PECM - Issue 2 2013

76
Issue 2 2013 £3.95 PROCESS ENGINEERING CONTROL & MAINTENANCE Maintec Sustainability Live AQE Latest Imperial College Wind Tunnel Upgrade Again it’s Dynamotive with Drives from Control Techniques Introducing the latest material database development for Designers and Engineers worldwide FTIR gas analysis improves container safety Exhibition Previews

description

 

Transcript of PECM - Issue 2 2013

Page 1: PECM - Issue 2 2013

Issue 2

2013 £

3.9

5 PROCESS

ENGINEERING

CONTROL & MAINTENANCE

MaintecSustainability Live

AQE

Latest Imperial College Wind Tunnel UpgradeAgain it’s Dynamotive with Drives from Control Techniques

Introducing the latest materialdatabase development for

Designers and Engineers worldwide

FTIR gas analysis improves container safety

Exhibition Previews

PECM113.indd 1 25/02/2013 13:43:14

Page 2: PECM - Issue 2 2013

NOW GUARANTEED FOR

25 YEARSAGAINST PERFORATION

The most cost effective, safe, corrosion resistant metal jacketingfor petrochemical insulation protection.

In 1993 Shell UK Oil Products Ltd. used PETROCHEM for their new "CRACKER" at the mighty Stanlow refinery.

PETROCHEM has been a standard for Shell since 1986

Where else can you get thisguarantee?

Ring Peter Halle

r for d

etails - 07841 344782

SSAB Swedish Steel LtdNarrowboat Way, Hurst Business Park, Brierley Hill, West Midlands, DY5 1UF

Phone: 01384 74660 Fax: 01384 77575

[email protected] www.dobel.co.uk

PECM113.indd 2 23/02/2013 15:37:48

Page 3: PECM - Issue 2 2013

January-March 2013 PECM 3

Contents

PROCESS ENGINEERING CONTROL & MAINTENANCE

Printed & Interactive Magazine

www.pecm.co.uk January - March 2013

M H Media Global Ltd. Suite 1, The Lead Centre, Dane Valley Road

St Peters, Broadstairs, Kent CT10 3JJ

All web addresses are inter-active, simply click the web address of your choice to view the company website. There is also a useful tool bar where you can search for a specific product, or simply view the index on page 3 and then type in the

page number of the section that you wish to view.

Please mention Process Engineering Control & Maintenancewhen responding to items in this issue.

Every effort is made to ensure the accuracy and reliability of material published in Process Engineering, Control & Maintenance however, the publishers accept no responsibility for

the claims or opinions made by the contributers, manufacturers or advertisers. No part of the publication may be reproduced or transmitted in any form or by any means, mechanical, electronic (including printing), recording or stored in any information retrieval

system without the prior written concent of the publisher.

News & Events

Cleaning Solutions

Control & Automation

Electrical Engineering

Facilities Management

Fluid Handling

Health & Safety

Hydraulics & Pneumatics

Machining

Measurement & Monitoring

Process Technologies

Product News

Pumps & Valves

Software & Systems

Storage Handling & Distribution

Switches, Sensors & Systems

Valves & Flow Control

4

18

21

25

32

39

41

43

44

48

55

64

67

68

71

72

75

Publishing Director:Martin Holmes Tel: 01843 863613 Email:[email protected]

Sales Director:Danny Humphrys Tel: 01843 604665 Email:[email protected]

Sales Manager:Ben Pritchard Tel: 01843 601705 Email:[email protected]

Editor:Justine Sanders Tel: 01843 604300 Email:[email protected]

Assistant Editor:Joe Pidduck Tel: 01843 601185 Email:[email protected]

Circulation Manager:Chris Sims Tel: 01843 601185 Email:[email protected]

ZZZFFVXNOWGFRXN7HOHSKRQH

)D[(PDLOVDOHV#FFVXNOWGFRXN

&RQQHFWRUV &DEOHV 6SHFLDOLVWV &&6 /WG DUH SOHDVHG WRDQQRXQFHWKDWZHDUHQRZGLVWULEXWLQJWKH(;&(/1HWZRUNLQJ5DQJHRISURGXFWV7KLVUDQJHLQFOXGHV&$7(873FDEOHLQVWDQGDUGMDFNHWDQG/62+&DW(3DWFKOHDGV873DQG)73&$7 SRUW X 3DWFK 3DQHOV EHYHOOHGIDFH SODWHV X ZDOO ER[HV LQ *UH\ DQG%ODFNDQG8;)ORRU&DELQHWV

3OHDVH FRQWDFW RXU VDOHV WHDP IRU IXUWKHULQIRUPDWLRQDQGRUGHULQJ

Enq 101

7+(35(0,(5(9(17)25(1(5*<:$7(5(1(5*<)520:$67(Ţ*DLQDFFHVVWRKXQGUHGVRIH[KLELWRUVŢ+HDUIURPOHDGLQJVSHDNHUVDWWKHIUHHFRPSUHKHQVLYHVHPLQDUSURJUDPPH

Ţ1HWZRUNDQGNHHSXSWRGDWHZLOODOOWKHODWHVWSURGXFWVDQGGHYHORSPHQWV

$35,/1(&%,50,1*+$08.

3UHUHJLVWHUQRZIRU)5((IDVWWUDFNHQWU\DW6XVWDLQDELOLW\OLYHFRPVYD

HQHUJ\/LYH1(0(;

ZDWHU/LYH,:(;

7+(3(5)(&76867$,1$%/(%$/$1&(

PECM113.indd 3 25/02/2013 14:53:34

Page 4: PECM - Issue 2 2013

4 PECM January-March 2013

News & Events

Small scale success for C & MC & M is applying the precision skills it generally applies on parts such as hydraulic connectors for the mining industry to the production of miniature locomotive components for railway modellers.The company is producing perfectly proportioned wheels, axles, tyres and buffers for a scale model railway organisation.Wheels are typically 6 to 7mm in diameter and buffers 3 to 4mm in diameter. But despite their small size the parts have to be perfectly scaled replicas of the originals — and it is not just ones and twos for individual modellers, but production quantities of 5,000-0ff.

www.onehitcnc.com

Accuracy of Carbolite ovens proves invaluable to testing at the James Walker

Technology CentreCarbolite ovens are making a real difference to work being conducted at the James Walker Technology Centre in Cockermouth, UK. The centre has been equipped with twelve 120-litre capacity, 300°C, peak ovens for high-temperature product testing. James Walker provides ÀXLG VHDOLQJ SURGXFWV DQG DVVRFLDWHGknowledge-based services to a broad range of industries, from pharmaceuticals to oil and gas. Control and quality are high on their OLVWRISULRULWLHVDQGWKLVZDVUHÀHFWHGLQWKHVHOHFWLRQRI&DUEROLWHequipment.

Tel: 01433 620011 www.carbolite.com

VORTEX

SWIRL

JWF Process Solutions Ltd, ScotlandJWF Instrumentation, England

0845 274 7750 info@jw!td.com

Fuel Gas Success Story

PECM113.indd 4 23/02/2013 15:38:02

Page 5: PECM - Issue 2 2013

ZZZSPGDWDEDVHFRP

*OREDO3RZGHU0HWDOOXUJ\'DWDEDVH

,QWURGXFLQJWKHODWHVWPDWHULDOGDWDEDVHGHYHORSPHQWIRU'HVLJQHUVDQG(QJLQHHUVZRUOGZLGH

9LVLWWKHZHEVLWHIRUPRUHLQIRUPDWLRQRQ+RZLWFDQEHQHÀW\RX

+RZWRDFFHVVLW

+RZLWZRUNV

7KH*OREDO3RZGHU0HWDOOXUJ\3URSHUW\'DWDEDVH²DVSHFLDORQOLQHUHVRXUFH

7KH*OREDO3RZGHU0HWDOOXUJ\'DWDEDVH*30'ZDVFUHDWHGLQUHVSRQVHWRWKHDEVHQFHRIDUHDGLO\DFFHVVLEOHVRXUFHRIGHVLJQGDWDZKLFKZDVDFWLQJDVDVLJQLÀFDQWLPSHGLPHQWWRWKHZLGHUDSSOLFDWLRQRI30SURGXFWV7KHGDWDEDVHZDVWKHUHVXOWRIDJOREDOFROODERUDWLRQEHWZHHQWKHWKUHHPDMRUUHJLRQDOWUDGHDVVRFLDWLRQV(30$(XURSH03,)1RUWK$PHULFDDQG-30$-DSDQ6LQFHLWVODXQFKLQWKHFRQWHQWKDVEHHQVWHDGLO\LQFUHDVHGWRDWRWDORIQHDUO\OLQHVRIKLJKTXDOLW\GDWD

7KH*30'SURYLGHVSK\VLFDOPHFKDQLFDODQGIDWLJXHGDWDIRUDUDQJHRIFRPPHUFLDOO\DYDLODEOH30PDWHULDOV2ULJLQDOO\FRYHULQJWKHPHFKDQLFDODQGSK\VLFDOSURSHUWLHVRI306WHHOVDQG6WDLQOHVV6WHHOVIURPJPFFXSZDUGV3RZGHU)RUJHG6WHHOVQRQIHUURXVPDWHULDOVDQGEHDULQJDOOR\VRYHURQHWKRXVDQGQHZOLQHVRIGDWDKDYHEHHQDGGHGVLQFHWKHODXQFK7KHVHQRZDGGLWLRQDOO\FRYHUIHUURXVDQGQRQIHUURXV0,0PDWHULDOVIDWLJXHHQGXUDQFHOLPLWVDQG61FXUYHV

$ZHOOWHVWHGV\VWHPRIGDWDFROOHFWLRQDQGYDOLGDWLRQPHDQVWKDWWKHPD[LPXPDPRXQWRIWHFKQLFDOLQIRUPDWLRQFDQEHGLVSOD\HGZLWKRXWFRPSULVLQJWKHVRXUFHDQGFRQÀGHQWLDOLW\RIGRQDWLQJRUJDQLVDWLRQV&XUUHQWDUHDVWREHIXUWKHUGHYHORSHGLQFOXGHH[SDQGLQJWKHDYDLODEOH0,0GDWDREWDLQLQJDQGYHULI\LQJGDWDIURPWKH30+,3VHFWRUDQGDGGLWLRQDOGDWDIRUIDWLJXHSURSHUWLHV:LWKRYHUUHJLVWHUHGXVHUVIURPDOOSDUWVRIWKHZRUOGWKHGDWDEDVHSURYLGHVDVLJQLÀFDQWUHVRXUFHWRDYHU\ZLGHUDQJHRIGHVLJQHUVDQGHQJLQHHUVZKRPD\QRWEHIDPLOLDUZLWK30WHFKQRORJ\

7KHIUHHWRDFFHVVGDWDEDVHDOORZVGHWDLOHGVHDUFKHVRQSK\VLFDODQGPHFKDQLFDOSURSHUWLHVWREHPDGHDQGUHVXOWVGRZQORDGHGDVHLWKHUVSUHDGVKHHWVRULQWRZHOONQRZQ)($SDFNDJHVVXFKDV$EDFXVRU06&7KHDVVRFLDWHGZHEVLWHDWZZZSPGDWDEDVHFRPDOVRSURYLGHVEDFNJURXQGGDWDRQWKH30SURFHVVDQGGHVLJQLQJIRU308VHUVFDQDOVRYLHZDOLVWRIFRQWULEXWLQJ30SDUWVPDNHUVZLWKFRQWDFWGHWDLOV)RUPRUHÀUVWFODVVGDWDSOHDVHYLVLWZZZSPGDWDEDVHFRP

PECM113.indd 5 23/02/2013 15:38:03

Page 6: PECM - Issue 2 2013

6 PECM January-March 2013

News & Events

Heat dissipation without turbulenceEisele expands LIQUIDLINE to include coolant FRQQHFWLRQVIRUKLJKÀRZrates.Coolant circuits place special requirements on the connections and lines used. To meet these requirements, Eisele offers a special product line for coolants – LIQUIDLINE – with optimised connections in a full range of sizes and time-proven Eisele quality. Now this product line includes two new components for extra high ÀRZFDSDFLWLHV

Tel: +49 7151 1719-0 www.eisele.eu

The two new LIQUIDLINE coolant connections are flow-optimised for extra fast heat dissipation

Stertil Stokvis Introduces Rapidroll Clean DoorStertil Stokvis has boosted its acclaimed range of RapidRoll doors with the launch of RapidRoll Clean. This latest generation of fast-action cleanroom doors provides all the established advantages of fast opening and closing alongside additional features to meet cleanroom requirements and protect against airborne contamination.The new doors are ideal for all cleanroom applications across numerous industries and environments including medical, pharmaceutical, biotechnology, electronics, aerospace, nanotechnology, optics, food and cosmetics. They are available in standard sizes ranging from 1000mm wide x 1000mm high to 3500mm wide x 3500mm high and feature impressive opening and closing speeds of 2.0metres/sec and 1.0metre/sec respectively.

Tel: 0870 770 0471 www.stertiluk.com

PECM113.indd 6 23/02/2013 15:38:07

Page 7: PECM - Issue 2 2013

January-March 2013 PECM 7

WŝƉĞ&ůŽǁdžƉĞƌƚ^ŽĨƚǁĂƌĞϮϬϭϯͲEĞǁZĞůĞĂƐĞ

WŝƉĞ&ůŽǁ^ŽĨƚǁĂƌĞƌĞĐĞŶƚůLJĂŶŶŽƵŶĐĞĚƚŚĞŚŝŐŚůLJĂŶƚŝĐŝƉĂƚĞĚŶĞǁƌĞůĞĂƐĞŽĨWŝƉĞ&ůŽǁdžƉĞƌƚϮϬϭϯǀĞƌƐŝŽŶϲĂŵĂũŽƌƐŽĨƚǁĂƌĞƵƉŐƌĂĚĞƚŽƚŚĞŝƌƉƌĞŵŝĞƌDŝĐƌŽƐŽĨƚtŝŶĚŽǁƐĂƉƉůŝĐĂƚŝŽŶĨŽƌƉŝƉŝŶŐƐLJƐƚĞŵĚĞƐŝŐŶŚLJĚƌĂƵůŝĐŶĞƚǁŽƌŬĂŶĂůLJƐŝƐĂŶĚĨůŽǁƉƌĞƐƐƵƌĞĚƌŽƉĐĂůĐƵůĂƚŝŽŶƐ

dŚĞWŝƉĞ&ůŽǁdžƉĞƌƚĂƉƉůŝĐĂƚŝŽŶŝƐƵƐĞĚďLJĞŶŐŝŶĞĞƌƐŝŶŽǀĞƌϳϱĐŽƵŶƚƌŝĞƐǁŽƌůĚǁŝĚĞĨŽƌĚĞƐŝŐŶŝŶŐĂŶĂůLJnjŝŶŐĂŶĚŵŽĚĞůůŝŶŐĨůƵŝĚĨůŽǁƐŝŶƉŝƉĞŶĞƚǁŽƌŬƐdŚĞƐŽĨƚǁĂƌĞŵŽĚĞůƐďŽƚŚŽƉĞŶĂŶĚĐůŽƐĞĚůŽŽƉƉŝƉĞƐLJƐƚĞŵƐĐĂůĐƵůĂƚĞƐƉŝƉĞƉƌĞƐƐƵƌĞĚƌŽƉƐĨůŽǁƌĂƚĞƐǀĞůŽĐŝƚŝĞƐĨƌŝĐƚŝŽŶůŽƐƐĞƐƉƵŵƉŚĞĂĚƌĞƋƵŝƌĞŵĞŶƚƐƉƵŵƉŽƉĞƌĂƚŝŶŐƉŽŝŶƚƐĂŶĚĂůůŽǁƐƚŚĞƵƐĞƌƚŽƐĞĞĂǀŝƐƵĂůŽǀĞƌǀŝĞǁŽĨƚŚĞŽƉĞƌĂƚŝŶŐĐŽŶĚŝƚŝŽŶƐǁŝƚŚŝŶƚŚĞŝƌƐLJƐƚĞŵ

tŚĞŶĂƐŬĞĚĂďŽƵƚƚŚĞďĞŶĞĨŝƚƐŽĨƵƐŝŶŐWŝƉĞ&ůŽǁdžƉĞƌƚĂǀŝĚ'ĂƌĚŝŶĞƌŽĨWŝƉĞ&ůŽǁĐŽŵƐĂŝĚ

WĞŽƉůĞĐŚŽŽƐĞWŝƉĞ&ůŽǁdžƉĞƌƚďĞĐĂƵƐĞŝƚŝƐŝŶĐƌĞĚŝďůLJĞĂƐLJƚŽƵƐĞǁŝƚŚĂŶŝŶƚƵŝƚŝǀĞŝŶƚĞƌĨĂĐĞƚŚĂƚĂůůŽǁƐƵƐĞƌƐƚŽƐƚĂƌƚƵƐŝŶŐƚŚĞƉƌŽŐƌĂŵŝŵŵĞĚŝĂƚĞůLJ/ƚŚĂƐĂƌŽďƵƐƚĐĂůĐƵůĂƚŝŽŶĞŶŐŝŶĞƚŚĂƚĂůůŽǁƐƚŚĞŵƚŽƋƵŝĐŬůLJĚĞƐŝŐŶĂŶĂůLJƐĞƐŽůǀĞĂŶĚƚƌŽƵďůĞƐŚŽŽƚƚŚĞŝƌƉŝƉĞƐLJƐƚĞŵ/ŶĂĚĚŝƚŝŽŶǁĞƉƌŽǀŝĚĞƵŶƌŝǀĂůůĞĚƐŽĨƚǁĂƌĞƐƵƉƉŽƌƚǁŚŝĐŚŝƐǁŚLJŽƵƌĐƵƐƚŽŵĞƌƐƐĂLJƚŚŝŶŐƐůŝŬĞ'ƌĞĂƚƐŽĨƚǁĂƌĞƐƵƉĞƌůĂƚŝǀĞƐĞƌǀŝĐĞ

