site Plan

Figure 2-3 Proposed Kennel and Socialising Areas




Figure 2-4 Proposed Whelping and Nursery Areas

3 EXISTING NOISE ENVIRONMENT

3.1 Surrounding Environment

The surrounding environment consists principally of rural properties. The acoustical environment is generally controlled by noise emissions from vehicular movements largely associated with traffic on Bigga Road and Junction Point Road and other activities associated with the properties in the area.

The nearest potentially sensitive residential receiver locations in relation to noise emissions from the proposed development are more than 600 metres away.

3.2 Ambient Noise Survey

In order to quantify the existing ambient noise environment of the area, noise monitoring was conducted at the proposed development site. This location was selected after a detailed inspection of the project area giving consideration to other noise sources that may influence the readings, the proximity of noise-sensitive receivers, security issues for the noise monitoring device and gaining permission for access from the residents or landowners. Unattended environmental noise monitoring was conducted between 17 January 2018 and 19 January 2018.

Instrumentation for the survey comprised a Rion NL 42 Environmental Noise Logger (Serial Number 572559) fitted with microphone and windshield. Calibration of the logger was checked prior to and following measurements. Drift in calibration did not exceed ±0.5 dBA. All equipment carried appropriate and current NATA (or manufacturer) calibration certificates.

The measured data was processed according to the NSW EPA’s Noise Policy for Industry (NPfI) assessment time periods. The processed noise monitoring results (based upon noise levels recorded during the weekday daytime period) are presented in Table 3-1.




Any data which has been affected by inclement weather has been removed from the assessment data.

Table 3-1 Measured Ambient Noise Levels Corresponding to NSW INP Assessment Time Periods

Logger Location

Noise Level – dBA re 20 µPa

Daytime 7.00 am – 6.00 pm

Evening 6.00 pm – 10.00 pm

Night-time 10.00 pm –

7.00 am

RBL 1 LAeq 2 RBL LAeq RBL LAeq

148 Bigga Road 33 40 25 56 18 38

Note 1: The RBL noise level is representative of the average minimum background sound level (in the absence of the source under consideration), or simply the background level.

Note 2: The LAeq is essentially the average sound level. It is defined as the steady sound level that contains the same amount of acoustical energy as a given time-varying sound.

4 ASSESSMENT CRITERIA

Responsibility for the control of noise emissions in New South Wales is vested in Local Government and the EPA. The EPA oversees the Noise Policy for Industry (NPfI) October 2017 which provides a framework and process for deriving noise criteria. The NPfI criteria for industrial noise sources have two (2) components:

Controlling the intrusive noise impacts for residents and other sensitive receivers in the short term; and

Maintaining noise level amenity for particular land uses for residents and sensitive receivers in other land uses.

Intrusiveness Criterion

For assessing intrusiveness, the background noise generally needs to be measured. The intrusiveness criterion essentially means that the equivalent continuous noise level (LAeq) of the source should not be more than 5 dB(A) above the measured Rated Background Level (RBL), over any 15 minute period.

Amenity Criterion

The amenity criterion is based on land use and associated activities (and their sensitivity to noise emission). The cumulative effect of noise from industrial sources needs to be considered in assessing the impact. The criteria relate only to other industrial-type noise sources and do not include road, rail or community noise. The existing noise level from industry is measured.

If it approaches the criterion value, then noise levels from new industrial-type noise sources, (including air-conditioning mechanical plant) need to be designed so that the cumulative effect does not produce total noise levels that would significantly exceed the criterion.

Area Classification

The NPfI characterises the “Rural” noise environment as an area with an acoustical environment that:

is dominated by natural sounds, having little or no road traffic noise and generally characterised by low background noise levels.

Settlement patterns would be typically sparse

The area surrounding the proposed development falls under the “Rural” area classification.




Project Specific Noise Levels

Having defined the area type, the processed results of the attended noise monitoring have been used to determine project specific noise criteria. The intrusive and amenity criteria for nearby residential premises are presented in Table 4-1.

These criteria are nominated for the purpose of assessing potential noise impacts from the proposed development.

In this case, the ambient noise environment is not controlled by industrial noise sources and therefore the project amenity noise level are assigned as per Table 2.2 of the NPfI (Recommended Amenity Noise Levels). For each assessment period, the lower (i.e. the more stringent) of the amenity or intrusive criteria are adopted.

These are shown in bold text in Table 4-1.

Table 4-1 Operational Project Trigger Noise Levels

Receiver Time of Day

ANL 1 LAeq(15min)

Measured

Criteria for New Sources

RBL 2 LA90(15min)

LAeq Noise Level)

Intrusive LAeq(15min)

Amenity LAeq(15min)

Residential Day 50 33 40 38 50

Evening 45 25 56 353 45

Night 40 18 38 353 40

Note 1: ANL = “Amenity Noise Level” for residences in Rural Areas. Note 2: RBL = “Rating Background Level”. Note 3: Where background noise level is below 30 dB(A), the RBL is assumed to be 30 dB(A).

In summary, the project specific noise level for the assessment of (continuous LAeq(15minute)) operational noise emissions between 7:00 am and 6:00 pm, based upon the procedures documented within the NSW NPfL, is 45 dBA. The project specific noise level for the assessment of (continuous LAeq(15minute)) operational noise emissions between 6:00 pm and 10:00 pm, based upon the procedures documented within the NSW NPfL, is 35 dBA. The project specific noise level for the assessment of (continuous LAeq(15minute)) operational noise emissions between 10:00 pm and 7:00 am, based upon the procedures documented within the NSW NPfL, is 35 dBA.

5 NOISE ASSESSMENT

5.1 Mechanical Plant Noise Assessment

Precise type and location of all proposed mechanical plant is currently unknown. It is recommended a mechanical plant noise assessment for the proposed mechanical plant system should be carried out for the proposed development before the issuing of a Construction Certificate. The plant must achieve the noise criteria of 35 dB(A) at the nearest property boundary.




5.2 Predicted Animal Noise Impact

It is anticipated that the noise generated from the outdoor activities and indoor lodging within the proposed development will be from dogs. The following section predicts the acoustic impact of the operation of the proposed development to the identified sensitive receivers to noise. Rodney Stevens Acoustics has previously conducted on site measurements of dogs. The sound power levels of barking dogs are presented in Table 5-1.

Table 5-1 Typical Sound Power Level of Dogs

Source Lw Sound Power Level, dB(A)

1 Dog Barking 85 dB(A)

The noise prediction is based on the following operational scenario:

Maximum of 40 dogs per day in the proposed facility.

Table 5-2 Sound Power Levels of Collective Animal Noise – Lw (dBA)

Scenario Location Lw Sound Power Level, dB(A)

40 dogs during daytime and night time period

Dog Kennels 101 dB(A)

5.3 Predicted Animal Noise Impact from Holding Facility

Noise level predictions for animal noise emissions at the site have been predicted by utilising NSW EPA recognised and approved computer noise model SoundPlan 7.4 software. SoundPlan is a fully integrating software suite that specialises in computer simulations of noise situations incorporating over 50 calculation standards. The model calculates overall noise levels at receiver locations considering distance, atmospheric absorption, barriers effects of intervening ground types, source levels, source and receiver locations and topography. Predictive resultant noise impact based on the operation of the proposed development has been calculated for animal noise emissions at neighbouring receivers are presented in Table 5-3.

