Pengolahan CPO

Click here to load reader

  • date post

  • Category


  • view

  • download


Embed Size (px)


Tentang pertanian, kehutanan, perkebunan

Transcript of Pengolahan CPO

STUDIPABRIKPENGOLAHCPO MENJADIPRODUKANTARA Oleh Dina Mardhatillah No. Mahasiswa 09.1056. MMP MAGISTER MANAGEMENT PERKEBUNAN INSTITUT PERTANIAN STIPER YOGYAKARTA 2010 1 I.PENDAHULUAN A.Latar Belakang Tanaman kelapa sawit (Elaeis guineensis) berasal dari Afrika, didatangkan keIndonesiaolehpemerintahHindiaBelandapadatahun1848.Perkebunan kelapasawitpertamakalidibangundiIndonesiapadatahun1911didaerah SumateraUtaradenganluas5.123Ha.Padatahun1957pemerintahIndonesia menasionalisasikan seluruh perkebunan swasta asing termasuk perkebunan kelapa sawitmenjadiperkebunanmilikpemerintah.Perkembangankelapasawitsecara nyatadimulaipadatahun1967denganluas144.308ha,hinggatahun2009luas perkebunansawitmencapai7.125.331jutaha,dengantotalproduksiCPO 16.091.500 juta ton per tahun.DiperdaganganInternasionaleksporprodukperkebunansawitIndonesia dalambentuk;CPOdanprodukturunan,yangdimaksudprodukturunandapat berupaprodukantaradanprodukhilir.Padaperiodetahun2001-2005ekspor produkantarasebesar21.552.000jutatonsedangkaneksporCPOsebesar 15.931.636jutaton.Tetapipadaperiodetahun2006-2009volumeekspor produk antara lebih rendah sebesar 24.392.000 dibandingkan volume ekspor CPO sebesar 29.285.841. Nuryanti (2008) mengatakan kenaikan pajak ekspor CPO dan produk antara dari tahun 2006 sebesar (1,5%)menjadi (6,5%), hal inimendorong produsenCPOmemproduksidanmengeksporCPObukanprodukantara,halini dikarenakankenaikanpajakeksporakanmeningkatkanbiayaproduksiyang berdampak kepada pay back periode.2 Padakenyataannyaeksporprodukantaramempunyainilaitambahyang lebihbesardibandingkaneksporCPO.Sugema(2007)mengatakannilaitambah produk CPO AS$ 458 per ton sedangkan nilai tambah produk antara AS$ 488 per ton.Goenadi(2005)mengatakanjumlahpabrikfraksinasiCPOdiIndonesia hanya berjumlah 10 pabrik, dengan kapasitas terpasang 11 juta ton per tahun, dan pabrikrefinerydiIndonesiaberjumlah46pabrik,dengankapasitasterpasang masing-masing pabrik sebesar 10 juta ton per tahun (Soeharto, 2010). Darikenyataandiatasapakahrendahnyavolumeeksporprodukantara dikarenakanpendirianpabrikpengolahanCPOmenjadiprodukantaramembutuhkanmodalyangsangatbesaruntukpembiayaaninvestasidan operasional,ataudibutuhkansumberdayamanusiayangmampumenjalankan manajemensertamenguasaiteknologipengolahanCPOmenjadiprodukantara, atauapakahbetulpajakekspormembebanieksporprodukantara.Berdasarkan permasalahaniniperludilakukanpenelitianuntukmemberikaninformasi investasikebutuhanmodalmaupunkualifikasisumberdayamanusiadalam menjalankan manajemen. Tujuan dari penelitian ini adalah untuk: 1.Mengetahuibesarnyabiayainvestasidanbiayaoperasionalpabrik pengolahan CPO menjadi produk antara 2.Mengetahuispesifikasimaupunkualifikasisumberdayamanusiayang diperlukandalammenjalankanmanajemenpabrikpengolahanCPO menjadiprodukantarapadatingkattopmanajersampaiketingkat pelaksana. 