/ŶƚŽĚĂLJƐǁŽƌůĚƚŚĞĚĞƐŝŐŶŽĨĞŶĞƌŐLJĞĨĨŝĐŝĞŶƚƉŝƉĞƐLJƐƚĞŵƐŚĂƐďĞĐŽŵĞĂƚŽƉƉƌŝŽƌŝƚLJzĞƐƚŚŝƐŚĞůƉƐǁŝƚŚĞŶǀŝƌŽŶŵĞŶƚĂůĐŽŶƐŝĚĞƌĂƚŝŽŶƐŚŽǁĞǀĞƌŝƚĐĂŶĂůƐŽůĞĂĚƚŽŚƵŐĞƐĂǀŝŶŐƐŝŶƚĞƌŵƐŽĨĂŶŶƵĂůƌƵŶŶŝŶŐĐŽƐƚƐ

dŚĞŶĞǁWŝƉĞ&ůŽǁdžƉĞƌƚƐŽĨƚǁĂƌĞŚĂƐƐŝŐŶŝĨŝĐĂŶƚĞŶŚĂŶĐĞŵĞŶƚƐƚŚĂƚĞŶĂďůĞĞŶŐŝŶĞĞƌƐƚŽďĞƚƚĞƌŵĞĞƚƚŚĞĞŶĞƌŐLJĞĨĨŝĐŝĞŶĐLJĐŚĂůůĞŶŐĞ

ĂͿEĞǁdĂďďĞĚĞƐŝŐŶ^ŚĞĞƚƐůĞƚƵƐĞƌƐǁŽƌŬŽŶĂŶĚĐŽŵƉĂƌĞƚŚĞƌĞƐƵůƚƐĨƌŽŵŵƵůƚŝƉůĞƐLJƐƚĞŵĚĞƐŝŐŶƐƐŝŵƵůƚĂŶĞŽƵƐůLJƚŽĞŶƐƵƌĞŽƉƚŝŵĂůƉĞƌĨŽƌŵĂŶĐĞ

ďͿEĞǁWƵŵƉDŽĚĞůůŝŶŐƉƌĞĚŝĐƚƐƉĞƌĨŽƌŵĂŶĐĞĂĐƌŽƐƐĂƌĂŶŐĞŽĨƐƉĞĞĚƐĂŶĚŝŵƉĞůůĞƌƐŝnjĞƐǁŚŝĐŚĂůůŽǁƵƐĞƌƐƚŽƐĞĞƚŚĞĞĨĨĞĐƚŽĨŽƉĞƌĂƚŝŶŐƚŚĞŝƌƉƵŵƉĂƚĚŝĨĨĞƌĞŶƚƐƉĞĞĚŝŵƉĞůůĞƌĐŽŶĨŝŐƵƌĂƚŝŽŶƐĂŶĚƚŚŝƐĐĂŶůĞĂĚƚŽďĞƚƚĞƌƉƵŵƉƐĞůĞĐƚŝŽŶĂŶĚŝŵƉƌŽǀĞĚƉƵŵƉĞĨĨŝĐŝĞŶĐLJ

ĐͿEĞǁ^ĞĂƌĐŚĂďůĞWƵŵƉĂƚĂďĂƐĞ;ƵƐĞƌƐĐĂŶĚĞĨŝŶĞŵŽĚĞůĂŶĚďƵŝůĚƚŚĞŝƌŽǁŶƉƵŵƉůŝďƌĂƌŝĞƐͿ

dŚĞWŝƉĞ&ůŽǁdžƉĞƌƚƐŽĨƚǁĂƌĞĂůƐŽĐŽŵĞƐǁŝƚŚŝƚƐŽǁŶ&ůƵŝĚĂƚĂďĂƐĞWŝƉĞĂƚĂďĂƐĞĂŶĚ&ŝƚƚŝŶŐĂƚĂďĂƐĞhƐĞƌƐĐĂŶĂůƐŽĂĚĚƚŚĞŝƌŽǁŶĚĂƚĂĂůƚŚŽƵŐŚƚŚĞƉŝƉĞĚĂƚĂďĂƐĞĂůŽŶĞĐŽŶƚĂŝŶƐŝŶĨŽƌŵĂƚŝŽŶŽŶŽǀĞƌϳϱƉŝƉĞŵĂƚĞƌŝĂůƐƐĐŚĞĚƵůĞƐĂŶĚŚĂƐŽǀĞƌϭϬϬϬƌŽǁƐŽĨƐƉĞĐŝĨŝĐĚŝĂŵĞƚĞƌƐŝnjĞƐ

dŚĞƉƌŽŐƌĂŵŝƐƵƐĞĚďLJĂǁŝĚĞƌĂŶŐĞŽĨĞŶŐŝŶĞĞƌƐĂŶĚĐŽŵƉĂŶŝĞƐĨƌŽŵŝŶĚŝǀŝĚƵĂůĚĞƐŝŐŶĐŽŶƐƵůƚĂŶƚƐƚŚƌŽƵŐŚƚŽůĂƌŐĞŵƵůƚŝŶĂƚŝŽŶĂůĐŽŵƉĂŶŝĞƐŝƚŝƐƵƐĞĚĂƐĂƉŽǁĞƌĨƵůƉŝƉŝŶŐƐLJƐƚĞŵĚĞƐŝŐŶĂŶĚĂŶĂůLJƐŝƐƚŽŽůŝŶŵĂŶLJŝŶĚƵƐƚƌŝĞƐŝŶĐůƵĚŝŶŐĂĞƌŽƐƉĂĐĞĐŚĞŵŝĐĂůƉƌŽĐĞƐƐŝŶŐĞĚƵĐĂƚŝŽŶĨŽŽĚĂŶĚďĞǀĞƌĂŐĞŐĞŶĞƌĂůĞŶŐŝŶĞĞƌŝŶŐŵŝŶŝŶŐƉĞƚƌŽĐŚĞŵŝĐĂůƉŚĂƌŵĂĐĞƵƚŝĐĂůƉŽǁĞƌŐĞŶĞƌĂƚŝŽŶǁĂƚĞƌĂŶĚǁĂƐƚĞǁĂƚĞƌƉƌŽĐĞƐƐŝŶŐ

WŝƉĞ&ůŽǁdžƉĞƌƚϮϬϭϯŝƐĂǀĂŝůĂďůĞŶŽǁĨŽƌĂĨƌĞĞƚƌŝĂůĂƚ

ǁǁǁƉŝƉĞĨůŽǁĐŽŵ

dŚĞƌĞŝƐĂůƐŽĂ>ŝƚĞǀĞƌƐŝŽŶŽĨƚŚĞƉƌŽŐƌĂŵƚŚĂƚŝƐƚŚĞƐĂŵĞĂƐƚŚĞĨƵůůǀĞƌƐŝŽŶĞdžĐĞƉƚŝƚŝƐůŝŵŝƚĞĚƚŽĂŵĂdžŝŵƵŵŽĨϮϱƉŝƉĞƐƉĞƌƐLJƐƚĞŵ

WDŚĂǀĞŶĞŐŽƚŝĂƚĞĚĂϮϬйĚŝƐĐŽƵŶƚĨŽƌŽƵƌƌĞĂĚĞƌƐŽŶƐŽĨƚǁĂƌĞůŝĐĞŶƐĞƐƚŚĂƚĂƌĞƉƵƌĐŚĂƐĞĚŽŶůŝŶĞďĞĨŽƌĞϮϴƚŚ&ĞďƌƵĂƌLJϮϬϭϯƵƐĞƉƌŽŵŽƚŝŽŶĐŽĚĞWDϮϬ

PECM113.indd 7 23/02/2013 15:38:08

Page 8: PECM - Issue 2 2013

8 PECM January-March 2013

The organisers of the highly successful MCERTS conferences have announced that the format of the next event will be considerably expanded. The focus on testing and monitoring will remain, but ambient air quality will be addressed in addition to environmental emissions and workplace exposure. As a result, the WKHPHRIWKH¿UVWGD\RIWKHFRQIHUHQFHwill be ambient air quality monitoring and the theme of the second day will be industrial emissions to air. AQE 2013 (Air Quality & Emissions Show 2013) is the seventh in a series of specialist air monitoring events and will take place at the International Centre in Telford, UK, on 13th and 14th March. In common with the previous MCERTS events, AQE 2013 will also include 50 free walk-in/walk-out workshops and an exhibition featuring over 80 of the world’s leading organisations in air quality and emissions monitoring products and services.

Visitors to AQE 2013 are likely to come from a wide variety of sectors including central government, local authorities, industrial process operators, test houses, consultants, researchers, academics, instrument manufacturers, the media and anyone with a professional interest in air quality.

Event organiser Marcus Pattison believes that the expanded remit for the event is a logical progression. “The need to produce accurate, reliable emissions monitoring data is the same whatever the industrial process,” he says. “Furthermore, the technologies are invariably the same and the people responsible for emissions are often also responsible for all aspects of environmental monitoring, including workplace monitoring, ambient monitoring, leak detection, fugitive emissions, fenceline monitoring etc. So

it makes a lot of sense for all of this to be brought together under one umbrella – AQE 2013.”

The Source Testing Association (STA) established the original MCERTS event with Environmental Technology Publications in 2002 and has organised every event since. The STA’s Dave Curtis is pleased with the plans for AQE 2013. He says, “The MCERTS events were ultimately about the protection of air quality, so it makes sense for AQE 2013 to have an expanded remit to include everybody with an interest in air quality and emissions monitoring.”

Emissions monitoring will remain one of the event’s central themes, but the addition of other applications for gas and particulate monitoring will substantially increase the scope and size of the event. For example, whilst the MCERTS events addressed the needs of those affected by the Environmental Permitting Regulations (large and/or complex industrial processes), AQE 2013 will also meet the needs of Local Authorities for ambient monitoring and for the many thousands of industrial processes that Local Authorities regulate.

AQE 2013 will also hold great appeal for international visitors, because in addition to an update on EU regulations, it will also provide an opportunity to see all of the latest technologies in air quality and emissions at one specialist event.

AQE 2013 Conferences5HÀHFWLQJWKHREMHFWLYHRIWKH(XURSHDQCommissioner for the Environment, the AQE conference theme will be ‘2013 – Year of Air’ and many of the sector’s leading authorities on air quality have agreed to speak at the conference.

Day 1: Ambient Air Conference,

13th March (*recognised by IAQM for CPD)Brian Stacey, speaking on behalf of Defra, will outline EU and UK air quality policy, followed by Prof. Frank Kelly from King’s College London, who will then discuss the future of air quality monitoring. He will discuss outline advances in sensor, data storage and communication technologies which have led to an expanding range of time resolved mobile sensors for air pollution, and how these sensors present an opportunity to make a step-change improvement in the quality, accuracy and scope of reliable exposure metrics for use in population studies, thereby helping to establish a more robust and targeted link between air pollution and negative health outcomes. Prof. Roy Harrison from Birmingham University will deliver a presentation in which he will explain how to gain added value from monitoring data by understanding air pollution processes. He will illustrate VRPH RI WKH VFLHQWL¿F DGYDQFHV ZKLFKhave been derived from the analysis of routinely collected data and will cite examples including explanations of relative nitrogen dioxide and NOx FRQFHQWUDWLRQV XOWUD¿QH SDUWLFOHemissions, sulphate concentrations and PM10. Emily Jarvis from SIRA will explain the role of instrument HTXLYDOHQFH DQG 0&(576 FHUWL¿FDWLRQof continuous ambient air quality monitoring systems (CAMs) and Ruth Fain from Golder Associates will explain how Section 106 agreements (section 75 in Scotland) have successfully enabled air quality monitoring programmes to ensure that development does not have a detrimental effect on air quality. Ruth has direct experience of using the legislation and will be able to present examples of where it can be used. (*This conference has been recognised by the Institute of Air Quality Management as valuable

‘MCERTS’ event expanded to become ‘AQE 2013’

PECM113.indd 8 23/02/2013 15:38:14

Page 9: PECM - Issue 2 2013

Continuing Professional Development for its members and other air quality professionals).

Day 2: Process Emissions Conference, 14th MarchRichard Vincent, Head of Industrial Pollution Control at Defra will explain the VLJQL¿FDQFHRIWKH,QGXVWULDO(PLVVLRQVDirective with particular reference to the Directive’s prescriptions concerning best available techniques and their use in environmental permitting. Other speakers, including Rod Robinson from NPL and Carsten Roellig from TÜV will also cover European legislation, monitoring methods and standards, with particular emphasis placed on critical aspects such as uncertainty calculation, maintenance interval, correlation FRHI¿FLHQW DQGDVVHVVPHQWRI FKDQJHVWR FHUWL¿HG PRQLWRULQJ V\VWHPV 3DXOWiggins, from the Environment Agency will then discuss Operator Monitoring Assessment (OMA), which provides a systematic tool for auditing the monitoring provisions required by an operator’s permit by scoring the degree of risk. Odour is an increasing concern in many sectors and Nana Ampomah, also from the Environment Agency, will explain the role of odour management plans.

International ExhibitionThe AQE 2013 exhibition (www.AQEshow.com) will be larger than previous events, with the inclusion of regulators, accreditation organisations, instrument manufacturers and software developers, test houses, laboratories, consultants, calibration gas providers and abatement equipment providers. In combination, the exhibitors, which will come from all over Europe, North America and Japan, will provide a comprehensive view of the latest products and services in the air quality sector.