Table 5-3 Animal Holding Facility Noise Assessment at Nearby Sensitive Receivers

Receiver Time Period Resultant Noise Impact dB(A) INP Criteria Compliance

213 Bigga Rd

Daytime Below 30 dB(A) 38 dB(A) Yes

Evening Below 30 dB(A) 35 dB(A) Yes

Night Time Below 30 dB(A) 35 dB(A) Yes

250 Bigga Rd




2951 Junction Point Rd







Based on the predicted noise levels it is expected that operational noise from the proposed development will not exceed the criteria at the nearest residential receivers.

6 CONCLUSION

Rodney Stevens Acoustics has conducted an acoustic assessment for the dog breeding facility located at 148 Bigga Road, Crooked Corner NSW. The assessment has included the establishment of noise criteria and a comparison of predicted noise levels with regard to regulatory criteria.

Noise emissions associated with the development to the surrounding nearest residential receivers have been calculated with the noise criteria as established in accordance with the Noise Policy for Industry. It has been demonstrated that the development will not have an adverse impact on the nearest residential receivers based on the proposed operations.

Approved:-

Rodney Stevens - MAAS




Appendix A – Acoustic Terminology

A-weighted sound pressure

The human ear is not equally sensitive to sound at different frequencies. People are more sensitive to sound in the range of 1 to 4 kHz (1000 – 4000 vibrations per second) and less sensitive to lower and higher frequency sound. During noise measurement an electronic ‘A-weighting’ frequency filter is applied to the measured sound level dB(A) to account for these sensitivities. Other frequency weightings (B, C and D) are less commonly used. Sound measured without a filter is denoted as linear weighted dB(linear).

Ambient noise The total noise in a given situation, inclusive of all noise source contributions in the near and far field.

Community annoyance Includes noise annoyance due to:

character of the noise (e.g. sound pressure level, tonality, impulsiveness, low-frequency content)

character of the environment (e.g. very quiet suburban, suburban, urban, near industry)

miscellaneous circumstances (e.g. noise avoidance possibilities, cognitive noise, unpleasant associations)

human activity being interrupted (e.g. sleep, communicating, reading, working, listening to radio/TV, recreation).

Compliance The process of checking that source noise levels meet with the noise limits in a statutory context.

Cumulative noise level The total level of noise from all sources.

Extraneous noise Noise resulting from activities that are not typical to the area. Atypical activities may include construction, and traffic generated by holiday periods and by special events such as concerts or sporting events. Normal daily traffic is not considered to be extraneous.

Feasible and reasonable measures

Feasibility relates to engineering considerations and what is practical to build; reasonableness relates to the application of judgement in arriving at a decision, taking into account the following factors:

Noise mitigation benefits (amount of noise reduction provided, number of people protected).

Cost of mitigation (cost of mitigation versus benefit provided).

Community views (aesthetic impacts and community wishes).




Noise levels for affected land uses (existing and future levels, and changes in noise levels).

Impulsiveness Impulsive noise is noise with a high peak of short duration or a sequence of these peaks. Impulsive noise is also considered annoying.

Low frequency Noise containing major components in the low-frequency range (20 to 250 Hz) of the frequency spectrum.

Noise criteria The general set of non-mandatory noise levels for protecting against intrusive noise (for example, background noise plus 5 dB) and loss of amenity (e.g. noise levels for various land use).

Noise level (goal) A noise level that should be adopted for planning purposes as the highest acceptable noise level for the specific area, land use and time of day.

Noise limits Enforceable noise levels that appear in conditions on consents and licences. The noise limits are based on achievable noise levels, which the proponent has predicted can be met during the environmental assessment. Exceedance of the noise limits can result in the requirement for either the development of noise management plans or legal action.

Performance-based goals

Goals specified in terms of the outcomes/performance to be achieved, but not in terms of the means of achieving them.

Rating Background Level (RBL)

The rating background level is the overall single figure background level representing each day, evening and night time period. The rating background level is the 10th percentile min LA90 noise level measured over all day, evening and night time monitoring periods.

Receptor The noise-sensitive land use at which noise from a development can be heard.

Sleep disturbance Awakenings and disturbance of sleep stages.

Sound and decibels (dB) Sound (or noise) is caused by minute changes in atmospheric pressure that are detected by the human ear. The ratio between the quietest noise audible and that which should cause permanent hearing damage is a million times the change in sound pressure. To simplify this range the sound pressures are logarithmically converted to decibels from a reference level of 2 x 10-5 Pa.

The picture below indicates typical noise levels from common noise sources.




dB is the abbreviation for decibel – a unit of sound measurement. It is equivalent to 10 times the logarithm (to base 10) of the ratio of a given sound pressure to a reference pressure.

Sound Power Level (SWL)

The sound power level of a noise source is the sound energy emitted by the source. Notated as SWL, sound power levels are typically presented in dB(A).

Sound Pressure Level (SPL)

The level of noise, usually expressed as SPL in dB(A), as measured by a standard sound level meter with a pressure microphone. The sound pressure level in dB(A) gives a close indication of the subjective loudness of the noise.

Statistical noise levels Noise levels varying over time (e.g. community noise, traffic noise, construction noise) are described in terms of the statistical exceedance level.

A hypothetical example of A weighted noise levels over a 15 minute measurement period is indicated in the following figure:

Key descriptor

LAmax Maximum recorded noise level.

40

50

60

70

80

00:00 05:00 10:00 15:00Monitoring Period (minutes)

soun

d pr

essu

re le

vel d

B(A)

LA90

LA

LAMAX

LA1LAeq




LA1 The noise level exceeded for 1% of the 15 minute interval.

LA10 Noise level present for 10% of the 15 minute interval. Commonly referred to the average maximum noise level.

LAeq Equivalent continuous (energy average) A-weighted sound pressure level. It is defined as the steady sound level that contains the same amount of acoustic energy as the corresponding time-varying sound.

LA90 Noise level exceeded for 90% of time (background level). The average minimum background sound level (in the absence of the source under consideration).

Threshold The lowest sound pressure level that produces a detectable response (in an instrument/person).

Tonality Tonal noise contains one or more prominent tones (and characterised by a distinct frequency components) and is considered more annoying. A 2 to 5 dBA penalty is typically applied to noise sources with tonal characteristics.




Appendix B – Calibration Certificate




Appendix C – Unattended Noise Monitoring

APPENDIX 5

Animal Welfare Code of Practice

Breeding dogs and catsa n i m a l w e l f a r e b r a n c h

w w w . i n d u s t r y. n s w . G O V . a u

A n i m A l W e l fA r e Co d e o f P r AC t i C e

B r e e d i n G d o G S A n d C AtS

Title: Animal Welfare Code of Practice – Breeding Dogs and Cats

Author: Ross Burton, Director Animal Welfare, Animal Welfare Branch, Agriculture, Biosecurity and Mine Safety Division, Orange

© State of New South Wales through Department of Industry and Investment (Industry & Investment NSW).

This publication is copyright. You may download, display, print and reproduce this material provided that the wording is reproduced exactly, the source is acknowledged and the copyright, update address and disclaimer notice is retained.

For updates to this publication, check www.dpi.nsw.gov.au/animal-welfare

Published by Industry & Investment NSW

First published August 2009

ISBN 978 0 7347 1945 4

Disclaimer The information contained in this publication is a Code of Practice prescribed under the Prevention of Cruelty to Animals (General) Regulation 2006 (the Regulation). People involved in the business of breeding dogs and cats are reminded that compliance with the standards specified in this Code is a requirement under that Regulation. New versions of this Code may be issued from time to time. It is the responsibility of users to ensure the version of the Code on which they rely is current by checking the Industry & Investment NSW website, or the Regulation.