3 II.TINJAUAN PUSTAKA A.Perkembangan Perkebunan Kelapa SawitTanamankelapasawit(Elaeisguineensis)berasaldariAfrika, didatangkankeIndonesiaolehpemerintahanHindia-Belandapadatahun 1848(Pahan,2005).Saatinikelapasawitsebagaitanamanperkebunan menjadisumberpenghasildevisanon-migasterbesarbagiIndonesia. Tanaman kelapa sawit mulai dikembangkan oleh pemerintah pada tahun 1967. Berdasarkan (Tabel 1), padaperiode 1967 - 1978 sebagian besar perkebunan kelapasawitdimilikiolehperusahaanperkebunan,baikpemerintahsekitar 98,892ha(68,5%),danswastasekitar46,235ha(32%).Padaperiodetahun 1979-1989totalluasareaperkebunanbesarbaikmilikpemerintahmaupun swasta144.308ribuha,selainituterdapatperkebunanmilikrakyat seluas 220.707ha(32%).Padaperiode1990-2000arealPerkebunankelapasawit meningkathingga3.031.400jutahayangdidominasiolehperkebunanmilik swastaseluas1.940.101jutaha(64%),kemudiandisusulperkebunanmilik rakyatsebesar874.920ribuha(28%)danperkebunanmilikpemerintah 215.879 ribuha (8%). Cerahnyaprospekkomoditiminyakkelapa sawit telah tercermin dari peningkatan areal perkebunan sawit, pada tahun 2009 total luas pengembanganperkebunansawitmencapai2.411.896jutahadimana 1.729.430jutaha(72%)dikuasaiolehperkebunanrakyat,kemudiandisusul olehperkebunanswastaseluas522.383ribuha(21%),danyangterkecil adalah perkebunan milik pemerintah seluas 151.063 ribu ha (7%).4 Peningkatanluasarealtersebutdiikutidenganpeningkatanproduksi CPOsebagaiberikut:Padaperiode1967-1978produksiCPOterbesardi hasilkan oleh perkebunanmilik pemerintah sebanyak 228.71 ribu ton (97 %), sedangkan perkebunan swasta hanya 5.905 ribu ton (3%). Pada periode tahun 1979-1989produksiCPOsudahdihasilkanolehperkebunanrakyatsebesar 182,929ributon(15%),produksiCPOtertinggimasihdihasilkanoleh perkebunanmilikpemerintahsebesar745.470ributon(56%),danswasta sebanyak395,315ributon(29%).Padaperiode1990-2000produksiCPO tertinggidihasilkanolehperkebunanmilikswastasebesar2.845.395jutaton (80%)sedangkanproduksiCPOterendahdihasilkandariperkebunanmilik pemerintahsebesar 186.789 ribu ton (5,2%). Pada periode tahun2001 - 2009 produksi CPOdariperkebunanmilik rakyat3.512.123juta ton(45%)hampir menyamaivolumeproduksiperkebunanswastayaitusebesar3.542.765juta ton (46%).Perkebunan sawitIndonesia pada periode 2001-2009 didominasi oleh perkebunanrakyatsebesar(72%),tetapiproduksiCPOperkebunanrakyat hampir samajumlahnyadenganperkebunanswastayangluasperkebunannya hanyasepertigadariluasperkebunanrakyat.Kemungkinanperbedaanini disebabkanbanyaknyatanamansawitpadaperkebunanrakyatyangbelum menghasilkan (TBM).Anonim(2006)mengatakanproduksi CPOperhektar rata-rata2,15ton. PadaperkebunanmiliknegaraproduksiCPO2,77ton/ha,perkebunanmilikswastaproduksiCPO1,87ton/ha,danperkebunanmilik rakyat produksi CPO hanya 1,8 ton/ha. 5 Tabel 1: Penambahan luas lahan perkebunan sawit dan produksi CPO Periode tahun Luas areal (ha)Produksi CPO (ton) Rakyat (ha)Pemerintah (ha)Swasta (ha)Total (ha)Rakyat (ton) Pemerintah (ton)Swasta (ton) Total (ton) 1967-1978098,892 (68,5%)46,416 (32%)144,3080228,710 (97%)5,905 (3%)234,615 1979-1989220,707 (32%)189,620 (26%)302,262 (42%)712,589182,929 (15%)745,470 (56%)395,315 (29%)1,323,814 1990-2000847,920 (28%)215,879 (8%)1,940,101 (64%)3,031,111520,703 (14%)186,798 (5,2%) 2,845,395 (80%)3,552,896 2001-20091,729,430 (72%)151,063 (7%)522,383 (21%)2,411,896 3,512,123 (45%)640,140 (8,3%)3,542,765(46%)7,695,028 Sumber: Direktorat Jenderal Perkebunan, 2009. B.Proses pengolahan CPO menjadi produk antara ProsespengolahanCPOmenjadiprodukantaramerupakantahapan untukmenghasilkanproduk-produkhilirseperti;minyakgoreng,margarin, shortening,cocoabutter,dansabun.Prosesyangdimaksudadalahrefining danfraksinasi;yangakanmenghasilkanproduksepertiRBDolein,RBD stearin,crudestearin,crudeolein,danDALMSsebagaiproduksamping (Bailey,1996).Produkinidisebutsebagaiprodukantarakarenauntukdapat dikonsumsimasihmembutuhkanpengolahan.Berdasarkantahapanproses dan produk yang dihasilkan ada tiga proses pengolahan; a.Prosesyanghanyamelakukanrefining,produkyangdihasilkanadalah RBD palm oil dan produk samping berupa DALMS b.Prosesyangmelakukanrefiningdanfraksinasi,produkyangdhasilkan adalah RBD olein dan RBD stearin c.Prosesyangmelakukanfraksinasi,produkyangdihasilkanadalahcrude olein, dan crude stearin. 