Many of the exhibitors will launch new products at AQE 2013. For example, DustScan will launch a PM10 sampler which is a low-cost, battery-powered, JUDYLPHWULF ¿OWHUUHIHUHQFH GHYLFHand Air Monitors will launch two new technologies that Managing Director Jim Mills says will change the face of air quality monitoring: “A new ambient PRQLWRULQJWHFKQRORJ\$40HVKZLOO¿OOin the gaps that cannot be addressed by larger conventional stations, providing real-time spatial coverage over a wide area.“We will also launch a new particulate monitoring technology ‘FIDAS’, which will complement the FDMS technology (which has recently passed TÜV tests

proving EU equivalence for PM10 and PM2.5). FIDAS offers additional information on particle size distribution from 0.18 – 30 microns and particle number and mass in each size range.”Air Products will launch a new range of multi-component ISO17025 gas mixtures including NO, SO2, CO and CO in Nitrogen. Turnkey Instruments will launch the fourth generation of its Site Compliance Monitor the CM3, for monitoring noise and vibration.The Horiba stand will feature the new PG-350E portable gas analyser and Kisters will launch the latest version of AquisNet DAS – software for monitoring stations.Sigma-Aldrich/Supelco will launch the new ASSET™EZ4-NCO Dry Sampler for isocyanate measurements in air. This sampler was developed in Sweden and complies with ISO 17734-1.

AQE WorkshopsOver 50 workshops will be available during the event and whilst visitors will not have to reserve places; they will have to plan their visit carefully in order to ensure that they attend the most relevant workshops and conference presentations, whilst also allocating time to visit the exhibition. The workshops are designed to provide an informal environment in which environmental practitioners are able to share information, much of which involves practical case studies.

The workshop programme will cover a broad spectrum of subjects relating to the measurement of gases, volatiles, particulates and heavy metals within industrial processes, stack emissions and the ambient environment. The workshops will address the monitoring of every important parameter and new technologies will be described for a wide variety of monitoring applications.

Many of the exhibitors that will be launching new products will utilise workshops to explain the applications for their technology.

AQE Partner: Environmental Protection UK (EPUK)EPUK aims to improve environmental quality for everyone in the UK. It seeks to bring together environmental professionals, industry, policy makers, academics and members of the public WRLQIRUPGHEDWHDQGLQÀXHQFHFKDQJHVto policy and practice in areas such as air quality, so EPUK shares many of the core objectives of AQE2013.

EPUK President Prof. John Murlis believes that, as air quality monitoring

plays such an important part in the work of EPUK members, AQE2013 will provide an ideal opportunity to meet air monitoring professionals and to take advantage of the many facilities that AQE has to offer. “It is extremely important to be able to understand the factors that affect air quality, so accurate, reliable monitoring has a vital role to perform,” he says, adding: “Regulations are often improved or developed as a result of advances in monitoring technology, so I hope that a good number of our members will be able to attend AQE 2013. It will provide them with the latest information on both regulatory and technological developments, whilst helping them to understand better what is now possible in determining the relationship between emissions and ambient air quality.”

AQE Partner: The Institute of Air Quality Management (IAQM)Roger Barrowcliffe, Chairman of the IAQM, believes that air quality is an environmental issue which concerns many members of the public and represents an outstanding problem for government at all levels. He says: “Despite consistent progress in reducing emissions from industry and road transport, we have not yet achieved universal compliance with the standards and guidelines we use to protect the health of humans and ecosystems. To make more progress we need to increase our understanding of the problems and to utilise even better techniques in our management of air quality.

“The AQE show provides a timely forum to keep air quality professionals in touch with the latest technology and to exchange ideas with their peers. The IAQM strongly supports events of this kind, which facilitate professional development and positive interaction between members of the air quality community. As an active air quality professional, I look forward to participating in the AQE Show and meeting other people with an interest in our subject.”

For visitors that pre-register at www.AQEshow.com, entry to the exhibition and workshops is free of charge, and also includes complimentary parking, food and refreshments. Entrance to the AQE 2013 conferences will cost £55 per day or £100 for both days.

For further information visit: www.aqeshow.com

PECM113.indd 9 23/02/2013 15:38:16

Page 10: PECM - Issue 2 2013

10 PECM January-March 2013

Air, Quality & Control (AQE Preview)

,W LV ¿WWLQJ WKDW $4( KDV EHHQ WKHPHG µYear of Air’ because Jim Mills, Managing Director of Air Monitors Ltd, says “We will be launching game-changing new technologies at this event which will VLJQL¿FDQWO\ LPSURYH WKHZD\ LQZKLFKDLUTXDOLW\ LVmonitored.”

Traditionally, ambient air quality has been monitored by networks of large monitoring stations that are costly to purchase and operate. In many instances these installations require planning permission, so it is not always possible to locate them in the ideal position. However, Air Monitors will launch a new battery operated technology that provides good quality reliable data in a monitor that can be easily mounted on any lamp post. Jim says “The main advantages of this technology, known as AQMesh, are that it can be positioned almost anywhere, and therefore provides cost-effective data that are complementary to existing networks; improving spatial coverage and enhancing models. This will help ensure that readings are more representative of the air that people breathe.”

Air Monitors will also launch a further technology that will substantially improve the value of ambient particulate monitoring. The FIDAS (Fine Dust Analysis System) complements existing PM monitoring technology such as the FDMS (which has recently passed TÜV tests proving EU equivalence for PM10 and PM2.5) by offering additional information on

particle size distribution from 0.18 – 30 microns and particle number in each size range. It also provides continuous real-time simultaneous mass concentration measurements of TSP, PM1, PM2.5 and PM10. The

instrument does not require consumables and does not need to be housed in an air-conditioned housing, further reducing operational costs and simplifying installation.

These new technologies and others will feature on the Air Monitors stands (26 & 33) at the entrance to AQE2013.

www.airmonitors.co.uk

Ambient monitoring will never be the same again…

PECM113.indd 10 23/02/2013 15:38:18

Page 11: PECM - Issue 2 2013

ZZZDXWRH[WUDFWFRXNLQIR#DXWRH[WUDFWFRXN

,03529(<285:25.,1*(19,5210(17%<(;75$&7,1*+$50)8/'8676$1'(0,66,2162XUIXPHDQGGXVWH[WUDFWRUVDUHGHVLJQHGWRHQVXUHKHDOWK\FOHDQHUDLULQZRUNLQJHQYLURQPHQWV

$XWR([WUDFW6\VWHPV/WG$(6/WGVSHFLDOLVHLQSURYLGLQJEHVSRNHV\VWHPVROXWLRQVWRPHHWLQGLYLGXDOVSHFLILFUHTXLUHPHQWVDQGKDYHJDLQHGH[WHQVLYHH[SHULHQFHLQWKHFROOHFWLRQUHPRYDODQGILOWUDWLRQRIDLUERUQHSDUWLFXODWHVIURPVPRNHVJDVHVIXPHVPLVWVGXVWVDQGYDSRXUV

2XUVXFFHVVRYHUWKH\HDUVKDVEHHQGRZQWRRXUDWWHQWLRQWRVDIHW\TXDOLW\DQGYDOXH

$OOHPSOR\HUVVKRXOGHQVXUHWKDWDOOV\VWHPVDUH/(9&26++WHVWHGRQDUHJXODUEDVLVDQGDVXLWDEOHUHFRUGLVNHSWDQGPDGHDYDLODEOHIRUDWOHDVW\HDUV

:LWKWRSTXDOLW\LQVWDOODWLRQVXVLQJLQKRXVHILWWLQJWHDPVDQGDIWHUVDOHVFXVWRPHUVXSSRUW$(6/WGVKRXOGEH\RXUQRFKRLFH

2XUVSHFLDOLVWDUHDVLQFOXGH 9HKLFOH([KDXVW([WUDFWLRQ ,QGXVWULDO9HQWLODWLRQDQG)LOWUDWLRQ (PHUJHQF\9HKLFOH([KDXVW([WUDFWLRQ %RG\VKRS'XVW([WUDFWLRQ :RRG'XVW([WUDFWLRQ &26++/(97HVWLQJDQG0DLQWHQDQFH

,V\RXU&26++WHVWGXHRQ\RXUFXUUHQWV\VWHPV"&DOO$(6/WGWRERRN\RXUVRQ

$(6/WG7+(),567&+2,&(,1)80($1''867(;75$&7,21

&DOO$(6/WGWRGD\WRGLVFXVV\RXUH[WUDFWLRQQHHGVRUWRDUUDQJHDIUHHVLWH

VXUYH\ZLWKIXOO\GHWDLOHGSURSRVDOVRQ

PECM113.indd 11 23/02/2013 15:38:19

Page 12: PECM - Issue 2 2013

Sustainability Live returns to the NEC, Birmingham on 16-18 April 2013. Comprising three shows - NEMEX energy Live, IWEX water Live and the brand new EfW EXPO energy from waste Live - this unique event will showcase the latest products and services from leading companies to thousands of industry visitors.

As well as the opportunity for visitors to meet hundreds of exhibitors face-to-face to discuss their individual company needs and requirements, each show will be running free to attend CPD-accredited seminar programmes, featuring expert speakers offering insight and advice into the latest industry developments across the energy, water and energy from waste sectors.

All shows are free to attend and located together so WKDWYLVLWRUVFDQ¿QGHYHU\WKLQJWKH\QHHGXQGHURQHroof.

NEMEX energy Live – the premier event for energy in all its forms

Sponsored by:

NEMEX energy Live is the event where visitors can discover New Energy Management Excellence. Responding to this ever-changing marketplace, the

2013 show will see a major focus on building energy PDQDJHPHQW V\VWHPV %(06HQHUJ\HI¿FLHQF\DQGinnovative energy management - from lighting to building fabrics and software to solar. The seminar programmes consist of over 100 speakers, with debate and discussions on a wide range of topical issues, LQFOXGLQJ (QHUJ\ (I¿FLHQF\ *UHHQ 'HDO (QHUJ\Management Standards, Behavioural Change, Smart Metering and Renewable Technologies.

IWEX water Live – bringing clarity to water resource management

IWEX water Live is the UK’s leading exhibition dedicated to water and waste water management and continues to be the key forum for the industry to tackle issues, ¿QGZD\VWRUHGXFHWKHLUZDWHUGHSHQGHQF\DQGEHWWHUmanage increasingly scarce water resources and look at effective waste water solutions.

With increasing concerns over the future of the UK water industry, IWEX is the place for organisations to discover sustainable water solutions, savings and best practice and gain high quality insight from the free seminar programme whose keynote topics include Catchment Area Management, Energy Savings, Sustainable Water Management, Smart Water Networks and Innovations in Treatment Technologies.

Sustainability Live 2013The ultimate event for the UK’s energy, water and energy from waste industries

PECM113.indd 12 23/02/2013 15:38:25

Page 13: PECM - Issue 2 2013

January-March 2013 PECM 13

EfW EXPO energy from waste Live – the new power behind energy from waste

EfW EXPO - energy from waste Live is a new UK exhibition dedicated to energy from waste suppliers and will cover the whole spectrum of advanced thermal treatment and pre-treatment processes.

Under the current EU directive requirement 15% of UK energy must be derived from renewables by 2020. Organisations will have to rethink their approach to resource-hungry processes and to improving sustainability. EfW EXPO will provide best practice and cutting edge solutions from this fast developing sector, bringing together industry professionals all looking for inspired innovation and fresh ideas.

As well as the chance to meet exhibiting companies, EFW EXPO will also feature its own seminar programme. 7RSLFVFRYHUHGZLOO LQFOXGH±/DQG¿OO*DV*HQHUDWLRQBio-fuels, Feedstock, Anaerobic Digestion & Biogas and RDF & SRF (Refuse Derived / Solid Recovered Fuels)

With so much on offer, Sustainability Live is a must-attend event for all professionals across the energy, water and energy from waste industries looking to network with like-minded individuals and source the latest product and services information to keep their organisation at the leading edge of innovation.

For up-to-date exhibitor news, seminar programmes and details on how to exhibit or free registration as a visitor, visit www.sustainabilitylive.com

PECM113.indd 13 23/02/2013 15:38:26

Page 14: PECM - Issue 2 2013

14 PECM January-March 2013

News & Events

Tinytags are accurate, battery operated devices designed to monitor temperature, humidity, power usage, CO2, and other environmental parameters across a range of applications. Data from the loggers is downloaded to a PC via a USB connection and viewed with easy to use Tinytag Explorer software. Manufactured in the UK, Tinytags help ensure that environmental conditions can be measured, recorded, analysed and validated.

7LQ\WDJV DUH XVHG LQ HQHUJ\ HI¿FLHQF\ DSSOLFDWLRQV SURYLGLQJdata to help ensure that heating, ventilation and air-conditioning systems are working correctly. In addition, the Tinytag Energy Logger monitors single and three phase power usage, identifying when equipment is being used, times of peak load, and how much energy is being used.

Robust and waterproof Tinytags are available for use in harsh, industrial and outdoor applications. External sensors in the form of probes offer easy access to awkward areas a logger cannot reach, such as pipework; or can be used for monitoring extremes of temperature such as those in manufacturing processes and cryogenic areas.

T: +44 (0)1243 813000 [email protected]

Tinytag Data Loggers: cost-effective and accurate

environmental monitoringNEMEX Stand K51

Hansford Sensors will be showcasing its latest vibration monitoring products at Maintec 2013. Among the new products on show will EHIRUWKH¿UVWWLPHLQWKH8.WKHQHZHS-109 Triaxial accelerometer, which allows three axes to be monitored si-multaneously, plus a new version of the company’s spot facing tool, which has been re-engineered to extend its operating life even further.

Triaxial accelerometers among latest vibration products from Hansford Sensors

at Maintec Stand number D5

Tel: 0845 680 1957 www.hansfordsensors.com

Composite Manufacturer Chooses a Babcock Wanson Thermal Fluid Heating and Cooling

SystemAIM Composites has installed a Babcock Wanson Thermal Fluid System into its facility in Waterbeach, Cambridgeshire to heat and control the cooling of its new press producing lightweight panels and mouldings for the transport sector.AIM uses the latest advanced composite materials for optimum weight saving and structural performance. Its products are used across the transport market, with the main focus in the aviation sector. In order to produce larger components with repeatable high quality for this market, AIM Composites made the decision to install a new, larger press.

tel: 020 89537111 www.babcock-wanson.co.uk

Ucrete floor for Tomlinson’s new dairyTomlinson’s Dairies has recently opened a brand new production facility in Wrexham capable of processing 150 million litres of milk per year.:DUULQJWRQEDVHGK\JLHQLFÀRRULQJFRQWUDFWRU.HPWLOH/LPLWHGODLGWKH\HOORZ 8FUHWH DQWLVOLS UHVLQ ÀRRULQJ WR WKH ZKROH DUHD ZLWK IDOOV WRWiedemann stainless steel drains and channels. Philip and John Tomlinson used Kemtile because they have the NQRZOHGJH DQG H[SHULHQFH LQ GDLU\ ÀRRU FRQVWUXFWLRQ ZHUH YHU\competitive, plus he had visited a number of companies that had used Kemtile and they all gave a glowing reference. .HPWLOHDUHWKH8.¶VOHDGLQJFRQWUDFWRUIRUK\JLHQLFÀRRUVLQERWKUHVLQconcrete and tiles for the food, beverage and pharmaceutical industries.

www.kemtile.co.uk

New managing director for ACWA Services ACWA Services is delighted to announce that Gary Jackson, the Director and General Manager of ACWA Emirates, has been appointed as their new Managing Director succeeding Peter Ripley who has retired after more than 25 years.Mr Jackson who has been with the Company for some twenty years will remain based in Dubai and Peter Brewer, the current President of ACWA’s highly successful American operation, ‘ACWA Clear’ will take on the role of General Manager for the UK. David Clegg, ACWA’s current Executive Financial Director will deputise for Mr Brewer when he is in the USA.

www.acwa.co.uk

$ ODUJH 8. 3HWURFKHPLFDO ¿UP UHFHQWO\encountered problems with one of their Fuel Gas installations. The technology in use was a Vortex Flowmeter and the engineer had concerns that it was over-reading by 20-30%, according to on-site Calculations. The Flowmeter had been calibrated which made no difference to the errors in measurement.