INT09/19370 Job No 9473

7 A n i m A l m A n A G e m e n t • 1 4

7.1 A n i mA l C A r e • 14

7.2 f o o d A n d WAt e r • 16

7.3 C l e A n i n G A n d d i S i n f e C t i o n • 17

7.4 t r A n S P o rt • 18

8 A n i m A l H e A lt H • 2 0

8.1 H e A lt H C H e C K S • 20

8.2 V e t e r i n A rY C A r e • 22

8.3 H UmA n e d e S t r U C t i o n • 23

9 t r A n S f e r o f o W n e r S H i P • 2 4

1 0 B r e e d i n G A n d r e A r i n G • 2 7

ta b l e o f co n t e n t s

1 PR E FACE • 1

2 i n t r o d U C t i o n • 2

3 i n t e r P r e tAt i o n A n d d e f i n i t i o n S • 2

3.1 i n t e r P r e tAt i o n S • 2

3.2 d e f i n i t i o n S • 3

4 r e S P o n S i B i l i t i e S A n d C o m P e t e n C Y o f S tA f f • 4

4.1 S tA n dA r d S • 4

4.2 G U i d e l i n e S • 5

5 Q U A l i t Y m A n A G e m e n t S Y S t e m S • 6

5.1 S tA n dA r d S • 6

5.2 G U i d e l i n e S • 7

6 A n i m A l H o U S i n G • 8

6.1 ACCo m m o dAt i o n • 8

6.2 e n V i r o n m e n t • 11

6.3 S e C U r i t Y • 13

AnimAl WelfAre Code of PrAC tiCe: BREEDINGDOGSANDCATS• 1

1 P R e fac e

This Code is designed for everyone involved in the activity of breeding dogs and cats and has been developed to protect the welfare of the animals in their care. By adhering to this Code, people involved in animal breeding demonstrate to the general community their concern for the welfare of the animals in their care.

When humans manipulate or limit an animal’s choices in relation to its physical or social environment, the welfare of that animal must be considered. Humans have a duty of care towards these animals and the greater the level of intervention or control of an animal or its environment, the greater those responsibilities become.

Animal welfare can be thought of as the way an animal’s health, safety and well-being are affected by its physical and social environment. Health and behaviour indicators provide information about how an animal is responding to a situation, thus enabling us to make informed decisions relating to the animal’s welfare.

Compliance with this Code does not remove the need to abide by the requirements of the Prevention of Cruelty to Animals Act, 1979 and any other laws and regulations, for example; the Local Government Act, 1993; or the Companion Animals Act, 1998.

This Code contains both standards and guidelines for the care of dogs or cats for breeding. The standards have legal effect in three ways:

• FailuretomeetastandardmayresultinaPenaltyInfringementNoticeoraprosecution under Clause 20 of the Prevention of Cruelty to Animals (General) Regulation 2006.

• Inmoreseriouscases,failuretomeetastandardmaysupportaprosecutionfor an offence under the Prevention of Cruelty to Animals Act, 1979.

Under the Prevention of Cruelty to Animals Act 1979 the person in charge of an animal is responsible for meeting the legal obligations regarding an animal’s welfare. The person in charge, who may be the owner of the animal or another person who has the care or control of the animal, for example the breeding manager or a member of staff, is legally responsible for the care of the animal, and therefore for meeting the standards of this Code.

ThisCodehasbeenpreparedinconsultationwithDogsNSW,WaratahNationalCatAlliance,theAustralianVeterinaryAssociation,RSPCANSW,AnimalWelfareLeagueNSW,NSWFarmers,andotherpeopleandorganisationsinvolvedintheindustry.ItisalsoendorsedbytheNSWAnimalWelfareAdvisoryCouncil.

The Code is neither a complete manual on animal husbandry, nor a static document.Itwillberevisedfromtimetotimetotakeintoaccountnewknowledgeof animal physiology and behaviour, technological advances, developments in standards of animal welfare and changing community attitudes and expectations about the humane treatment of animals.

2 • AnimAl WelfAre Code of PrAC tiCe: BreedinG doGS And CAtS

2 I n t R o D U c t I o n

2.1 This Code sets the standards for the care and management of breeding dogs and cats.

2.2 Itappliestothewelfareofdogsandcatswhichareinvolvedinthebusiness of breeding and raising puppies and kittens.

2.3 This Code comprises both enforceable provisions and guidelines. Enforceableprovisionsareidentifiedbytheword“Standards”,andarelocated within boxes.

2.4 The incidental breeding of animals by pet shops, pounds or shelters are activities for which the standards are set by other Codes recognised by the Prevention of Cruelty to Animals Regulation 2006.

3 I n t e R P R e tat I o n a n D D e f I n I t I o n s

3.1 interPretAtionS

Objectives

The intended outcome(s) for each section of this Code.

Standards

Standards describe the mandatory specific actions needed to achieve acceptable animal welfare levels. These are the minimum standards that must be met under law.

They are identified in the text by the heading “Standards” and use the word “must”. They are highlighted in boxes within the text.

Guidelines

Guidelines describe the best practice agreed at a particular time following considerationofscientificinformationandaccumulatedexperience.Italsoreflectssociety’s values and expectations regarding the care of animals. A guideline is usually a higher standard of care than minimum standards, except where the standard is best practice.

Guidelines will be particularly appropriate where it is desirable to promote or encourage better care for animals than is provided by a minimum standard. Guidelines are also appropriate where it is difficult to determine an assessable standard.

Guidelinesareidentifiedbyaheading“Guidelines”.

Notes

Notes describe practical procedures where appropriate to achieve the minimum standards and guidelines.


3.2 definitionS

InthisCode:

Animal means a dog, cat, puppy or kitten.Breeding means the business of breeding of litters of animals for sale. Cat means an animal of the species Felis catus.Cat housing includes a cattery, cage, module, colony pen or other enclosure used to contain cats within a facility; or garages, carports, sheds, commercially sold dog kennels of any material, and any room forming part of a house, flat, apartment or town house used for human habitation.Dog means an animal of the species Canis familiaris.Dog housing includes a kennel, cage, module, colony pen or other enclosure used to contain dogs within a facility; or garages, carports, sheds, commercially sold dog kennels of any material, and any room forming part of a house, flat, apartment or town house used for human habitation.Environmental enrichment means the provision of stimuli that promote appropriate physical and mental activities, resulting in healthier and more active animals. Euthanasia technician means a person who has acquired through training, qualifications and experience, competency in humanely destroying dogs and cats. Facility means any place, premises or thing used for the accommodation or shelter of animals for the purpose of breeding or rearing dogs or cats, or where puppies or kittens are housed as a result of breeding; and includes a vehicle used for the transportation of animals.Isolation facility means a secure area in which individual animals are kept separate from other animals.Microchip means an subcutaneous full duplex electronic radio transponder that complieswiththerelevantISOstandard.Owner means:• theowneroftheanimal(inthesenseofbeingtheowneroftheanimalas

personal property),• thepersonbywhomtheanimalisordinarilykept,• theregisteredowneroftheanimal.

A reference in this Code to the owner of a companion animal is a reference to each and all owners of the animal.Parvovirus means a virus which causes intestinal inflammation in infected dogs, for which symptoms include vomiting, diarrhoea, high fever, and dehydration.Person in charge of an animal means the person who has an animal/s in their possession or custody or under their care, control or supervision, and who is responsible for meeting the welfare needs of the animal/s, and may include the owner of an animal, a family member or friend of the owner, or in a facility; the manager or staff of a facility, or volunteers.