6 Secaradiagramatismasing-masingprosestersebutdapatdilihatpada Gambar 1 sebagai berikut: a. b. c. Gambar 1: Hasil proses pengolahan CPO berdasarkan tahapan proses(Lubis, 1992).Keterangan (a; proses refining, b; gabungan proses refining dan fraksinasi, c; proses fraksinasi CPO (100%)RefiningRBD Palm Oil(94%) DALMS (5%) Fraksinasi RBD Palm Oil(94%)RefiningCPORBD stearin (21%) RBD olein(73%) DALMS (5%) CPO FraksinasiCrude Strearin 20 % Crude Olein 80% 7 Berikutiniadalahpenjelasanprinsipmasing-masingproses pengolahan CPO berdasarkan tahapan proses menjadi produk antara.1.Refining Padaprinsipnyaprosesrefiningadalahmenghilangkankandungan selain minyak dalam CPO seperti zat warna (pigmen), gum, senyawa odor, dan asamlemakbebas. Padaproses refining ada tiga tahapanprosesyaitu Degumming,Bleaching,danSteamRefining(Yussof,2003).Masing-masing tahapan proses tersebut adalah sebagai berikut: a.Degumming Tujuandegummingadalahmenghilangkangum(getah), protein,residukarbohidrat,phospatida,danairdalamCPO.Proses degummingdilakukandengancaramemanaskanminyakpadasuhu 850Cselama15menitdilanjutkanpenambahanasamphospat0,1-0,4%(orthoposporitacid).Proteindangetahakanmengalami koogulasi;sehinggaperludilakukanprosespengendapandan pemisahan antara minyak dan koogulan (Yussof, 2003). b.Bleaching Tujuanbleachingadalahmenghilangkankotoranpenyebab pewarnaanminyak;sepertikarotenoid,maupunpigmenlain(Frasser andFrank,1981cit.Yussrof,2003).Prosesbleachingdilakukan dengancarapenambahanlempungaktifsebanyak1,0-2,0%dari jumlahminyakdalamkondisivakum20mmHg-25mmHgpada 8 suhu 950C selama 1,5 jam dan diakhiri dengan proses filtrasi (Howes, 1993 cit. Yussof, 2003), c.Steam Refining Tujuansteamrefiningadalahmenghilangkanasamlemak bebas dan senyawa penyebab bau pada minyak. Proses steam refining dilakukan dengan caramemanaskanminyak pada suhu 2400C -2700C dalamkondisivakum25mmHg(Corley,2003).Penambahanalat strippingyangakanmempermudahlepasnyasenyawavolatiledalam minyak (Yussof , 2003). 1.Fraksinasi Tujuanfraksinasiadalahmemisahkanfraksicair(olein)dari fraksipadat(stearin)(Yussof,2003).Dalamprosesnyafraksinasidi bagimenjaditigamacam;fraksinasikering,fraksinasidetergen,dan fraksinasimenggunakan sovlen(Yussof,2003). Fraksinasikeringlebih banyakditerapkandipabrik-pabrikpengolahanminyakkarenalebih efisien baik dari segi biaya maupun dari segi proses ( Wong et al., 1991 cit. Yussof, 2003).Prosesfraksinasikeringdilakukandengancaramendinginkan minyakyangtelahdifraksinasisehinggadidapatkanfraksinasiolein dengannilaicloudpointyangrendahdanmempunyai stabilitasyang baikpadasuhudingin,kemudiandilanjutkanprosesfiltrasiuntuk memisahkan fraksi cair (olein) dari fraksi padat (stearin). 9 BerdasarkandiagramalirpadaGambar1(a,b,c),makahasil pengolahanCPOberdasarkantahapanprosesdidapatkanenammacam produkyangdiperdagangkanyaitu:DALMS,RBDpalmoil,RBD olein,RBDstearin,crudeoleindancrudestearin.Persentasesecara keseluruhanproses