They approached JWF who found that the Fuel Gas Line had an in-line Densitometer approximately 7-10D Upstream from the “problematic” Vortex.

JWF advised that the problem could be linked to the in-line Densitometer which would cause a GLVWXUEDQFHLQÀRZSUR¿OH'XHWRWKHWHFKQLTXHthe Vortex uses, this would have an effect on measurement accuracy. JWF recommended installation of the ABB Swirlmeter - unaffected by GLVWXUEDQFHVLQÀRZSUR¿OH

Following installation, the site advised that the results produced are accurate and equate to calculated values saving the site large amounts of money.

)RUIXUWKHUGHWDLOHPDLOLQIR#MZÀWGFRP

Fuel Gas Success Story

PECM113.indd 14 25/02/2013 10:39:29

Page 15: PECM - Issue 2 2013

:RUOGZLGH (YHQWV

Senior Partners: Management

Dr Duncan Clarke: [email protected] van Gessel: [email protected]

Sponsor / Exhibition

Amanda Wellbeloved: [email protected] Greyvenstein: [email protected]

Pre-Registration:

[email protected]@glopac-partners.com

Global Pacific & Partners

25th - 29th November 2013Cape TownConvention Centre Cape Town, South Africa

15th Scramble For Africa: Strategy Briefing - 25th November 2013

10th Africa Independents Forum - 26th November 2013

20th Africa Upstream Conference - 27th November - 29th November 2013

54th PetroAfricanus Dinner In Africa - 25th November 2013

2nd - 4th October 2013Goodwood Park Hotel Singapore

22nd Asia Petroleum: Strategy Briefing - 2nd October 2013

18th Asia Upstream Conference - 3rd - 4th October 2013

18th - 20th June 2013 InterContinental Nairobi, Kenya

4th Eastern Africa: Strategy Briefing - 18th June 2013 4th Eastern Africa Oil, Gas & Energy Conference - 19th - 20th June 2013 51st PetroAfricanus Dinner - 19th June 2013

3rd - 5th June 2013L’Hotel du Collectionneur Arc de TriompheParis, France

WK

10th Maghreb-MidEast Strategy Briefing - 3rd June 2013 10th Maghreb, Mediterranean - MidEast Upstream Conference 4th - 5th June 2013 50th PetroArabian-PetroAfricanus Dinner - 4th June

22nd - 24th April 2013 Hilton Windhoek Windhoek, Namibia

9th Western Africa: Strategy Briefing - 22nd April 2013 19th Western Africa Oil, Gas & Energy Conference - 23rd - 24th April 2013 49th PetroAfricanus Dinner - 23rd April 2013

15th -17th May 2013 Sofitel Hotel Copacabana Rio de Janeiro, Brazil

9th Latin Petroleum: Strategy Briefing - 15th May 2013 19th Latin Upstream Conference - 16th - 17th May 2013

48th PetroAfricanus – World Upstream Networking Reception

19th March 2013, The Geological Society, London, United Kingdom

53rd PetroAfricanus – World Upstream Networking Reception

September 2013, London, United Kingdom

52nd PetroAfricanus – World Upstream Networking Reception

June/July 2013, London, United Kingdom

:RUOGZLGH (YHQWV

ZZZSHWURFRP

PECM113.indd 15 23/02/2013 15:38:31

Page 16: PECM - Issue 2 2013

More to see than ever before at MAINTEC 2013easyFairs MAINTEC 2013, which returns to the NEC in Birmingham on 5-7 March 2013, looks set to be bigger than ever.

Indeed there is so much going on that the Institution of Diagnostic Engineers (IDE) has decided to host a spring gathering during MAINTEC. This will also be attended by members of the Institution of Local Exhaust & Ventilation Engineers, another show supporter. IDE Chief Executive, Bill Parker, says: “We’d urge all our members to put the dates in their diary.”

MAINTEC Business Strategy ConferenceThis new show innovation will provide an opportunity to hear from leading experts and practitioners exploring and debating the maintenance issues of the day. Major names such as Wayne Curry, Engineering Team Leader, Britvic, Ian Rigby, Engineering Manager, Pepsico, John Davenport, Operations Director, Alcon, Paul Dennis, Technical Facilities Manager, Experian and Dr Sethuraman Muthuraman, Condition Monitoring Engineer, Scottish & Southern Energy will draw on their experiences, new research and case studies as they explore the industry’s hottest topics.

Innovating ExhibitorsOn the exhibitor front, MAINTEC 2013 will see show

UHJXODUV VXFK DV 6FKDHIÀHU 8. )ORZFUHWH 8.R.Stahl, ERIKS, Idhammar Systems, SPM Instruments, PRUFTECHNIK and Prevost UK joined by an array of new exhibitors such as James Walker, Decksafe Solutions, AW Chesterton, Metool, SAACKE Combustion, Intertek, Keytracker and Lubricus Grutzner and Ernst Schad.

First time exhibitor, SAACKE Combustion, will outline how it has helped Harveys Brewery improve the operation of its boiler plant. SAACKE recommended ¿WWLQJDEXUQHUZLWKDVXSHULRUWXUQGRZQDOORZLQJWKHboiler to match the site’s steam demand – massively LPSURYLQJHI¿FLHQF\

Xetec will show its FlexMaint computerised maintenance management software. It is both network and web based, and with a facility to edit every menu, button and screen, not only from customer to customer, but also from user to user within a company.

Dust extraction specialists, Dustcontrol UK, will showcase their latest centralised dust vacuum system - the DC 11 Module. The company can install one of these systems in a plant within just a few days. Plus, by reducing noise to 65 dB(A), the DC 11 Module is HDVLHUWR¿WLQDEXLOGLQJZKHUHQRLVHLVDFKDOOHQJH

SAACKE Combustion has worked with Harveys Brewery

PECM113.indd 16 23/02/2013 15:38:31

Page 17: PECM - Issue 2 2013

January-March 2013 PECM 17

Fluke, is showcasing its new Fluke® CNX Wireless 6\VWHP WKH ¿UVW VHW RI WHVW WRROV WKDW ZLUHOHVVO\connects multiple measurement modules and sends simultaneous readings to a master device up to 20 metres away, allowing users to troubleshoot problems TXLFNO\DQGHI¿FLHQWO\

Ocip Energy will outline how a recent project to install QHZ/('¿WWLQJVDW)OHWFKHU0RRUODQG¶VVLWHLVRQWDUJHWto save the company 70% of its lighting costs.

Included on the Michell Instruments stand will be its smallest and fastest portable dew-point hygrometer, the MDM300. At just 21cm by 17cm, weighing 1.5kg, and with a battery life of up to 48 hours typical usage, it HQDEOHVWKHXVHUWRWDNH¿HOGPRLVWXUHPHDVXUHPHQWVwith the minimum of fuss.

7KHUH ZLOO EH D XQLTXH GHPRQVWUDWLRQ RI 6FKDHIÀHUFAG WiPro s condition monitoring system for wind turbines. Via a ‘live’ remote link to a wind farm based in Scotland, visitors will be able to see in real time how the main rotor bearings, gearbox and generators on ¿YHZLQGWXUELQHVDUHEHLQJPRQLWRUHG

HAZEX The HAZEX area at MAINTEC brings the UK’s top hazard prevention experts under one roof to address the growing health and safety responsibilities of engineering professionals. Here for instance Newson Gale which will debut its Bond-Rite® static earthing clamps. These provide hazardous area operators with the capability to continuously monitor the condition

of their static earth loop connections on equipment at risk of electrostatic spark discharges. R.STAHL will be introducing IS1+ a key innovation for the company’s already leading explosion-protected remote I/O system IS1.

How far is too far?DENIOS will be running a live and explosive free lecture at the show. Running for all three days this experimental lecture uses graphic demonstrations to H[SORUH WKH OLPLWDWLRQVRIÀDPPDEOHPDWHULDOV LQ WKHworkplace.

Awards & The Maintenance ExchangeAdding even more drama to the proceedings, the winners of the MAINTEC 2013 Maintenance Professional $ZDUGVZLOO EH DQQRXQFHGRQ WKH VKRZÀRRU 7KHUHare two categories: ‘Maintenance Professional of the Year’ and, in support of newer entrants to the industry, ‘Maintenance Apprentice of the Year.’

There will also be 38 ‘free to attend’ learnShops. These will explore an array of practical topics for instance, John Roberts, Managing Director at Idhammar Systems, will give an insight into the OEE concept and how it is linked to return on investment while Mike O’Brien, of Newson Gale will de-mystify the hazards associated with static electricity.

MAINTEC is free to attend and visitor registration for MAINTEC 2013 is now open. To register visit www.easyfairs.com/maintecuk.

Bond-Rite Fluke CNX 3000 Wireless System

Flu-Ace

PECM113.indd 17 23/02/2013 15:38:38

Page 18: PECM - Issue 2 2013

18 PECM January-March 2013

Two seepex customers have recently improved the performance of their centrifuge feed pumps by using

Smart Conveying Technology (SCT). This unique design of progressive cavity pump provides engineers with access to the rotor and stator for inspection and, if necessary, replacement without the need to dismantle pipelines. The stator is split axially into two halves, with 4 retaining segments holding them in a FRPSUHVVLRQ ¿W 7KRVH VHJPHQWV DOVRact as re-tensioning devices that, when tightened down, can help regain optimal ÀRZUDWHV

A sewage treatment plant in Ireland converted their existing progressive cavity pumps to SCT with the aim of reducing the maintenance time compared to a conventional technology. Ragging was an issue on this site and the ability to clear blockages by removing the top half of the stator in situ was one of the deciding factors in the choice of SCT. Once in operation, however, the engineers noticed that the historical ragging issues experienced before pump conversion KDGEHHQUHGXFHGVLJQL¿FDQWO\5HFRUGLQJVRIÀRZUDWHVsuggested that these pumps, running at about 20m3/hr, were better at passing rags than a conventional design PC pump. Since conversion to SCT there have been fewer ragging problems and those that do occur can be cleared without dismantling any pipework. The customer is so happy with the reduction in downtime that they are looking to convert all suitable pumps to SCT design.

In the North of England SCT pumps had been supplied as centrifuge feed pumps and performed with no maintenance interventions for the past two years. When the engineers reported a drop in performance (which would normally mean a new stator is needed) seepex established that the pump had not been adjusted by the site since installation. A seepex visit DQG¿YHPLQXWHDGMXVWPHQWRIWKHVWDWRUUHVWRUHGWKHÀRZ WR WKH RULJLQDO VSHFL¿FDWLRQ JLYLQJ DQ LQVWDQW

increase of 25%. This adjustment can be made again the next time that performance decreases and can be used to predict when eventual stator replacement is necessary.

Smart Conveying Technology was developed to speed up rotor and stator maintenance times and improve the ability to remove blockages and contaminants. For seepex customers it is driving down pump whole life costs as re-tensioning the adjustable segments UHVWRUHVSXPSSHUIRUPDQFHWRWKHRULJLQDOVSHFL¿FDWLRQwithout the need for stator replacement.

seepex Smart Conveying Technology extends pump life and reduces whole life costs.

p5OCTV%QPXG[KPI6GEJPQNQI[pRTQXKFGUVJGHCUVGUVRQUUKDNG

OCKPVGPCPEGVKOGUHQT[QWTRWOR#UUGODNKPICPFFKUOCPV

NKPIUGGRGZRWORUJCUPGXGTDGGPGCUKGTCPFVJGNKHGE[ENG

EQUVUQHQWTRWORKPIUQNWVKQPUJCXGPGXGTDGGPNQYGT

,QKPVJGUOCTVTGXQNWVKQPCPFVGUVQWTKPPQXCVKQP

p5OCTV%QPXG[KPI6GEJPQNQI[q

5RGGF7R

5OCTV%QPXG[KPI6GEJPQNQI[

UGGRGZ7-.VF

6GN

UCNGU"UGGRGZEQWM

YYYUGGRGZEQO

PECM113.indd 18 23/02/2013 15:38:39

Page 19: PECM - Issue 2 2013

January-March 2013 PECM 19

Hilsonic is an leading interna-tional supplier of ultrasonic cleaning equipment for a vari-ety of uses throughout indus-

try.

The company’s systems are suitable for a variety of purposes within these areas, including the cleaning valves, pipework, plastic crates and compo-nents, indeed whatever you have may well lend itself to ultrasonic clean-ing, potentially saving your company time and money indeed many com-SDQLHVJHWD¿QDQFLDOSD\EDFNZLWKLQZHHNV RQ FOHDQLQJ H[SHQVLYH ¿OWHUVmore often the pay back is a matter of months.

Hilsonic systems can also be used to clean engine parts such as pistons, cylinder heads and engine blocks.

Hilsonic’s industrial ultrasonic cleaning tanks deliver the best cleaning results, with no compromise on quality or reli-ability. They are available in up to 50 distinct variations as standard with an endless number of custom built varia-WLRQVEXLOWWRIXO¿OLQGXVWULHVGHPDQGing requirements. The company of-fers full support including accessories, chemicals, service contracts and full training packages.

Its range of popular sizes comprises:-,67±ZLWKEDWKGLPHQVLRQVRI500×500×300mm, this is the most compact tank in the range, an ideal portable system for cleaning small en-JLQHSDUWVDQG¿OWHUV

,67±ZLWKEDWKGLPHQVLRQVRI1×1×1m, this mid-range system is ideal for general workshop use.

,67±ZLWKEDWKGLPHQVLRQVRI2×1×1.5m, this system is designed for larger components such as heat

exchangers, intercoolers and major engine components.

,67±ZLWKEDWKGLPHQVLRQVRI3×2×2m, the largest standard system in the range, the IST5000 is built to accommodate the biggest coolers and

heat exchangers.

All systems have Hilsonic’s unique generator technology, which features a predetermined frequency sweep and twin-tandem transducers capable of driving up to 2m in height, and full cavitation, crucial for cleaning larger components. Hilsonic systems are manufactured using the highest qual-ity materials, with 316L stainless steel tanks as standard, and heavy-duty stainless-steel frameworks for maxi-mum weight distribution and perfor-mance.

Also standard through the range is the under liquid jetting system, which improves the cleaning performance and maintains chemical integrity for longer. With other unique design fea-tures, this makes the IST range of systems a durable solution to heavy-duty cleaning applications, providing many years of cleaning performance, backed by a two-year warranty.

Custom-built ultrasonic cleaning tanksHilsonic also manufac-tures custombuilt ultra-sonic cleaning tanks of all shapes and sizes. From 1L to 15,000L capacities, and with a huge range of frequencies, densities and power ratings, these cus-tomised models will always deliver the best cleaning results, with no compro-mise on quality or reliabil-ity. For more complex in-dustrial cleaning processes, Hilsonic will consult fully with the customer to de-velop the right system.

Bench-top ultrasonic cleaning tanksFor small-scale workshop cleaning problems, Hilson-ic’s bench-top ultrasonic cleaning tanks are the ideal solution. Its Performance bench-top models are con-structed in 316L stainless steel and are designed for longlasting durability, while the Budget bench-top ultra-sonic cleaning tanks offer good cleaning performance at a reasonable price, with-out cutting corners in terms of ultrasonic power.Whether a standard or be-spoke system is required, Hilsonic works closely with the customer at all stages in order to develop a sys-tem to suit their purpose.