Person in charge of the facility includes the owner of the facility or the manager of the facility.

Re-home means the process of providing an animal with a new owner and a new place to live.

Sale means the transfer of ownership of an animal or animals, including causing, permitting or suffering an animal to be sold by auction, barter, exchange or other supply, and also includes the attempt to sell or offer to sell, expose, supply, possess or receive animals.

Significant infectious disease means a disease caused by a transmissible agent that is likely to cause illness or death in susceptible animals that become infected. Common examples include: canine cough; feline respiratory disease; parvovirus; feline enteritis; canine infectious hepatitis; heartworm and distemper.

Staff includes the person in charge, manager, employees and volunteers that work in the facility, whether working full or part time and whether or not working for fee or reward.

Operating procedures means procedures for the management and operation of a facility for the accommodation and shelter of animals required under this Code.

4 R e s P o n s I b I l I t I e s a n D co M P e t e n c Y o f s ta f f

Objectives

All people who care for and manage breeding dogs and cats should be competent and aware of their responsibilities. Where breeding facilities employ staff or volunteers, the person in charge of the facility should be aware of their extra responsibilities, and that all people employed to care for animals must comply with all enforceable provisions within this Code, the Prevention of Cruelty to Animals Act 1979 and any other relevant legislation.

4.1 S tA n dA r d S

4.1.1 The person in charge of the facility is responsible for the facility complying with all enforceable provisions within this Code.

4.1.2 The person in charge of the facility must be aware of their responsibilities towards dogs and cats. Each day, a person must be present to meet the requirements of this Code, and must be knowledgeable and competent to provide for:• thecareandwelfareofdogsandcats;• thefeeding,andwatering,ofdogsandcats;• theprotectionofdogsandcatsfromdistressorinjurycausedbyotheranimalsorinterferencebypeople;

• cleaningandproperhygieneinthefacility;• identifyingsignsofcommondiseasesofthespecieskept.

4.1.3 Where trainees and volunteers are employed by the facility, they must work under the supervision of trained and experienced staff.


4.2 G U i d e l i n e S

4.2.1 Where staff are employed to care for animals; they should have formal qualifications and experience in animal care and management, which should be recorded in a register of staff training. Where appropriate, staff should be re-trained on a biennial basis. Training should include:

• currentanimalbehaviourandsocialneeds;

• thereceiptandreleaseofdogsandcats;

• housingofdogsandcats;

• animalhusbandry;

• thehandlingandcontrolofdogsandcats;

• moving,transportingandcaptureofdogsandcats;

• identifyingsignsofhealthandillhealthindogsandcats,includingidentifying symptoms of stress or when prompt veterinary care is required;

• procedures for the care of sick and injured dogs and cats;

• special requirements of old or young dogs and cats;

• disease and parasite control and prevention;

• emergency management and evacuation procedures;

• the keeping of records.

Note

For information on nationally recognised animal services qualifications, see: www.ntis.gov.au

People caring for animals should be aware of the risk of transfer of infectious disease and microbial contamination which could occur when handling dogs and cats or when cleaning enclosures, and the practices that will reduce or eliminate these risks.

For information on NSW Occupational Health and Safety legislation, see: www.workcover.nsw.gov.au

For information on emergency management response planning for animal holding facilities, see: www.dpi.nsw.gov.au/agriculture/emergency/management


5 Q U a l I t Y M a n aG e M e n t s Y s t e M s

Objectives

Breeding establishments should operate in a transparent way so that standards of animal welfare are maintained.

5.1 S tA n dA r d S

5.1.1 The following information must be recorded relating to each dog or cat housed at the breeding facility:

• a description of the dog or cat which includes: name, microchip number;sex(includingwhetherdesexed);breed;colour;distinguishingfeatures;vaccinationstatus;detailsofanyspecialmedicalanddietaryrequirements;and

• thedateofbirth;andthedateofacquisition/arrival,andregistrationnumber(forpurebredanimals)ofownedandleaseddogsandcats;and

• the name, address and telephone number of owner or lessee of thedogorcat;and

• details of preventative and veterinary treatment of dogs and cats, including routine husbandry procedures such as worming orparasitecontrol;and

• for leased dogs or cats, the name and contact telephone number oftheveterinarypractitionerwhonormallyattendstheanimal;and

• the disposal of owned and leased dogs and cats including the date and details of the disposal.

5.1.2 Information which details each litter bred must be recorded and must include: the name and microchip number of both the dam andthesire;thedateofmating(s);thedateofwhelping/queening;identification details of each animal within the litter, including any abnormalities or deaths.

5.1.3 Records must be retained for no less than three years, at the facility, and all staff must be able to produce the records.

5.1.4 The facility must have a documented program in place to control insects, ectoparasites and vertebrate pests. This document must be kept at the facility and all staff must be able to produce the document and must be familiar with its content.

5.1.5 Each facility must have a documented procedure for the swift removal of animals from the facility, in the case of emergency. This document must be kept at the facility and all staff must be able to produce the document and must be familiar with its content.


5.2 G U i d e l i n e S

5.2.1 Proceduraldocumentsshouldbeperiodicallyreviewedandapprovedby the person in charge. The period from the last review and approval of procedures should not exceed 2 years.

5.2.2 Records kept should have space for notes or observations regarding individual animals made during time at the facility, including any significant alteration in the animal’s condition or behaviour since arrival.


6 a n I M a l H o U s I n GObjective

The accommodation, environment and security of animals should be of a standard which ensures their security, safety and wellbeing.

6.1 ACCo m m o dAt i o n6.1.1 Standards

6.1.1.1 Vehicles, caravans, portable crates and the crawl space under any dwelling must not be used as permanent housing for dogs and cats.

6.1.1.2 Breeding facilities must have a continuous water supply, adequate to meet the daily requirements of the dog and cats held.

6.1.1.3 Breeding facilities must be designed, constructed, serviced and maintained in a way that provides for the good health and well being of the animals, which prevents the transmission of infectious disease agents, theescapeofanimalsanddoesnotcauseinjurytoeither animals or humans.

6.1.1.4 Animals must be provided with protection from rain and wind, direct sunlight or other adverse weather conditions and must be provided with a clean and dry dedicated sleeping area.

6.1.1.5 Where a facility houses both dogs and cats, cat housing must be a sufficient distance or otherwise isolated from dog housing to minimise the stress created by the sound, sight or smell of dogs.

6.1.1.6 Dog housing and cat housing must meet the minimum pen sizes shown in Tables 1 and 2 below. These limits do not apply to dogs and cats under veterinary care for adiseaseorinjury.

6.1.1.7 Dogs and cats must not be in extended contact with wet floors.

6.1.1.8 Each cat must be provided with a suitable box in which to hide or sleep.

6.1.1.9 All sleeping areas for cats and dogs must have clean, hygienic, dry and soft bedding, appropriate to the species and breed, sufficient for the number of animals held, and sufficient to insulate them from the floor.

6.1.1.10 Each confined cat must be provided with a litter tray which is at least 1.2 times the length of the cat, and which contains a sufficient depth of material such as commercial cat litter, sawdust, shavings, sand or shredded paper.


Isolation Facilities

6.1.1.11 An isolation facility must be available either at the facility or at a veterinary hospital, and must have documented and demonstrable biosecurity measures in place.

6.1.1.12 Animals known or suspected to be suffering from a significantinfectiousdiseaseorsevereinjurymustbetaken directly to the isolation facility unless written assurances from a registered veterinary practitioner regarding the appropriateness of housing with other animals is received.