Ultrasonic cleaning for best resultsUltrasound is used widely throughout industry for removing problem contamination from all kinds of hard surfaces. Its unique properties can be harnessed to clean items of all shapes, sizes and technical complexity, penetrating holes and cavities that are impossible to reach using ordinary cleaning methods.

Manufactured in the UK

Hilsonic ultrasonic cleaning tanks are built to customer specifi cations

Hilsonic is a specialist in the supply of ultrasonic cleaning equipment for the power-generation and marine industries

Tel: 0151 6396020www.hilsonic.co.uk

PECM113.indd 19 23/02/2013 15:38:42

Page 20: PECM - Issue 2 2013

At the Department of Aeronautics, Imperial College London, when the 3ft x 3ft wind tunnel needed an upgrade, once again the College turned to wind tunnel specialists Dynamotive for the task. Dynamotive chose a drive from Control Techniques for the crucial job of controlling fan/wind speed.

The project came about because of the failure of the DC motor and controller on the 3ft x 3ft low speed wind tunnel, which had a maximum wind speed of 150 ft/sec, during a time limited testing project being carried out by a PhD student. Because they had successfully worked with the Department of Aeronautics before, notably on WKH KLJK SUR¿OH +RQGD :LQG 7XQQHO '\QDPRWLYH ZDVasked to provide a fast turnaround AC solution - AC being preferred because of its reduced maintenance.

A complete scheme comprising PLC controller, HMI, AC motor and a Control Techniques AC variable speed drive was installed within weeks, enabling the PhD student to collect all of his test data with time to spare.

The wind tunnel is used for a wide range of tests from models of drones, or designs for reducing fractal turbulence (on an aircraft wing or a wind turbine blade for example) to attenuating noise produced by machinery. Recently, testing has produced designs to reduce the drag on heavy vehicles, with a view to fuel saving.

The drive chosen was a 37 kW Unidrive SP model, ¿WWHG ZLWK DQ 60 (WKHUQHW SOXJLQ PRGXOH WR HQDEOHcommunications with the Proface touch screen colour HMI that Dynamotive supplied and programmed.

The 37 kW motor was a special order through Emerson &RQWURO 7HFKQLTXHV ,W LV D SROH XQLW SUH¿WWHGZLWKa 1,024 ppr TTL optical encoder that feeds back to the drive for the closed loop Vector speed control operation and with a force-ventilation fan module mounted to the non drive end of the AC motor’s rotor. This gives the extremely accurate low speed operation required by many of the university’s experiments.

In remote control mode, the university closes the loop externally, taking into account differential pressure measurement feedback from the tunnel’s test section area. It is then possible to use an algorithm to calculate actual wind speed in metres/second. The researcher can then issue a corrected rotational speed set-point via the AC drive that is monitoring fan speed via the encoder, until the desired wind speed for the experiment is achieved.

The HMI touch screen is programmed with a number of virtual pages, push-buttons and digital displays for RPM, drive and motor status and fan motor temperature. These are duplicated on the university’s own PC control, which allows remote access if required for diagnostics and service.

The Department of Aeronautics has a series of wind tunnels, covering speeds of just a few metres/sec to Mach 9. Their Honda low speed wind tunnel was upgraded by '\QDPRWLYHDFRXSOHRI\HDUVDJRWRUHÀHFWWKHLQFUHDVHGperformance of today’s F1 cars. The 19 year old Control Techniques DC drives, still working well, were upgraded with more powerful Control Techniques Mentor II digital DC drives.

The Honda wind tunnel, which is optimised for race car WHVWLQJKDVDUROOLQJURDGDQGLV¿WWHGZLWKHTXLSPHQWWRsimulate the boundary layer effect. It has a six component force balance. The Donald Campbell low speed wind tunnel also has a rolling road and is equipped with an electromechanical three component force balance. There are four other general purpose wind tunnels including the newly refurbished 3ft x3ft low turbulence low speed wind tunnel.

Dynamotive, formed in 1998, has developed and manufactured chassis dynamometers and facility control systems for numerous climatic, aeroacoustic and aerodynamic wind tunnel test facilities throughout the world.

www.ControlTechniques.com

Latest Imperial College Wind Tunnel UpgradeAgain it’s Dynamotive with drives from Control Techniques

20 PECM January-March 2013

PECM113.indd 20 23/02/2013 15:38:46

Page 21: PECM - Issue 2 2013

January-March 2013 PECM 21

Variohm EuroSensor has released its new ETP range of temperature probes based on a MEAS thermistor.

To suit the broadest range of industrial, DXWRPRWLYH DQG VFLHQWL¿F DSSOLFDWLRQVfor precision temperature measurement, four basic packaged design types are available that each offers a choice of options.

The four designs conveniently mount the industry standard thermistor in a choice of Ø 4 mm PTFE or Ø 5 mm brass housings, ring terminal probes, or hexagonal head bolts. Within each packaged design, a standard off-the-shelf stock version is available with D . VHQVRU ¿WWHG DQG WKH FRPSUHKHQVLYH OLVW RIoptional features offered for each type include; housing diameter and length for the cylindrical probes, ring terminal mount diameter/size, and metric thread size for the hexagonal bolt version. The leadwire length for DOOW\SHVLVVLPLODUO\VSHFL¿DEOH

Furthermore, thanks to Variohm’s UK based in-house design and manufacturing capability, fully customised versions of the ETP range are available. Variohm welcomes the challenge from its customers for their individual requirements, and for each design type can provide higher or alternative temperature ranges, different thermistor technologies, or mechanical LQWHUIDFLQJPRGL¿FDWLRQV

The combination of so many feature options within a single range makes the new ETP temperature sensors a very convenient, practical and cost effective source for temperature measurement applications from HVAC to industrial process control and from home appliances to calibration and instrumentation equipment.

Variohm EuroSensor designs, manufactures and sources a comprehensive range of sensor technologies for linear and rotary position, load, force, vibration and temperature - providing complete pre-sale and post-sale application support for demanding measurement applications throughout industry, agriculture, construction, autosports and research.

New cost effective and flexible ETP temperature sensor range covers all

bases for mounting and measurement

HOLDINGSCompany

Email: [email protected]: www.variohm.com

Tel: +44(0)1327 351004Fax: +44(0)1327 353564

Temperature Probes

Choice of PTFE or brass tubular, ring terminal and hex bolt designsTemperature range: -40 to +125°CResistance values from 2.2 - 100 kΩ Competitively priced Standard models from stockCustom designs / higher temperature range available

PTFE ∅ 4mm

SMT Ring Terminal

Brass Tubular ∅ 5mm

Hex bolt M8

PECM113.indd 21 23/02/2013 15:38:47

Page 22: PECM - Issue 2 2013

22 PECM January-March 2013

Control & Automation

$UHOLDEOHVRXUFHIRUSOXJDQGSOD\PRWLRQV\VWHPVVXEDVVHPEOLHVDQGFRPSRQHQWV

,QKRXVHGHVLJQDQGPDQXIDFWXUHSURGXFWVFDQEHUHDGLO\PRGL¿HGWRVXLWLQGLYLGXDODSSOLFDWLRQV

ZZZUSPHFKDWURQLFVFRXN7HOVDOHV#USPHFKDWURQLFVFRXN

6WDQGDUGDQG&XVWRPLVHG&RPSRQHQWV

8SWR9,VRODWLRQ%DUUL

USB and Ethernet Instruments with Galvanic Isolation...

CalCert Instruments have over 30 years experience of solving process control and measurement applications, and having now gained ISO 9001 accreditation, back it up with Quality.As a company they are ready to provide the necessary products and services to address either the day to day problems or put together a full project solution.We can provide:Products: Instrumentation and sensorsSystems: Designed, built and installedCalibration: On or off site and to recognised procedures Repairs: Both to product and systemsLoop Optimisation: Get your control loops performing to the best possible.

Tel: 01922 744740Email: [email protected]

PECM113.indd 22 23/02/2013 15:38:51

Page 23: PECM - Issue 2 2013

January-March 2013 PECM 23

Control & Automation

Communication between controllers and intelligent sensors made easy

Due to the large variety of bus systems in factory

automation, many system integrators are faced with the dilemma of choosing the “right” system, a decision that can have far-reaching consequences.

For this reason, Panasonic developed a solution for transferring data between controllers and the sensors required. Up until now, communication between intelligent sensors and controllers has been realized via serial or parallel interfaces built into the sensors. At the same time, simple sensors capable of displaying the digital status of 1 or 0 only were developed for one VSHFL¿F¿HOGEXVW\SH7KDWLVDOOSDUWRIWKHSDVWQRZ

In 2005 Panasonic, known for sensors at that time under the brand QDPH681;LQWURGXFHGWKH);VHULHV¿EHURSWLFVHQVRUV7KHVHVHQVRUVZHUHWKH¿UVWZRUOGZLGHWRSURYLGHDPDVWHUVODYHIXQFWLRQvia optical interfaces between sensors. Each sensor could thus act as master or slave. Using these interfaces it was possible to copy settings such as threshold values, response times, NO/NC states, HWFIURPRQHVHQVRUWRWKHRWKHUV7KLVQRWRQO\VDYHGWLPHEXWDOVRensured reliability for applications that required several sensors. For these reasons, high-precision laser and pressure sensors soon began taking advantage of optical interfaces, too.

We continued to pursue this philosophy when designing the SCGUxx series units, i.e. units were developed that provided an interface EHWZHHQEXVDQGVHQVRU7KRXJK56LVVWLOO WKHPRVWSUHYDOHQWLQWHUIDFH LQ XVH XQLWV IRU &&/LQN 'HYLFH1HW DQG (WKHU&$7 KDYHbeen introduced as solutions for open networks. More units are SODQQHG

[email protected]

4H_PT\TMVVKZHML[ TH_PT\TWYVK\J[PVUV\[W\[TPUPTHSJVZ[Z!2SILY3\IYPJH[PVUOLSWZ`V\HJOPL]LHSS[OLZLNVHSZTVYLLHZPS`6\YOPNOWLYMVYTHUJL5:-/S\IYPJHU[ZHYL0:6 JLY[PÄLKHUKOH]LHT\S[P[\KLVMHWWYV]HSZ;OL`HYLH]HPSHISLMVYHSSIYHUJOLZVM[OLMVVKWYVJLZZPUNPUK\Z[Y MVYHSSJVTWVULU[ZHUK[YPJR`ZWLJPHSJHZLZL]LY`^OLYLPU[OL^VYSKPU[OLZHTLOPNOX\HSP[ 6\YL_WLY[Z^PSSWYV]PKL`V\^P[OZ\WWVY[[VTLL[`V\YPUKP]PK\HSYLX\PYLTLU[ZMYVTJVUZ\S[PUN[VVW[PT\TS\IYPJH[PVUTHUHNLTLU[LUZ\YPUNTVYLZHML[`VMWYVK\J[PVUWYVJLZZLZHUKOPNOLYWYVÄ[HIPSP[

2SILY3\IYPJH[PVU!`LHYZVML_WLYPLUJLHUKWYVMLZZPVUHSZLY]PJLZMVY`V\YZ\JJLZZ

Klüber Lubrication Great Britain Ltd.ZHSLZ'\RRS\ILYJVT^^ RS\LILYJVT

Certified speciality lubricants for the best possible taste.

`V\YNSVIHSZWLJPHSPZ[

PECM113.indd 23 25/02/2013 11:17:07

Page 24: PECM - Issue 2 2013

24 PECM January-March 2013

Control & Automation

Technical Solutions 24 Seven LimitedTechnical Solutions 24 Seven Limited is the UK agent for the Italian manufacturer Santerno.They have a large range of inverters with the Penta proving well suited to the UK market. Its robust steel enclosure, tropicalised boards and 3 year warranty all proving attractive. The drives are available up to 3000kw on short lead times. Up to 132kw they can be supplied in an IP54 casing with Estop and Mains Isolator as options. TS247 engineer’s have a wealth of experience in motion control and can help at all project stages wether it be design, manufacture, installation or commissioning.

www.technicalsolutions247.co.ukwww.santerno.com

It Won’t Drive you SpareQuantum Controls has launched a brand new website www.abbdrivespares.co.uk, KHUH \RX ZLOO ¿QG WKH FRUUHFWspare for any ABB drive easily. The web site has been designed with ease of use in mind to provide ABB users with an online shop to locate and purchase ABB drive Spares..Quantum’s Web based spare parts information and ordering site ensures quick and easy ordering online. The new website contains VSHFL¿F LQIRUPDWLRQ RI $%% GULYHV VSDUHV WKHLU DYDLODELOLW\ DQGtechnical details. The site provides 24-hour access to extensive information and possibility to order them round the clock.www.abbdrivespares.co.uk

Bifold, Official Partner of the Marussia F1™ Team have linked Safety with Performance to provide the widest range of relief valves for pneumatic & hydraulic applications

Bifold provide the widest range of relief valves for pneumatic and hydraulic instrument applications with pressures ranging from 7 to 1300 bar.Our relief valves are suitable for safety applications. Many other relief valves of this type on the market, fail to perform the correct safety function required.The Bifold pneumatic relief valves have a YHU\KLJKÀRZDQGORZGHDGband. The relief valves are a safety device designed to match Bifold’s KLJKÀRZ¿OWHUUHJXODWRUV7KHGHYLFHZLOOOLPLWWKHRYHUSUHVVXUHWROHVVWKDQRIWKHVHWSRLQWLQWKHHYHQWRID¿OWHUUHJXODWRUPLVRSHUDWLRQ

Tel: 0161 345 4777 www.bifold.co.uk

New Poggi “AISI 316 Stainless Steel” Spiral Bevel Right Angle Gearbox A.5000 Series From Francis And Francis Ltd Achieving EXCEPTIONAL CORROSION RESISTANCE, for application in the FOOD, PHARMACEUTICALS, SHIPBUILDING, CHEMICALS, TEXTILE, PAPER, PHOTOGRAPHIC and other Industries, POGGI’s latest innovative, ‘ergonomic’ design of the A.5000 Series, AISI 316 Stainless Steel (Gleason Spiral Bevels) Right Angle Gearboxes, matches the external, ÀDQJHFRQQHFWLRQVVKDIWGLPHQVLRQVRIWKH$$OXPLQLXP6HULHVthereby enabling full ‘interchangeability’.Selection of AISI 316, in preference to the more commonly used AISI 304, Stainless Steel, results in a substantially superior corrosion resistance, thereby offering a wider range of applications.

www.poggispa.com/pict/doc/185000X/185000X.pdf

The hugely successful range of one piece Reli-a-Flex® couplings manufactured by Reliance Precision Mechatronics has been VSHFL¿FDOO\GHVLJQHGWRSURYLGHH[WUHPHO\accurate transfer of motion between two rotating shafts, while catering for parallel and angular misalignment.

The Reli-a-Flex® couplings are available from the Reliance Precision Mechatronics online store on a short lead-time, with a selected ‘preferred range’ available ex-stock. The coupling selector enables the designers to create their own unique Reli-a-Flex®FRXSOLQJZLWKH[DFWVSHFL¿FDWLRQVfor the application in hand, rather than using a coupling with a similar VSHFL¿FDWLRQ ZKLFK FRXOG SRWHQWLDOO\compromise the design.

The original range includes outside diameters from 13mm to 40mm and the additional micro sizes now available are 6mm, 8mm and 10mm. These couplings retain all the advantages of Reli-a-Flex’s patented design, and are ideal for the accurate, miniature motion control applications demanded by the printing, PHGLFDO DQG VFLHQWL¿F LQVWUXPHQWmarkets.