6.1.1.13 A cat isolation facility must be a sufficient distance or otherwise isolated from dog enclosures to minimise the stress created by the sound, sight or smell of dogs.

table 1: MInIMUM sIzes foR DoG enclosURes

animal/s

Puppy/ies (+/– bitch)

Min floorarea (m2)*

3.5

Min Height (cm)

180

Min width (cm)

120

1 dog, < 40 cm height at shoulder 1.5 180 90

2 dogs, < 40 cm height at shoulder 2.5 180 90

Socially compatible group of dogs, < 40 shoulder, housed in back yard or house

cm height at 1.5 per animal

– –

1 dog, 40–60 cm height at shoulder 2.4 180 90

2 dogs, 40–60 cm height at shoulder 3.6 180 90

Socially compatible 40–60 cm height at house

group of dogs, shoulder, housed in back yard or

2.4 per animal

– –

1 dog, > 60 cm height at shoulder 3.5 180 120

2 dogs, > 60 cm height at shoulder 5.2 180 120

Socially compatible group of dogs, > 60 shoulder, housed in back yard or house

cm height at 3.5 per animal

– –

* minimum floor area includes the area allocated to bedding.


table 2: MInIMUM sIzes foR cat enclosURes

animal/s Min floorarea (m2)

Min Height (cm) Min width (cm)

Kitten/s* (+/– queen) 0.8 210* 60

Single Cat 0.8 210* 60

Cats (max 2) 0.8 210* 60

Socially compatible back yard or house

group housed in 0.8 per animal, with provisions made

for vertical space

–

* the module must contain at least 2 levels incorporating raised sleeping quarters. Access to all levels must be available through the provision of ramps, poles, steps or the like.

6.1.2. Guidelines

6.1.2.1 Measures should be in place to minimise the deterioration of exercise areas to bare earth.

6.1.2.2 All facilities should have an adequate water supply and should be sewered or on a septic system, in accordance with the requirements of the local government authority, the relevant government department or other authorities; or have some other adequate and acceptable method for disposal of faeces and other liquid wastes.

6.1.2.3 Where groups of cats are housed together, consideration should be given for each cat to be able to be free from interference by other cats.

Note

The cage sizes provided in Tables 1 and 2 provide the minimum enforceable standard. Breeders of dogs and cats are strongly encouraged to ensure that the physical and mental needs of individual animals do not become constrained by their spatial environment.

Dog breeders should refer to the Companion Animals Act 1998 for the appropriate minimum sizes for dangerous or restricted dog enclosures.


6.2 e n V i r o n m e n t

6.2.1 Standards

6.2.1.1 Dog housing and cat housing must have a shaded area when exposed to sunlight.

6.2.1.2 Dogs and cats must be protected from extremes of temperature.

6.2.1.3 The duration and intensity of artificial lighting, where used, must be as close as possible to natural conditions, sufficient to allow thorough inspection and observation of animals, and which mimic the prevailing natural light cycles. Animals must be protected from excessive light which is generated from an external source.

6.2.1.4 Animal housing areas must be provided with ventilation which is sufficient to maintain the health of theanimals;whileminimisingunduedraughts,odoursand moisture condensation.

6.2.1.5 Air ventilation devices, where used, must have an air change rate which is sufficient to distribute fresh air evenlytoalloftheareasholdinganimals;andmusthave a back-up system in the case that the ventilation device becomes inoperable.

6.2.2 Guidelines

6.2.2.1 Environmental temperature should be controlled to minimise distress to dogs and cats including the provisions of heating or cooling particularly for old, young and pregnant animals if necessary.Particularattentionshouldbegiventoprotectionsfor brachycephalic breeds, especially against heat.

6.2.2.2 Dog and cat breeding facilities should be located away from sources of excessive noise or pollution that could stress or injure dogs or cats.

6.2.2.3 Measures should be in place to protect dogs and cats from loud or sudden noise.

6.2.2.4 Noisefrombarkingdogsshouldbemanagedtocomplywith noise regulations and occupational health and safety requirements and may be reduced by one or more of the following methods:

• judicioususeofsoundproofingorsuitableconstructionmaterials which reduce noise;

• carewithdogplacementtoavoidunnecessaryarousal;


• limitingexternalstimulation,e.g.bypartitioningdoghousing, judicious use of blinds or dog housing design to prevent dogs from seeing into nearby pens;

• holdingdogsincompatiblepairs;or

• takingcaretoexercisedogsawayfromthesightofkennelled animals.

6.2.2.5 Noisefromstudcatsorcallingqueensshouldbemanagedtocomply with noise regulations and occupational health and safety requirements and may be reduced by one or more of the following methods:

• providinglockablesoundproofquartersinwhichthestudis held at night in compliance with noise regulations;

• locatingthestudhouseinsideanotherbuilding,orbytaking advantage of as much shielding by existing walls and buildings as possible;

• providingthestudwithcompanioncats,amoreinteresting run, or more companionship, such as relocation to where people, other cats and other animals can be regularly seen;

• removingacallingqueenfromanoutsidepenandplacingindoors in a pen, which can also be further covered over at night;

• takingthequeenpromptlytothestud(thestudbeingeither entire or vasectomised).

Notes

Brachycephalic means short-faced.


6.3 S e C U r i t Y

6.3.1 Standards

6.3.1.1 The facility must be able to be reasonably secured to prevent access to the facility by unauthorised people.

6.3.1.2 Dog housing and cat housing must be fitted with a secure closing device that cannot be opened by the dogs and cats held.

6.3.1.3 An animal must not be able to escape except in circumstances that cannot reasonably be foreseen and guarded against.

6.3.1.4 Unauthorised people must not have access to dog and cat holding areas unless under the supervision of a staff member.

6.3.1.5 Functioning fire fighting equipment must be readily available and staff trained and practised in its use.

6.3.1.6 All potential poisons and harmful substances, whether in storage or in use, must be kept out of reach of dogs and cats.

6.3.2 Guidelines

6.3.2.1 Double barriers are recommended to assist in preventing the escape of dogs and cats.

6.3.2.2 Any security methods used should allow for ready access to dogs and cats and ready exit for staff and animals from the facility in the event of an emergency.

Notes

Some fire retardants may be toxic to dogs and cats.


7 a n I M a l M a n aG e M e n tObjectivesThe safety, wellbeing, and psychological health when of breeding dogs and cats when housed and transported is paramount. Animals should be protected from distress, injury, illness and disease, and provided with appropriate food and water.

7.1 A n i m A l C A r e7.1.1 Standards

7.1.1.1 Each animal must be individually identified.7.1.1.2 Measures must be implemented to protect dogs and

catsfromdistressorinjurycausedbyotheranimals.7.1.1.3 Dogs and cats must be protected from distress or

injurycausedbyinterferencebypeople.7.1.1.4 Dogs and cats which must be housed singly in a

quiet, warm and dry area isolated from other animals include:• animalswithdependentyoung;and• animalsabouttogivebirth;and• animalsinseason,whereitisnottheintentiontobreed;and

• sickorinjuredanimals.7.1.1.5 Dogs and cats that may be distressed by the presence of

other dogs and cats must be housed in a manner that prevents visual and minimises or reduces olfactory contact.

7.1.1.6 The coats of long haired dogs and cats must be groomed by brushing or clipping at a frequency which ensures that the dogs and cats coats are not left dirty, matted, tangled or unkempt.

7.1.1.7 Dogs must have the opportunity to exercise for at least 20 minutes daily, except under the written advice of a veterinary practitioner. This can be provided by allowing the animal access to an exercise area to run freely, or by walking them on a lead.