Other one piece couplings currently on

the market may outwardly resemble the Reli-a-Flex® DW ¿UVW JODQFH EXW WKHUH

is one vital difference. The patented slot design on the Reli-a-Flex® maintains a constant pivot length which minimises stress variations. On the Reli-a-Flex® the pivot points travel back and forward without changing the centre piece angle, resulting in uniform stress levels and accurate angular rotation. Similar looking couplings on the market can actually have a slot pattern where the pivot points move in and out, and the centre piece angle varies. This causes stress variations and less uniform rotation.

In tests performed on typical applications, the bi-directional error produced by a Reli-a-Flex® coupling used to drive a 3600 line encoder was four times smaller than that produced by a 4 beam spiral coupling. When used to drive a 6.35mm

l e a d l eadsc rew, the bi-directional error from the Reli-a-Flex® was 6 times less than that of the 4 beam spiral.

Reli-a-Flex® also offers predictable performance, having been tested for 50,000,000 cycles at its rated torque and 80% maximum offset.

For more information on Reli-a-Flex® couplings and the full range of positioning components and assemblies,please contact Reliance at [email protected] or visit our website www.rpmechatronics.co.uk

Reliance Expands its Range of Reli-a-Flex® Precision Couplings

PECM113.indd 24 25/02/2013 11:17:33

Page 25: PECM - Issue 2 2013

PECM113.indd 25 23/02/2013 15:38:58

Page 26: PECM - Issue 2 2013

26 PECM January-March 2013

Electrical Engineering

MMS Electronic releases a new 7” Intelligent TFT graphic display, EA eDIPTFT70-ATP. With an LED backlit 800 x 480 pixel resolution touch screen display, built-in intelligence and innovative user-friendly features. It provides the ideal platform for development of interactive controls. For example, a virtual keyboard can be generated on the screen with just a few simple commands. The display can also provide acoustic feedback into an 8 ohm speaker. Sounds ranging from simple clicks, notes or jingles acting as warning or status messages.

Simple commands offer an abundance of clever graphics functions for GLVSOD\LQJEDUJUDSKVIUDPHVDQGVZLWFKHV(LJKWSUHGH¿QHGIRQWVDUHSURYLGHGand other TrueType fonts can be imported. The onboard 4MB memory stores images, animations and macros. Text can be mixed with graphics, pictures and gif animations. There are new integrated analogue rotary and pointer instruments commands. The unit features two analogue inputs in addition to 8 digital inputs and 8 digital outputs.

The eDIPTFT70-ATP features wide connectivity with 5V serial, I2C and SPI interfaces on-board. Also available in 3.2” and 4.3”.

MMS Electronics LtdTel 01943 877668 www.mms-e.co.uk

7“ Intelligent TFT display with sound

Multiplexer Transmits up to 16 Signal Channels over Fiber

The new range of MX series Multiplexers from Ultra Electronics NSPI (formerly Weed Instruments) is now available from IndustrialComms.With up to 16 signal channels available and a choice of input/output modules for 4-20mA, 0-10 VDC, Contact Closure or 56 VLJQDOV WKH0; VHULHV RIIHUV DÀH[LEOH VROXWLRQ WRtransmitting control and instrumentation signals over long distances.7KHV\VWHPFRPSULVHVD%DVHXQLWZKLFKKDQGOHVWKH¿EHURSWLFtransmission to which up to four input/output modules can be FRQQHFWHG$VLPLODUDUUDQJHPHQWDWWKHRWKHUHQGRIWKH¿EHUlink completes the system. Bi-directional communication via the ZD\¿EHURSWLFOLQNLVSRVVLEOHXSWRGLVWDQFHVRINPWith DIN-Rail mounting, 24 VDC power input, ATEX and CE approvals the MX series of Multiplexers are ideal for applications in many market sectors in particular Process Automation, Utilities and Oil and Gas.

Tel: 0203 086 9569 www.industrialcomms.co.uk

PECM113.indd 26 23/02/2013 15:39:02

Page 27: PECM - Issue 2 2013

?7"A(( 56'$. .36/./AA)=97"A4=7?41@+?<4@7#?*2@*:

'5.5 6.5/ A$A

+++*1@+?<4@7#?*2@*:

,A/. 3'(! A=:>@A<=;09;0A9;1:>,A3%&A5%&A6/5%&A$'5%AA'55%A@:>1:>A1@+?<A<=>9;0,A9;07?A63&A3(A@<A(/A A=8:4>=7?A@:>1:>A#@7>=0?,A@+?<A@@8AA?)@>?A;--,A:00?8A)?>=7A2=4?A-@<A=<4A9;8:4><9=7A?;#9<@;)?;>4,A!A2?<>9-92=>9@;A-@<A==<8@:4A7@2=>9@;4A@1>9@;=7,A!88A@;A-:;2>9@;A)@8:7?4A-@<A6A<?8:;8=;2&A?>?;8?8@78A:1A>9)?A@<A=>>?<A=2A:1*

PECM113.indd 27 23/02/2013 15:39:06

Page 28: PECM - Issue 2 2013

28 PECM January-March 2013

Electrical Engineering

Descale 518Contains

NOChloride

s

before after

Descale 518 is speciallyformulated for stainless steel but can also be used on steel, iron, brass, copper, plastic and rubber. Ideal for holding tanks, reservoirs, heat exchangers, condensers, and other aluminium or stainless steel equipment.

Aqua Safe Descaler is safe on steel, stainless steel, aluminium, iron, brass, copper, plastic, rubber, and other materials

found in most water cooled, heated, or operated equipment. Ideal for water heat exchangers, tankless hot water heaters, coolers, pumps, boilers, compressors, condensers, extruders, molds, cooling towers, furnaces, water piping systems and other water side heat exchange surfaces. Dissolves all types of water scale, calcium carbonate,lime, and rust.

Aqua Safe Descaler

before after

Aqua Safe Descaler is certified by NSF to NSF/ANSI Standard 60

®

Tel: 01579 384 584 Fax: 01579 384 765 Email: [email protected] Web: dynamicdescaler.co.uk

afterbefore

Scale removal = Lower energy costs

Environmentally Friendly

World’s Safest & Most Effective Descaler

Environmentally Friendly & Biodegradable

Dynamic Descaler® is a revolutionary liquid descaler that rapidly dissolves all water scale and lime plus it removes, rust, and other non-soluble sedimentation deposits safely and effectively.

Biodegradable. Won’t harm the environment.Safe. Won’t harm workersEconomical. Compare cost to other products and cleaning options.Fast. Equipment is cleaned within a few hours.Superior corrosion inhibitors. Lowest corrosion rate of any descaler.Powerful detergents and penetrating agents.

Scale removal = Lower energy costs

Environmentally Friendly

Ideal For:

%RLOHUV&KLOOHUV&RQGHQVHUV+HDW([FKDQJHUV2LO&RROHUV&RROLQJ7RZHUV:DWHU3LSLQJ6\VWHPV/LTXLG5LQJ9DFXXP3XPSV

Safe On:

6WHHO,URQ&RSSHU%UDVV3ODVWLF5XEEHU

Arc Energy Resources has completed a contract for the subsea division of Vector Technology to carry out highly specialised welding and fabrication services on a pig launcher and retrieval system (PLR) destined for a time-critical subsea pipeline DSSOLFDWLRQ LQ WKH &DVFDGH &KLQRRN RLO¿HOG LQ WKHGulf of Mexico. The PLR is 3.5 metres tall, 2 metres wide and weighs approximately 5 tonnes. The contract involved welding a soft landing-arm system to the PLR and fabricating a number of specialised components that also needed to meet similarly demanding welding procedures in accordance with American structural welding codes, AWS D1.1 and ASME VIII.

Email: [email protected] www.arcenergy.co.uk

Arc Energy Provides Specialised Welding and Fabrication for Vector PLR

General Food & Drinks Ltd International Food Suppliers your never too far away for us to deliver.

Just e-mail us your order [email protected]

Master Lock advises on controlled electrical lockoutSafety specialist Master Lock gives recommendation on how to implement a complete electrical lockout. Thousands of work accidents occur while repairing or servicing industrial equipment. Most of those accidents are due to energy sources that have not been isolated. 7KHUHIRUH LGHQWL¿FDWLRQ RI WKH HTXLSPHQW¶V SRWHQWLDOhazard is essential for a successful safety procedure:1. Stop the machine from sources of electrical energy.2. Lock out the machine with an appropriate safety device. The isolation point that allows the lock out must be immobilized in open or closed position according to the instructions.3. Check that the device is properly locked out7DJRXWZLWKVSHFL¿FWDJVLQIRUPLQJWKDWLQWHUYHQWLRQLVLQSURJUHVVDQGWKDWit is forbidden to unlock the equipment.

Tel: +33 1 77 69 02 41 www.safetyseries.eu

Providing continuous powerRecognising the need for the seamless performance of today’s technological innovations, UPS provider Socomec has introduced its new NETYS range of ‘intelligent’ single-phase UPS systems, which KDYH EHHQ FUHDWHG VSHFL¿FDOO\ IRU WKH UHTXLUHPHQWV RI GRPHVWLFenvironments and small to medium sized organisations.Available in a range of options from 600VA to 3.3kVA, the systems are based on Socomec’s UPS technology and have been engineered

to guarantee uninterruptible and continuous power for mission critical IT applications.The range includes compact multi·socket UPS systems

with features such as a USB port and powerful rack or

tower solutions to protect net-works and other connected services.

Socomec UPS Tel: 01285 863 300 www.socomec.com

are based on Socomec’s UPS technology and have been engineered to guarantee uninterruptible and continuous power for mission critical IT applications.The range includes compact multi·socket UPS systems

with features such as a USB port and powerful rack or

tower solutions to

PECM113.indd 28 23/02/2013 15:39:15

Page 29: PECM - Issue 2 2013

/A0-4*"+'.2-#2"'A:9;&>=8<5A;96:?A@6?;@9<5A3.-#2"'/A+1:8?<5>A'A@:?6:?A@ A>;?>=A34A?@A32"A@=A4*A?@A4."A/A<;,:,A@:?6:?A6@)>=A340A/A@:8>1A;9A=:((>1;>1 A8><5>1 A1;>-7<8?A<5:,;9;:,A@:8;9(/A%<8A7@99>7?;@9AA&;<A)<?>=6=@@ A;96:?AA@:?6:?A7@99>7?@=8/A:8?AA<?>=A=>8;8?<9?A?@A#AA%+A*A=<?;9(/A6>=<?;9(A?>,6>=<?:=>A =@,A-*0'[email protected]'/A@=?A7;=7:;?A<91A@&>=5@<1A6=@?>7?;@9/A+%AA+A7>=?; ;7<?;@9A @=A<<=1@:8A5@7<?;@98

>5$A**-032-243.2.AAA%,<;5$A8<5>86@)>=8@5&>!7@!:

20. AA

)))!6@)>=8@5&>!7@!:

PECM113.indd 29 23/02/2013 15:39:17

Page 30: PECM - Issue 2 2013

30 PECM January-March 2013

Introduction(QWU\WRIUHLJKWFRQWDLQHUVUHSUHVHQWVDVLJQL¿FDQWKD]DUGWRVWDIIUHVSRQVLEOHIRULQVSHFWLRQVWXI¿QJRUGHVWXI¿QJbecause of the large number of airborne chemicals that can be present. Research in Germany and the Netherlands found hazardous levels of gases and vapours in around 20% of all containers and this level of contamination is now accepted as commonplace.

It is therefore necessary to examine containers before entry and this work is usually conducted with a wide variety of gas detection techniques in order to be able to assess, individually, all of the substances of greatest concern. +RZHYHUD'XWFK¿UPRIKHDOWKDQGVDIHW\FRQVXOWDQWVReaktie, has employed FTIR (Fourier Transform Infra Red) gas analysis to dramatically improve the speed and effectiveness with which containers are assessed, because this technology enables the simultaneous measurement of the 50 gases of most concern.

Chemical HazardsThere are two potential sources of hazardous chemicals inside cargo containers; fumigants and chemicals that arise from the goods or packing materials. Fumigants are applied to goods to control pests and micro-organisms. Cargoes most likely to have been fumigated include foodstuffs, leather goods, handicrafts, textiles, timber or cane furniture, luxury vehicles and cargo in timber cases or on timber pallets from Asia.

According to the IMO’s international regulations, ‘Recommendations on the safe use of pesticides in ships’, fumigated containers and ship cargoes must be labelled JLYLQJ VSHFL¿FDWLRQVDERXWGDWHVRI IXPLJDWLRQDQG WKHIXPLJDWLRQJDVXVHG)XUWKHUPRUHDSSURSULDWHFHUWL¿FDWHVare necessary and these records have to be forwarded to the Port Health Authorities without their explicitly asking for them. However, absence of marking cannot be taken

FTIR gas analysis improves container safety

PECM113.indd 30 23/02/2013 15:39:19

Page 31: PECM - Issue 2 2013

January-March 2013 PECM 31

www.gasmet.fi

to mean fumigants are not present. Containers marked as having been ventilated after fumigation may also contain fumigant that was absorbed by the cargo and released during transit. There is also concern that fumigants may be retained in the goods and subsequently present a hazard to logistics providers, retail staff and consumers.

Common fumigants include Chloropicrine, Methyl EURPLGH (WK\OHQH GLEURPLGH 6XOIXU\O ÀXRULGH DQGPhospine. However, with over 20 years of experience testing gases in containers, Peter Broersma from Reakti says “While the fumigants are highly toxic, the number of containers exceeding occupational exposure limits (OEL) due to other chemicals is much greater and the number of ‘failed’ containers is likely to rise as more containers are tested, detection methods improve and new gases DUHLGHQWL¿HG

Containers often travel for extended periods and experience a wide range of temperatures. It is therefore not surprising that unsafe levels of gases should DFFXPXODWH LQ WKH FRQ¿QHG VSDFHRI D FRQWDLQHU 3HWHULGHQWL¿HVWKHW\SLFDOVRXUFHVRIJDVHVRYHUWKHLU2(/VDVfollows:

6ROYHQWVIURPJOXHVXVHGWRSURGXFHFORWKLQJ accessories and shoesGLFKORURHWKDQHIURPSODVWLFSURGXFWV39& blister packaging etc. )RUPDOGHK\GHIRXQGLQFKHDSIXUQLWXUH3O\ZRRG0') etc.) but also in used pallets and lashing materials6ROYHQWVDQGIRUPDOGHK\GHIURPSRO\UHVLQSURGXFWV&DUERQPRQR[LGHIURPFKDUFRDODQGQDWXUDOSURGXFWV&DUERQGLR[LGHIURPQDWXUDOSURGXFWV(WK\OHQHR[LGHIURPPHGLFDOHTXLSPHQWVWHULOLVHG with ethylene oxide 6ROYHQWVLQFOXGLQJ%HQ]HQH7ROXHQH(WK\OEHQ]HQH and Xylene (BTEX) in Christmas and decoration products)ODPPDEOHJDVHVIURPGLVSRVDEOHOLJKWHUV$PPRQLDLQKRXVHKROGHTXLSPHQWZLWK%DNHOLWHSDUWV9RODWLOH2UJDQLF&RPSRXQGV92&VIURP¿UHEORFNV3HQWDQHVDQGKH[DQHVIURPFRQVXPHUHOHFWURQLFV3KRVSKLQHDUVLQHIURPQDWXUDOPLQHUDOVVXFKDV ferrosilicon

Inspection proceduresMajor ports have strict regulations in place to protect against potential hazards in cargo containers. In general terms, every incoming stream of products has to be checked for dangerous gases and if one of more gases are detected during the preliminary investigation, all of the

FRQWDLQHUVIURPWKLVVSHFL¿FSURGXFHUPXVWEHFKHFNHG,Ino gases are detected, it may be possible to only conduct random tests a few times per year. If it is necessary for Customs staff to enter a container, all containers must ¿UVWEHWHVWHGDQGLIQHFHVVDU\GHJDVVHG

Gas detectionSince there are a large number of gases that might be present inside a container, the traditional approach to monitoring has been either to employ a wide range of instruments or to use chemical stain tubes for the most common gases, or a combination of both.