7.1.1.8 Exercise areas must be supervised to ensure that dogs contained within it are compatible.

7.1.1.9 Dogs must not be exercised in any way which may pose theriskofseriousinjury,forexampleattachedtoamotor vehicle, or unsupervised on a treadmill.

7.1.1.10 Dogs and cats must receive environmental enrichment, recognising the physiological status and special needs of differing ages and species, to ensure good psychological health.

7.1.1.11 Dogs and cats that are unable to feed themselves must only be kept where adequate facilities and expertise is available for artificial rearing.


7.1.2 Guidelines

7.1.2.1 All equipment, which may affect the welfare of dogs and cats should be designed and maintained to minimise the risk of illness or injury.

7.1.2.2 Dogs and cats that may be distressed by the presence of other species of animals should be housed in a manner which prevents olfactory contact.

7.1.2.3 When grooming an animal, particular attention should be given to their eyes, nose, ears, breech, claws teeth and anal glands.

7.1.2.4 Animals which are excessively nervous, aggressive, or which cannot live in harmony with other animals should not be bred.

Note

Positive efforts should be made to socialise animals to humans and other animals. Animals that have been well-socialised when young may make better pets.

The person in charge of a dog during exercise are reminded of the provisions of the Companion Animals Act 1998 which specify minimum responsibilities when a dog is in a public place.


7.2 f o o d A n d WAt e r

7.2.1 Standards

7.2.1.1 Clean water must be available at all times at a temperature, quantity and quality that meets the physiological needs of the dog and cat, and that the dog and cat will drink.

7.2.1.2 Dogs and cats must receive a balanced and complete diet which allows them to maintain good health and growth, recognising the physiological status and special needs of differing ages and species.

7.2.1.3 Puppies and kittens under four months of age must be offered a sufficient quantity of a balanced and complete diet at least three times daily, from three weeks of age.

7.2.1.4 Dogs and cats which are co-housed with other animals must be monitored during feeding to ensure that all animals are eating their own share.

7.2.1.5 Uneaten, spoiled or stale food must be removed and disposed of promptly.

7.2.1.6 Food and water containers must be removed, cleaned and replaced immediately if noticed to be contaminated by urine, faeces, vomitus and the like.

7.2.1.7 Food must be stored to prevent its deterioration or contamination.

7.2.2 Guidelines

7.2.2.1 Foodshouldbepreparedhygienicallyandservedinclean,non-spillable containers.

7.2.2.2 Foodshouldbegiventopupsandkittensunderfourmonthsof age with a maximum interval of 12 hours between feeds. (Forexample,apuppythatreceivesitsthirdfeed,andfinalfeed, for the day at 5pm should receive its first feed for the next day no later than 5am the following morning.)

7.2.2.3 Foodandwatercontainersshouldbereadilyaccessibleto dogs and cats, and be positioned to avoid spillage or contamination by urine or faeces.

7.2.2.4 Foodandwatercontainersshouldbestable,non-toxicandeasily cleaned/disinfected.

7.2.2.5 Puppiesfromfourtosixmonthsofageandkittensfromfourto eight months of age should be offered a sufficient amount of a balanced and complete diet at least twice daily.


7.2.2.6 Fordogsandweanedpuppies,onefeedingbowlshouldbeprovidedperindividualanimal.Forcats,thereshouldbeone feeding bowl per adult and one feeding bowl per three kittens.

7.3 C l e A n i n G A n d d i S i n f e C t i o n

7.3.1 Standards

7.3.1.1 Areas housing animals within a facility must be cleaned at least once daily.

7.3.1.2 Animal enclosures must be disinfected at least once weekly.

7.3.1.3 Animal enclosures must be cleaned and disinfected before new animals are introduced or before whelping or kittening.

7.3.1.4 Bedding must be cleaned or changed at least once daily and disinfected at least once a week.

7.3.1.5 Exercise areas must be cleaned daily or before new dogs are introduced to the area.

7.3.1.6 Food preparation and storage areas, food and water containers, and utensils and equipment used in the preparation and provision of food, must be maintained to a hygienic standard.

7.3.1.7 Collection drains must be cleaned daily.

7.3.1.8 Litter trays must be checked, scooped and replenished daily.

7.3.1.9 Litter trays must be changed, washed and disinfected at least once every 3 days.

7.3.1.10 Litter trays that are saturated with urine must be changed immediately.

7.3.2 Guidelines

7.3.2.1 All dead animals or waste products such as faeces, bedding, and food wastes should be disposed of promptly and hygienically, and in accordance with the requirements of the local government authority, the relevant government department or other authorities.

7.3.2.2 Specialistadviceshouldbesoughtbeforepestcontroloperations are conducted, in order to protect the health and safety of the staff and the animals kept.


Notes

Some disinfectants are toxic to some species, for example some common disinfectants containing coal and wood tar products such as pine oil, phenol, cresol and chloroxylenols, are toxic to cats. Tea tree oil is toxic to both cats and dogs. Staff should be familiar with these matters and avoid the use of inappropriate products.

Chemicals used for pest control should be registered by the Australian Pesticides and Veterinary Medicines Authority under the Agricultural and Veterinary Chemicals Code Act 1994 (Commonwealth) and only used in accordance with the manufacturers’ instructions.

7.4 t r A n S P o r t

Transport may cause distress to dogs and cats and should be kept to a minimum. All dogs and cats should be contained or suitably restrained so that they are secure and protected from injury when transported.

7.4.1 Standards

7.4.1.1 All cats and dogs must be transported in such a manner which addresses their size and age. Cats and dogs, and incompatible animals of the same species, must be physically separated during transport to preventinjury,harmordistress.

7.4.1.2 Dogs and cats must not be transported in the boot of a car.

7.4.1.3 Vehicles must have adequate ventilation and shade, sufficient to maintain good health and to avoid distress.

7.4.1.4 All vehicles used extensively for the purpose of transporting animals must be thoroughly cleaned and disinfected after use to minimise the possibility of transmission of infectious disease agents between consignments of animals.

7.4.1.5 The minimum exercise requirement of this Code applies to transported dogs.


7.4.2 Guidelines

7.4.2.1 All consignments of animals should comply with the recommendations and requirements for animal behaviour andcontainersofthecurrentIATALiveAnimalsRegulations.

7.4.2.2 Containers used for dog and cat transport should provide adequate light and ventilation.

7.4.2.3 Any vehicle especially designed or regularly used for transporting dogs and cats should:

• protectanimalsfrominjurythroughbeingfreefromprotrusions or sharp edges in the carrying area;

• havenonslipfloors;

• provideeasyaccessandsafeaccessforhandlers;

• beairconditionedtoprotectagainstextremesoftemperature even when stationary;

• protectagainstunauthorisedreleaseorescapeoftheanimals;

• beeasytocleananddisinfect;and

• befittedwithanoperationalairconditioningsystemtothesection of the vehicle where the animals are held.

7.4.2.4 Onroadtripsofmorethantwohoursduration,adequatestops should be made to allow dogs and cats the opportunity to exercise, eat, drink, urinate and defecate where appropriate; and for the enclosures to be cleaned where necessary.

Notes

The driver of a transport vehicle is the person in charge, and therefore responsible for the welfare of animals in the vehicle during transportation.

For more information about the minimum standards for animal transport, refer to the publication in this series titled “The Care and Management of Animals by Companion Animal Transport Agencies”.

For more information about the IATA Live Animal Regulations, see: www.iata.org/whatwedo/cargo/live_animals


8 a n I M a l H e a lt H

Objective

The health of animals should be monitored regularly to detect signs of disease, injury and distress with treatment provided where necessary. Where the destruction of animals is necessitated, it should be conducted in an efficacious and humane manner.

8.1 H e A lt H C H e C K S

8.1.1 Standards

8.1.1.1 All dogs and cats must be inspected at least once daily to monitor their health and well-being. The person checking the animals must note all adverse observations where an animal is not:

• eating;

• drinking(inthecaseofkittens/puppiesdrinkingmilk);

• defecating;

• urinating;

• behavingnormally;

• showinganyobvioussignsofillnessordistress;

• abletomoveaboutfreely;

• displayinganormalcoat.

8.1.1.2 Any changes in health status must be promptly reported to the person in charge of the facility for appropriate action.

8.1.1.3 Where there is evidence that whelping or kittening has commenced(egstrainingorcontracting)andthereis no progress within two hours, the bitch or queen must be examined by a veterinary practitioner and appropriate remedial action taken.


8.1.2 Guidelines

8.1.2.1 Signsofillnessorinjuryofforwhichveterinarytreatmentshould be sought include but are not limited to:

• runnynose;

• runny,dischargingorinflamedeyes;

• repeatedsneezing;

• coughing;

• vomiting;

• severediarrhoea,especiallyifbloodstained;

• lameness;

• bleedingorswellingofbodyparts(otherthanthevulvaofa female on heat);

• inabilitytostand,walk,urinateordefecate;

• lossofappetite;

• weightloss,particularlyifsevereorsudden;

• apparentpain;

• fits,staggeringorconvulsions;

• patchyhairloss.

• bloatingoftheabdomen;

• difficultyorinabilitytourinateordefecate;

• redorbrowncolouredurine;

• patchyhairloss;

• depression;

• fever;

• presenceofexternalparasites;

• anyotherseriousphysicalorbehaviouralabnormality.

8.1.2.2 Bitches or queens in the last week of pregnancy should be inspected by animal care staff at regular intervals.


8.2 V e t e r i n A rY C A r e

8.2.1 Standards

8.2.1.1 The person in charge of the facility must establish liaison with a veterinary practitioner who is able to attend to dogs and cats, and is able to advise on disease prevention measures.

8.2.1.2 The contact details for the veterinary practitioner must be posted in a location which enables staff and visitors to the facility to see them.

8.2.1.3 Appropriate veterinary treatment must be provided for sickorinjureddogsandcats.

8.2.1.4 Veterinary advice must be obtained in the event of unexplained illness or deaths.

8.2.1.5 Permission in writing must be obtained from an dog or cat’s owner or nominee if leased at the time of accepting the animal for breeding authorising the provision of necessary veterinary treatment.

8.2.1.6 Dogs must be vaccinated against distemper, hepatitis, parvovirus and canine cough in accordance with the manufacturer’s recommendations, unless with the written approval of a veterinary practitioner.

8.2.1.7 Cats must be vaccinated against feline infectious enteritis and feline respiratory disease in accordance with the manufacturer’s recommendations, unless with the written approval of a veterinary practitioner.

8.2.1.8 Kittens and puppies must be vaccinated against common infectious diseases in accordance with best practice clinical guidelines, in consultation with a veterinary practitioner.

8.2.1.9 Dogs and cats known or suspected to be suffering from an infectious disease must not be used for breeding or be accepted for breeding under lease unless under written approval from a veterinary practitioner.

8.2.1.10 A program for heartworm prevention for dogs must be in place and in accordance with veterinary advice.

8.2.1.11 Internal and external parasites must be controlled through routine and preventative treatments.


8.2.2 Guidelines

8.2.2.1 A program for maintaining a feline leukaemia free population is recommended. This should include a program of testing and vaccination of resident cats in accordance with veterinary advice, and a requirement for a current negative test prior to breeding (which applies to cats from the permanent population, new additions to the permanent population or visiting cats).

8.2.2.2 Newlyacquireddogsorcatsordogsorcatsvisitingfromanother location should not be mixed with the permanent population for a minimum of 48 hours.

Notes

Parasites include fleas, lice, ticks and gastrointestinal or heart worms.

8.3 H U m A n e d e S t r U C t i o n

8.3.1 Standards

8.3.1.1 Where treatment to restore the physical and mental health of a dog or cat while in the facility is impractical or unsuccessful and where it is recommended by a veterinary practitioner, the dog or cat must be humanely destroyed.

8.3.1.2 Euthanasia of dogs and cats must only be performed by a veterinary surgeon or a person who is a euthanasia technician.

8.3.1.3 Euthanasia must be performed by the intravenous administration of an overdose of pentobarbitone sodium unless there are compelling reasons to use other methods to destroy a dog or cat.

8.3.1.4 Euthanasia must be conducted in an area that is separated from animal accommodation at the facility and must not be carried out in view of any other animals.

8.3.2 Guidelines

8.3.2.1 All efforts should be made to home physically healthy and behaviourally sound dogs and cats.


9 t R a n s f e R o f o W n e R s H I P

Objective

The transfer of ownership of animals should be used to promote socially responsible pet ownership, and to reduce the destruction of companion animals.

9.1.1 Standards

9.1.1.1 Puppies and kittens must not be re-homed before they are 8 weeks of age.

9.1.1.2 Dogs and cats must not be re-homed to people less than 18 years of age.

9.1.1.3 No dog or puppy, cat or kitten may be sold unless vaccinated in compliance with the requirements of Section 8.2 of this Code.

9.1.1.4 All dogs and cats re-homed must be microchipped, and treated to remove gastrointestinal parasites prior to release.

9.1.1.5 Nodogorcatsuspectedofbeingsick,injuredordiseased may be sold under any circumstances.

9.1.1.6 At the time of purchase, clients must be offered accurate written information at no charge which concerns the care of animals purchased.

9.1.1.7 If within 3 days a dog or cat is not acceptable to the purchaser for any reason, the breeder is required to take the dog or cat back and refund 50% of the purchase price of the animal. This guarantee must be provided in writing to the purchaser at the point of sale.

9.1.2 Guidelines

9.1.2.1 InformationrequiredbyClause9.1.1.6shouldincludeinformation about:

• generalcarerequirementsofthespecies,includingappropriate diet and feeding regimes;

• usuallifespanofbreed/species;

• minimumrequirementsforhumaneshelterandaccommodation;

• minimumrequirementsforsecurityofthedogorcat;

• minimumrequirementsforsocialcontactwithhumansand other animals of the same species;


• minimumrequirementsfordiseaseandparasitecontrol/prevention;

• howtoidentifyandappropriatelymanagecommondiseases;

• proceduresforseekingemergencytreatmentforthedogor cat, and the value of establishing a relationship with a veterinary practitioner, and/or animal behaviourist or other experienced persons;

• theestimatedcostsassociatedwithprovidingfoodandshelter for the dog or cat;

• routineveterinarytreatmentwhichmayberequiredfor the animal(s), for example vaccination or parasite control;

• maximumtimeadogorcatcanbeleftunattended;

• theexpectedbehavioursofthespeciesorbreed,forexample digging or scratching;

• informationaboutthelegalrequirementsforpetownership, and the penalties for non-compliance;

• thedogorcat’svaccinationstatus,andtheneedforongoing vaccinations;

• thedesirabilityandadvantagesofdesexingdogsandcats;

• minimumrequirementsforexercise;

• costsassociatedwithregisteringthedogorcat;

• otherinformationwhichisreasonablethatthepurchaser must be made aware of.