Chemical stain tubes provide a colorimetric assessment of an individual gas, typically with an accuracy of +/- 15%. Different tubes are available for many gases and results can be obtained between 5 seconds and 15 minutes depending on the test. Once a result has been obtained, the tube itself is hazardous waste and must be disposed of. Historically stain tubes have been popular because the cost per test is low. However, the number of tubes that have to be employed in order to demonstrate that a container is safe can be prohibitively expensive and time-consuming to employ.

One of the potential problems with electrochemical sensors is their inability to cope with high concentrations in a sample gas. This can result in poisoning of the cell, which would normally result in instrument failure. In contrast, similar high concentrations do not harm FTIR, and the instrument can recommence analysis after a few PLQXWHVRIEDFNÀXVKLQJ

3HWHU%URHUVPDKDVEHHQRQHRIWKH¿UVWWRXWLOLVH)7,5LQ WKH DVVHVVPHQW RI FRQWDLQHUV VLQFH LW ¿UVW EHFDPHpossible to acquire the technology in a portable battery powered unit. He says “The problems with hazardous gases in cargo containers is now widely publicised and the UHTXLUHPHQWIRUWHVWLQJLVJURZLQJDVHPSOR\HUVIXO¿OWKHLUresponsibility to protect the health and welfare of staff. However, the traditional testing methods are laborious, WLPHFRQVXPLQJ DQG ULVN IDLOLQJ WR ¿QG D SRWHQWLDOO\harmful gas.

“FTIR has long been established as an accurate technology for the simultaneous measurement of gaseous emissions from industrial processes, so when the Finnish company Gasmet developed a portable version we were very eager to investigate its feasibility in container testing.

“Following our initial tests, we worked with Gasmet to GHYHORSDFRQ¿JXUDWLRQIRUWKHSRUWDEOH)7,5D*DVPHWDX4030) that would measure the 50 compounds of greatest concern. As a result, we are now able to test for all of these gases in around 3 minutes, which dramatically lowers the time taken for container inspection and greatly increases the number of containers that can be examined every day.

“We now use a portable FTIR for all of our container examination work and we have also supplied a number of these units to freight companies that wish to conduct their own testing. This technology is now in use at Rotterdam, Amsterdam, Vlissingen, Antwerp and Hamburg, and a company providing ship fumigation and degassing is using portable FTIR all over the world.”

PECM113.indd 31 23/02/2013 15:39:20

Page 32: PECM - Issue 2 2013

Kemet International Ltd, world leaders in surface ¿QLVKLQJKDYHEHHQEXLOGLQJRQWKHVXFFHVVRIWKHLUspherical polishing machines with a new range of ODSSLQJ PDFKLQHV GHVLJQHG VSHFL¿FDOO\ IRU QRQ ÀDWSUR¿OHV

In today’s world, engineers/designers are asking for cylindrical and spherical surfaces which may appear ÀDW WR WKH QDNHG H\H EXW LQ UHDOLW\ DUH SHUIHFWgeometrically spherical or cylindrical forms.

In some cases, convex and concave surfaces need to be lapped together to form a perfectly matched bearing surface. Until recently the matching of surfaces has been a laborious manual operation, but with Kemet’s new Kemtech 15 Match Lapping Machine, all the hard work is performed automatically, at the push of a button.

The machine is based on Kemet’s market leading Kemet 15 base unit with the addition of a variable pressure, top plate mounting arm, adjustable to suit the requirements of the parts being matched together, dependent on size and material. The machine is ideal for convex/concave hydraulic pump components

particularly in service workshops removing damage and wear marks. Machines are supplied with bespoke tooling to suit whatever application and Kemet offer process proving trials, free of charge.

For more complex cylindrical shapes, Kemet have developed a form generating machine which is able to produce cylindrically convex and concave surfaces where an extremely large radius is needed. A recent project created a convex form where the convexity was MXVWPLFURQV7KLVLVQRWDPDFKLQHGVXUIDFH,WLVDlapped form with a highly controllable, uniform shape DQGVXUIDFH¿QLVK

Used with Kemet’s extensive range of super-abrasive FRPSRXQGVDQGRWKHUVXUIDFH¿QLVKLQJFRQVXPDEOHVthese new machines are able to process materials with ease, even extremely hard aerospace coatings, ceramics, and hard alloys.

Follow the lead of the world’s aerospace and medical market leaders - contact Kemet International if your ZRUOGLVQRWMXVWÀDW

Kemet develops curvier profile for lapping

Tel: (+44) 1622 755287 Email: [email protected] www.kemet.co.uk

Before lapping After lapping

PECM113.indd 32 23/02/2013 15:39:29

Page 33: PECM - Issue 2 2013

January-March 2013 PECM 33

Facilities Management

Counter Corrosion LtdCoatings & linings

www.countercorrosion.co.uk

ContactMalcolm Smitht: 01924 468559 / 380002f: 01924 [email protected]

Counter Corrosion Ltd designs, manufactures and applies high performance coatings, linings and floor toppings for industrial equipment and environments.*ODVVIODNHFRDWLQJVCounterflake coatings are used to protect steel tanks, vessels and process equipment in the chemical, petro-chemical, power and allied industries.5HLQIRUFHGPRQROLWKLFOLQLQJVCounterline and Bundline linings are used to protect steel, concrete, tile and brick in hostile and corrosive environments. )ORRUWRSSLQJVCounterfloor systems are seamless chemical- and wear-resistant floor toppings.

Corrosion Control Systems

Chemical holding tank lined inCounterflake HD

Hybrid Counterline system protectinga concentrated brine pit at 60°C

&RYH,QGXVWULDO(QWHUSULVHV/WG,QGXVWULHV+RXVH,QYLQFLEOH5RDG)DUQERURXJK+DPSVKLUH*848

$HURVSDFHDQG'HIHQFH5XJJHGLVHG(0&+RXVLQJV3DQHOVDQG´5DFN6\VWHPV(OHFWURQLF'HVLJQ$XWRPDWLF7HVW(TXLSPHQW,QGXVWULDODQG&RPPHUFLDO:LULQJ+DUQHVVHV&DEOH$VVHPEOLHV6KHHW0HWDO)DEULFDWLRQ

([SDQG \RXU GHVLJQ KRUL]RQV ZLWK &RYH ,QGXVWULHV XVLQJ RXU \HDUVH[SHULHQFH LQ WKH GHVLJQ DQG SURGXFWLRQ RI UXJJHGLVHG VKLHOGHG HQFORVXUHVZLULQJ KDUQHVVHV DQG$7( :H SURYLGH D WRWDO VROXWLRQPDQXIDFWXULQJ VHUYLFHIURPGHVLJQWKURXJKWRGHOLYHU\

VDOHV#FRYHLQGXVWULHVFRXNZZZFRYHLQGXVWULHVFRXN

All CERTUSS Steam Generators are type tested according to European Pressure Equipment Guideline DGRL 97/23/EG. CERTUSS offer seven construction groups within their range of fossil fuel Generators with outputs ranging from 80kg/hr to 2000kg/hr and operating pressures of up to 32 Bar G. To accompany the Generator, CERTUSS also offer their CVE Package Plant Module, where all of the associated ancillary items are pre-piped, pre-wired and factory tested. Fuel types offered are Gas, Light Oil, LPG and Bio Fuel, with combination burners offered on all units from 500kg/hr upwards. Also available are a range of Electrical Steam Generators from 6kW to 120kW.CERTUSS also offer a new “TC Model” with touch screen control DQGIXOOPRGXODWLRQIURP¿ULQJ7KH7&RIIHUVRXWSXWranges from 500-2000kg/hr and is compatible with many BMS LQWHUIDFHSURYLVLRQVVXFKDV3UR¿EXVDQG0RGEXVHWF

Tel: 0121 327 5362 Fax: 0121 328 [email protected] www.certuss.co.uk

CERTUSS

PECM113.indd 33 23/02/2013 15:39:32

Page 34: PECM - Issue 2 2013

34 PECM January-March 2013

Facilities Management

10kW UPS ‘backup in a box’ from under £10kA fully integrated backup power system for

RI¿FHEXLOGLQJVGDWD FHQWUHVDQG LQGXVWULDO836applications has been launched by UK company

Pnu Power, with prices starting from less than

£10k.

The EPS10 (left) provides 10kW of peak power

and 100+ hours run time in a self-contained

weatherproof box that can be located in extreme outdoor environments.

It can be connected to critical loads via a single mains cable and several

units can be run in parallel, for higher loads and/or redundancy.

The unit uses the latest ultra-capacitor technology in place of

conventional lead-acid batteries, to provide instant bridging power in

the event of an outage and fast, reliable start-up of its integral diesel

generator for extended run time.

More information at www.pnu-power.com

Telephone Hoods,Cabinets, Kiosks and

Special Environment Phones

Tel +44 (0)1242 570995email [email protected]

www.teleacoustics.co.uk

SOUND SOLUTIONS

Dawsonrentals temperature control solutionsDawsonrentals temperature control

solutions (DRTCS) offer bespoke

refrigeration equipment and temperature

controlled factory extensions. The refrigeration equipment available

includes purpose built cold stores, blast freezers, blast chillers, chill

stores, tempering units and hot boxes. DRTCS modular extensions are

ideal for creating extra space which can be used to house an additional

production line, to provide extra warehouse room, or to expand

existing work space. Extensions can be linked into existing facilitates

or installed standalone depending on requirements. The image shows

a temperature controlled factory extension which allowed an additional

production line to be installed at the customer’s site within weeks.

Email: [email protected] www.drtcs.co.uk

dustbits.com has been launched to provide a gap in the market place for a One Stop Shop to provide components for Bag Filter Systems throughout the UK.

Previously owners of Filter Systems would have to go to the Original Equipment Manufacturer to buy component parts and this would usually mean purchasing from several companies for Filter Bags, Filter Cages, Pulsing Equipment etc.

The goal of dustbits.com is to bridge this gap by offering a full range of components at competitive prices so that the owners of the Filter Plants only have to make one phone call.

The new ecommerce website with easily ordered components makes the process of getting multiple spares a simple task www.dustbits.com

To complete the service dustbits.com provides LEV COSHH testing WR+6*VWDQGDUGZLWKTXDOL¿HGHQJLQHHUVDQGFDQSURYLGHUHJXODU¿OWHUPDLQWHQDQFH

Tel: 01858 288676 Fax: 01858 288082 Email: [email protected]

FOR FILTER SPARES & ACCESSORIES

PECM113.indd 34 23/02/2013 15:39:43

Page 35: PECM - Issue 2 2013

DP Fabrications, established in 1987, has built up a reputation for quality and reliability. DP has the versatility to design and build SpecialPurpose enclosures ranging from Control Desks to large switchboards.Our experience has been gained through working to Customer specifications for the Water, Food, Transportation and Electrical Industries.

tware.unching to 0.1mm accuracy

ainting facilityild Steel, Stainless Steel,

* Custom Built Enclosures * Motor Control Centres * Switchboards * Wardrobe Enclosures ** Control Desks * Transformer Housings * Starter/Cable Boxes * Road Tunnel Panels *Frameworks *

Your Specials Are our Standards

D.P. Fabrications Ltd, Chantry Road, Woburn Road Industrial Estate, Kempston, Bedford, MK42 7HUTel 01234 840166 Fax 01234 840177 Email: [email protected] Website: www.dpfabs.co.uk

Te ed Installers

onnecProtection to IP66

ully Welded Construc c’sWelded Frame

c’stensions To c’s

PECM113.indd 35 25/02/2013 16:02:41

Page 36: PECM - Issue 2 2013

In conjunction with the drive by the British

Automation and Robot Association (BARA)

on behalf of UK Government, CKF Systems

Ltd has developed a low cost robotic packing

system designed to increase the take-up

of automation within British industry. The

V\VWHPLVVSHFL¿FDOO\DLPHGDW60(¶VZKHUHthere has been a reluctance to embrace such

technologies, providing them with a very

XVHUIULHQGO\DQGKLJKO\ÀH[LEOHRSHUDWLRQWRreduce production costs through improved

HI¿FLHQFLHVDQGTXDOLW\FRQWURO

Designed around a standard robot cell with integrated product and case handling interfaces, the system will enable many more UK businesses to compete more effectively at home and internationally. The Gloucestershire company aims to counter the competitive advantage, through low labour rates, of businesses in Asia and Eastern Europe, by supporting BARA’s efforts to assist in the implementation of automated solutions for manufacturers of all sizes.

Chris Buxton, CEO of the British Automation & Robot Association (a PPMA Group Company), stated: “It is to the credit of CKF that they have risen to the challenge. If the UK is to remain competitive on the global stage it is essential that companies adopt the latest technology DYDLODEOH EXW WKH\ RIWHQ ¿QG WKDW WKH FDSLWDO FRVW RIestablishing an automated facility can be prohibitive. &.)KDVFOHDUO\LGHQWL¿HGDVROXWLRQWRWKLVFRQXQGUXPthat can help UK Manufacturers take that all important step into the world of robotics.”

Although the situation is starting to change, recent reports show that the UK still lags behind much of the world in robotic investment, with one report highlighting Germany employing a ratio of 127 robots SHUHPSOR\HHVFRPSDUHG WR WKH8.¿JXUHRI25 robots.

“There is a limit to what can be achieved by the DSSOLFDWLRQ RI HI¿FLHQF\ PHDVXUHV LI RSHUDWLRQVcontinue to be based on manual input,” explains Ian 6FKR¿HOG6DOHV0DQDJHU&.)6\VWHPV/WG³<HWPDQ\SME’s, typically with between 10 and 100 employees, consider automation a step too far. Over the past 12 months, CKF has been examining ways to address their concerns relating to the skill sets required and the perceived costs. Our ready-made, low cost robotic packing system doesn’t require highly skilled operators, it is easily maintained and utilises a relatively small DUHD RI DQ\ VKRS ÀRRU ,W KDQGOHV PHGLXP WR KLJKVSHHGUHSHWLWLYHWDVNVPRUHHI¿FLHQWO\RYHUVXVWDLQHGperiods than manual labour, with greater consistency and reduced wastage. A company can then make better use of resources, redeploying staff more productively whilst also reducing the likelihood of RSI and other health and safety concerns.”