9.1.2.2 Ifwithin7daysadogorcatisnotacceptabletothepurchaser due to health reasons, excluding injury, and the complaint is supported by a veterinary practitioner, the breeder and the owner should negotiate in good faith to achieve an equitable outcome.

9.1.2.3 All advertisements for dogs and cats for sale should include the microchip number, and the vaccination status of the animal.

9.1.2.4 Desexing of dogs and cats not intended for breeding is strongly encouraged.

9.1.2.5 All facilities which re-home dogs and cats should assist in promoting socially responsible pet ownership in the community.


9.1.2.6 Policies,proceduresandstafftrainingshouldbeimplemented which ensure that prospective buyers are matchedtosuitabledogsandcats.Suchmatchingshouldconsider the characteristics and lifestyle of the buyer, the type and behavioural attributes of the animal including exercise requirements, and the environment of the new home,includingyardsizeandpresenceofchildren.

9.1.2.7 Sick,aggressive,pregnant,unweaned,poorlysocialisedordeformed dogs and cats or animals with known vices such as excessive barking, fence jumping (dogs) should not be made available for rehoming.

9.1.2.8 Importantinformationabouttheindividualdogorcat,such as health care history, should be provided to the new owner of any animal sold.

9.1.2.9 Newownersshouldbeencouragedtoseekadviceaboutcare, management and training issues from veterinary practitioners or other people with appropriate expertise.

9.1.2.10 Where possible, breeders should participate in breed placement programs to assist pounds and shelters in the rehoming of surrendered dogs and cats.

9.1.2.11 Dogs or cats should not be sold to inappropriate purchasers.

Notes

The person in charge of the facility is reminded of the provisions of the Companion Animals Act 1998 concerning dangerous dogs and restricted breeds and concerning notification of change in registration information.


10 b R e e D I n G a n D R e a R I n G

Objectives

The mating, breeding, birthing and rearing processes should be managed in a way that assures good animal welfare outcomes.

10.1.1 Standards

10.1.1.1 Bitches and queens must not be intentionally mated during their first oestrous cycle.

10.1.1.2 A dog or cat must be physically and mentally fit, healthy and free of disease at the time of being mated.

10.1.1.3 During mating, breeding pairs must be isolated from the remaining breeding population, and monitored by the person in charge.

10.1.1.4 Mothers in the latter stages of pregnancy must be provided with additional access to food and water, provided at frequent intervals.

10.1.1.5 During birthing bitches and queens must be isolated from the remaining breeding population, and monitored by the person in charge on a regular basis to ensure that the birth proceeds in a normal manner.

10.1.1.6 Whelping bitches must be provided with a suitable whelping box, lined with clean bedding, changed daily.

10.1.1.7 Kittening queens must be provided with a covered kittening box, lined with clean bedding, changed daily.

10.1.1.8 Animals that are isolated from the remaining breeding population must be provided with additional attention and socialisation to animal carers.

10.1.1.9 Bitches must not have more than two litters in any two year period, unless with the written approval of a veterinary practitioner.

10.1.1.10 Queens must not have more than three litters in any two year period, unless with the written approval of a veterinary practitioner.

10.1.1.11 Lactating mothers must be provided with additional food and water.

10.1.1.12 Lactating mothers must be housed in such a manner that they are able to escape their young.

10.1.1.13 Kittens or puppies must not be separated from their litter or their lactating mother until they are seven weeks of age to facilitate socialisation, except in the best interests of the puppy or kitten, or their mother.


10.1.1.14 Solid food must be offered to puppies and kittens from three weeks of age. Puppies and kittens must be monitored when first offered solid food to ensure that the food is acceptable and palatable. If necessary, solid food may require moistening or softening to increase palatability.

10.1.1.15 Puppies and kittens must be observed to ensure that they achieve a steady weight gain every week.

10.1.2 Guidelines

10.1.2.1 Breeding practices should ensure that both breeding animals and the offspring they produce are as physically and behaviourally sound and healthy as possible. Dog and cat breeders have a responsibility to ensure that their breeding animals maintain the best quality of life possible, and litters should only be produced with a reasonable expectation of finding homes where they are both wanted and appreciated, and are offered a similarly good quality of life.

10.1.2.2 Where a heritable disease is recognised in a breed and where there is screening procedures or a test for that disease the person in charge in the case of a stud cat or dog or bitch or queen should:

• haveacurrentofficialevaluationortestresultforthedog or cat for such hereditary disease;

• providetheofficialevaluationortestresulttotheowners where the dog or cat is to be mated to an animal not owned by the breeding facility;

• providetheofficialevaluationortestresultofboththesire and the dam to the new owners of any puppy of kitten;

• endeavourtoensurethatthegeneticmake-upofboth sire and dam will not result in an increase in the frequency or severity of known inherited disorders.

10.1.2.3 Breeding dogs and cats should be selected to eliminate negative behavioural traits, for example poor mothering ability or aggressiveness.

10.1.2.4 Itisdesirabletoencouragepuppiesandkittenstourinateanddefecateawayfromthenestingarea.Itiseasierfordogsand cats to learn this behaviour at a young age, and animals with good toileting practices may make better pets.


10.1.2.5 Dogs and cats which are well socialised to human adults and children and with other animals will become well-adjusted companions. The best opportunity to socialise puppies to humans and other animals is before twelve weeksofage.Forkittens,socialisationtohumansandother animals is best achieved before seven weeks of age.

10.1.2.6 Before any dog or pup, cat or kitten is sold the prospective owner should be advised that the breeder has taken all reasonable steps to ensure that the animal is physically and behaviourally healthy.

10.1.2.7 Breeders should consider the welfare of their breeding sires and dams when deciding on the best time to re-breed or to cease breeding their animals.

10.1.2.8 When dogs or cats reach the end of their useful breeding life, or when mature potential breeding stock is found to be in some way unsuitable for breeding purposes, it is the responsibility of the owner to:

• havesuchdogsorcatsspayedorcastrated;

• settlethedogsorcatsintotheirnewcondition(exstudcats require considerable patience and care, but can become excellent candidates for pet homes);

• eitherprovideapethomeforthedesexeddogsorcatsthemselves, or to canvass for and carefully select a new pet home for the animals;

• exercisepatienceandretainresponsibilityforthedogor cat until such time as a satisfactory new home is established.

10.1.2.9 When cats are housed together for the purposes of mating, the animal care personnel should endeavour to ensure that:

• thequeenandstudarebotheatingandusingtheirlittertray;

• theanimalshaveseparatebedsandareabletogetsomerest;

• theanimalshaveactuallymated;and

• thestudhasaneasilyaccessibleshelfonwhichtojumpafter mating the queen, to enable him to escape her claws.

10.1.2.10 After delivery of a litter, the mother and young should be health checked by a veterinary practitioner, and the birthing area should be cleaned and disinfected.


10.1.2.11 Any puppy or kitten which does not achieve a regular weight gain should be referred for veterinary consultation.

10.1.2.12 The correct paper work, including mating dates, sire’s pedigree and any service agreements or litter registration forms should be supplied to the owner/lessee of the bitch or queen when she is collected after the mating, or on payment of an agreed fee.

Notes

The person in charge of the facility is reminded of the provisions of the Companion Animals Act 1998 concerning dangerous dogs and restricted breeds.

Breeding dogs and cAnim

al Welfare C

aode of Prts actice

Statement of Environmental Effects - Upper Lachlan Shire · GSC Greater Sydney Commission HIS...

Documents

Transcript of Statement of Environmental Effects - Upper Lachlan Shire · GSC Greater Sydney Commission HIS...