CKF is a well established specialist supplier of integrated solutions to the manufacturing industry, particularly in the area of food processing and packaging. It serves customers worldwide, including many global brands, utilising new technologies designed to transform virtually all aspects of production.

www.ckf.co.uk

CKF – MAKING AUTOMATION ACCESSIBLE

PECM113.indd 36 23/02/2013 15:39:52

Page 37: PECM - Issue 2 2013

)GPGTCVQT5YKVEJIGCT5GTXKEGU

7PKV5V/KEJCGNU4QCF5V*GNGPU/GTUG[UKFG9#9<

6GN 'OCKNUCNGU"DWTVQPYQQFITQWREQO9GDYYYDWTVQPYQQFITQWREQO

$WTVQPYQQF)GPGTCVQT5YKVEJIGCT5GTXKEGUJCUQXGT[GCTUEQODKPGFGZRGTKGPEGKPVJGFGUKIPUWRRN[CPFOCKPVGPCPEGQHGOGTIGPE[RQYGTU[UVGOUCPFKUVJGVTWUVGFRCTVPGTKPRTQXKFKPIUVCPFD[RQYGTUWRRN[QTGSWKROGPV

6JGRQYGTQHVJKUGZRGTKGPEGGPUWTGUVJCVYGQHHGTCVGCOCRRTQCEJHTQONQECVKQPUPCVKQPYKFGCPFCYGNNITQWPFGFKPFWUVT[GZRGTVKUGVQCNNQWTEWUVQOGTUVJGKTHCEKNKVKGUCPFUVCPFD[IGPGTCVQTU[UVGOUFGNKXGTKPIVKOGETKVKECNRQYGTIGPGTCVKQPUQNWVKQPUCPFFKUVTKDWVKQPQHGOGTIGPE[RQYGTUGTXKEGUVQUQOGQHVJGOQUVUGPUKVKXGTGOQVGQTFKHſEWNVNQECVKQPUKPVJG7-CPFQXGTUGCU

4EPDLKSAN?KIAOCNA=PNAOLKJOE>EHEPU

6JG2QYGTQH'ZRGTKGPEG

PECM113.indd 37 23/02/2013 15:39:57

Page 38: PECM - Issue 2 2013

Corrosion of pipework and components in water based ŚĞĂƟŶŐ ĂŶĚ ĐŽŽůŝŶŐ ƐLJƐƚĞŵƐ ŶĞĂƌůLJ ĂůǁĂLJƐ ƌĞƐƵůƚƐ ŝŶ ĐŽƐƚůLJƌĞƉĂŝƌƐĂŶĚƵŶǁĞůĐŽŵĞĚŝƐƌƵƉƟŽŶĞƐƉĞĐŝĂůůLJǁŚĞƌĞĂ ůĂƌŐĞŽĸĐĞďůŽĐŬŚŽƐƉŝƚĂůŽƌĚŝƐƚƌŝĐƚŚĞĂƟŶŐƐĐŚĞŵĞŝƐĐŽŶĐĞƌŶĞĚtŚĞŶ ĨĂŝůƵƌĞƐ ŽĐĐƵƌ ŝŶ ƚŚĞ ůŽǁ ƚĞŵƉĞƌĂƚƵƌĞ ŚŽƚ ǁĂƚĞƌ;>d,tͿ Žƌ ĐŚŝůůĞĚǁĂƚĞƌ ;,tͿ ƐLJƐƚĞŵƐ ƚŚĞ ƚĞŶĚĞŶĐLJ ŝƐ ƚŽŝŶǀĞƐƟŐĂƚĞ ƚŚĞ ĨĂŝůĞĚ ĐŽŵƉŽŶĞŶƚ ĂŶĚ ƉŽƐƐŝďůLJ ŵƵĐŚ ůĂƚĞƌƚŽ ĐĂůů ŝŶ ƐƉĞĐŝĂůŝƐƚ ĐŽƌƌŽƐŝŽŶ ĐŽŶƐƵůƚĂŶƚƐ ;ƐƵĐŚ ĂƐDŝĚůĂŶĚŽƌƌŽƐŝŽŶ ^ĞƌǀŝĐĞƐͿ ƚŽ ĮŶĚ ƚŚĞ ƌŽŽƚ ĐĂƵƐĞ ŽĨ ƚŚĞ ƉƌŽďůĞŵĂŶĚ ƌĞĐŽŵŵĞŶĚ Ă ƐŽůƵƟŽŶ dŚĂƚ ŝƐ ĂůůǁĞůů ĂŶĚ ŐŽŽĚ ďƵƚŝƚ ŝƐ Ă ďŝƚ ůŝŬĞ ĐůŽƐŝŶŐ ƚŚĞ ƐƚĂďůĞ ĚŽŽƌ ĂŌĞƌ ƚŚĞ ŚŽƌƐĞ ŚĂƐďŽůƚĞĚ ĞƐƉĞĐŝĂůůLJ ǁŚĞŶ ŽŶĞ ĐŽŶƐŝĚĞƌƐ ƚŚĂƚ ƚŚĞ ƉƌŽďůĞŵƐĐŽƵůĚŚĂǀĞďĞĞŶƉƌĞĚŝĐƚĞĚĂŶĚ ƚŚĞƌĞĨŽƌĞĂǀŽŝĚĞĚ ŝĨƉƌŽƉĞƌŵĞĂƐƵƌĞŵĞŶƚƐŽĨŬĞLJƉĂƌĂŵĞƚĞƌƐŚĂĚďĞĞŶŵĂĚĞĨƌŽŵƚŚĞƉŽŝŶƚŽĨŝŶƐƚĂůůĂƟŽŶĂŶĚĐŽŵŵŝƐƐŝŽŶŝŶŐ

KŶĞŽĨƚŚĞďĂƐŝĐƉƌŽďůĞŵƐŚĂƐďĞĞŶƚŚĂƚďƵŝůĚŝŶŐŵĂŝŶƚĞŶĂŶĐĞ ĨĂĐŝůŝƟĞƐŵĂŶĂŐĞŵĞŶƚ ĐŽŵƉĂŶŝĞƐ ŚĂǀĞ ƌĞůŝĞĚ ŽŶ ƉĞƌŝŽĚŝĐǁĂƚĞƌƐĂŵƉůŝŶŐƚŽĐŚĞĐŬŽŶƚŚĞŚĞĂůƚŚŽĨƚŚĞƐLJƐƚĞŵƐEŽƚŽŶůLJĚŽĞƐƚŚŝƐŽŶůLJŐŝǀĞĂƉĂƌƟĂůƉŝĐƚƵƌĞ;ǁĂƚĞƌĐŽŵƉŽƐŝƟŽŶŝƐŽŶůLJŽŶĞĂƐƉĞĐƚƚŚĂƚŶĞĞĚƐƚŽďĞĐŽŶƐŝĚĞƌĞĚͿŝƚŝƐĂƐŶĂƉƐŚŽƚǀŝĞǁƚĂŬĞŶĂƚďĞƐƚŽŶĐĞƉĞƌŵŽŶƚŚ dŚĞ ŝŶĚƵƐƚƌLJŚĂƐďĞĞŶ ƐůŽǁ ƚŽ ƐĞŝnjĞ ŽŶ ƚŚĞ ŽƉƉŽƌƚƵŶŝƚLJ ƚŚĂƚ ĐŽŶƟŶƵŽƵƐŵŽŶŝƚŽƌŝŶŐƉƌĞƐĞŶƚƐŶĂŵĞůLJŵŽŶŝƚŽƌŝŶŐĂŶĚƌĞĐŽƌĚŝŶŐŽĨĂůůŬĞLJƉĂƌĂŵĞƚĞƌƐϮϰdžϳ

LJƵƐŝŶŐĂĐŽŵďŝŶĂƟŽŶŽĨŚŝŐŚƋƵĂůŝƚLJ ƌĞůŝĂďůĞƐĞŶƐŽƌƐĂŶĚĚĂƚĂůŽŐŐĞƌƐĂůůƚŚĞŬĞLJŝŶĚŝĐĂƚŽƌƐŽĨƐLJƐƚĞŵƉƌŽďůĞŵƐĐĂŶŶŽǁďĞĐŽŶƟŶƵŽƵƐůLJŵŽŶŝƚŽƌĞĚƌĞŵŽƚĞůLJĨƌŽŵD^ ƐŵĂŝŶŽĸĐĞǁŝƚŚ ĂůĂƌŵƐ ƐĞƚ ŝĨ ĐƌŝƟĐĂů ůĞǀĞůƐ ĂƌĞ ĞdžĐĞĞĚĞĚ /Ŷ ĂĚĚŝƟŽŶD^ĂƌĞĂďůĞƉƌŽǀŝĚĞƌĞŐƵůĂƌƌĞƉŽƌƚƐŽŶƚŚĞŚĞĂůƚŚŽĨLJŽƵƌŚĞĂƟŶŐŽƌĐŚŝůůĞĚǁĂƚĞƌƐLJƐƚĞŵƐĂŶĚƌĞĐŽŵŵĞŶĚĂĐƟŽŶƐŝĨŶĞĐĞƐƐĂƌLJWĂƌĂŵĞƚĞƌƐƚŚĂƚĐĂŶďĞŵŽŶŝƚŽƌĞĚŝŶĐůƵĚĞ

/ŶƚĞƌƉƌĞƚĂƟŽŶŽĨ ƚŚĞĚĂƚĂ ŝƐ ƉĂƌĂŵŽƵŶƚ ŝĨ ƉƌŽƉĞƌĚŝĂŐŶŽƐŝƐŝƐƚŽďĞŵĂĚĞĂŶĚĞdžƉĞƌŝĞŶĐĞĚĐŽƌƌŽƐŝŽŶĐŽŶƐƵůƚĂŶĐŝĞƐƐƵĐŚĂƐD^ĂƌĞǁĞůůƉůĂĐĞĚƚŽŽīĞƌĂĨƵůůLJŵĂŶĂŐĞĚĐŽŶƟŶƵŽƵƐŵŽŶŝƚŽƌŝŶŐĐŽƌƌŽƐŝŽŶƐĞƌǀŝĐĞ

&Žƌ ŵŽƌĞ ĚĞƚĂŝůƐ ĐŽŶƚĂĐƚ ^ƚĞǀĞ DƵŶŶ Ăƚ DŝĚůĂŶĚCorrosion Services on 01629 733162 Žƌ ĞŵĂŝů [email protected]

DŝĚůĂŶĚŽƌƌŽƐŝŽŶ^ĞƌǀŝĐĞƐ>ƚĚ^ƚĂŶĐůŝīĞ,ŽƵƐĞtŚŝƚǁŽƌƚŚZŽĂĚĂƌůĞLJĂůĞĞƌďLJƐŚŝƌĞh<ϰϮ,:ǁǁǁŵŝĚůĂŶĚĐŽƌƌŽƐŝŽŶĐŽƵŬ

ZĞŵŽƚĞDŽŶŝƚŽƌŝŶŐWŽŝŶƚƐdŚĞtĂLJdŽŽƌƌŽƐŝŽŶWƌĞǀĞŶƟŽŶ

WĂƌĂŵĞƚĞƌ ŽŵŵĞŶƚŝƐƐŽůǀĞĚŽdžLJŐĞŶ ǀĞŶŵŽĚĞƌĂƚĞůĞǀĞůƐĐĂŶŐŝǀĞƌŝƐĞƚŽĐŽƌƌŽƐŝŽŶ

ŽĨŵĞƚĂůƐWƌĞƐƐƵƌĞ WŽƐŝƚŝǀĞƉƌĞƐƐƵƌĞƐŶĞĞĚƚŽďĞŵĂŝŶƚĂŝŶĞĚĂƚĂůů

ƚŝŵĞƐƚŚƌŽƵŐŚŽƵƚƚŚĞƐLJƐƚĞŵƚŽƉƌĞǀĞŶƚĂŝƌĞŶƚĞƌŝŶŐƚŚĞƐLJƐƚĞŵ

DĂŬĞͲƵƉǁĂƚĞƌŝŶƚĂŬĞ &ůŽǁŽŶƚŚĞŵĂŬĞͲƵƉůŝŶĞŵĂLJďĞŝŶĚŝĐĂƚŝǀĞŽĨĂůĞĂŬŝŶƚŚĞƐLJƐƚĞŵ

ŽŶĚƵĐƚŝǀŝƚLJ ĐŚĂŶŐĞŝŶĐŽŶĚƵĐƚŝǀŝƚLJƐƵŐŐĞƐƚƐƚŚĂƚŝŶŚŝďŝƚŽƌůĞǀĞůƐĂƌĞŶŽƚďĞŝŶŐŵĂŝŶƚĂŝŶĞĚ

'ĂůǀĂŶŝĐĐƵƌƌĞŶƚ dŚŝƐŐŝǀĞƐĂŐŽŽĚŝŶĚŝĐĂƚŝŽŶŽĨŐĞŶĞƌĂůĐŽƌƌŽƐŝŽŶƌĂƚĞƐŽĨƐƚĞĞů

ƌĞǀŝĐĞĐŽƌƌŽƐŝŽŶŵŽŶŝƚŽƌ;ƉĂƚĞŶƚƉĞŶĚŝŶŐͿ dŚŝƐŐŝǀĞƐĂŐŽŽĚŝŶĚŝĐĂƚŝŽŶŽĨůŽĐĂůŝƐĞĚĐŽƌƌŽƐŝŽŶƌĂƚĞƐĞƐƉŝŶĐƌĞǀŝĐĞƐĂŶĚƵŶĚĞƌĚĞďƌŝƐ

dĞŵƉĞƌĂƚƵƌĞ ĂŶĐŚĞĐŬƚŚĂƚŚĞĂƚĞĚǁĂƚĞƌŝƐĐŝƌĐƵůĂƚŝŶŐĂƐƌĞƋƵŝƌĞĚ

ϬϬϬ

ϭϬϬϬ

ϮϬϬϬ

ϯϬϬϬ

ϰϬϬϬ

ϱϬϬϬ

ϲϬϬϬ

ϳϬϬϬ

ϴϬϬϬ

ϵϬϬϬ

ϭϬϬϬϬ

ϬϬ

ϮϬϬϬ

ϰϬϬϬ

ϲϬϬϬ

ϴϬϬϬ

ϭϬϬϬϬ

ϭϮϬϬϬ

ϭϰϬϬϬ

ϬϬϬ ϱϬϬϬ ϭϬϬϬϬ ϭϱϬϬϬ ϮϬϬϬϬ ϮϱϬϬϬ ϯϬϬϬϬ ϯϱϬϬϬ ϰϬϬϬϬ ϰϱϬϬϬ ϱϬϬϬϬ

ŽŶĚ

ƵĐƚŝǀ

ŝƚLJ;Ƶ

^Đŵ

Ϳ

,ŽƵƌƐ

^ĞŶƐŽƌZĞƐƉŽŶƐĞƚŽŚĂŶŐŝŶŐŽŶĚŝƚŝŽŶƐŝŶ>d,t^LJƐƚĞŵ

ŽŶĚƵĐƚŝǀŝƚLJ;ƚĞŵƉĐŽŵƉͿ

'ĂůǀĂŶŝĐƵƌƌĞŶƚ;ŵͿ

dĞŵƉĞƌĂƚƵƌĞ;ĚĞŐͿ

ŝƐƐŽůǀĞĚKdžLJŐĞŶ;йKͿ

>d,tZŝŐƚĞƐƚͲ^ĞƉƚϭϮ^ƚĂƌƚŝŶŐ^ŽůƵƚŝŽŶϬϱй&ĞƌŶŽdž&ϭ

>ĞĂŬŝŶƚƌŽĚƵĐĞĚƌŝŐƌĞƉůĞŶŝƐŚĞĚǁŝƚŚϬϱй&ϭ

ĂŝƌďůĞĚŝŶƚŽƐLJƐƚĞŵ

>ĞĂŬŝŶƚƌŽĚƵĐĞĚƌŝŐƌĞƉůĞŶŝƐŚĞĚǁŝƚŚĂĞƌĂƚĞĚǁĂƚĞƌ

ƌĞǀŝĐĞĐŽƌƌŽƐŝŽŶĚĞƚĞĐƚĞĚ

ƚLJƉŝĐĂůƉůĂŶƚƌŽŽŵŝŶĂůĂƌŐĞďƵŝůĚŝŶŐ

EĞǁƉƌĞƐƟŐŝŽƵƐďƵŝůĚŝŶŐǁŝƚŚ>d,tΘ,tƐLJƐƚĞŵƐ

PECM113.indd 38 23/02/2013 15:40:09

Page 39: PECM - Issue 2 2013

Diagnostics beforeDamage

PECM113.indd 39 23/02/2013 15:40:12

Page 40: PECM - Issue 2 2013

40 PECM January-March 2013

Fluid HandlingNOV® MONO® Helps Solve Theme Park ProblemA Series ‘A’ Muncher® from NOV® Mono® has helped resolve a sewage handling problem at one of the UK’s most popular theme parks. The unit has been installed at the Drayton Manor Park Hotel at Tamworth in Staffordshire, to macerate sewage from the hotel’s 150 rooms before it reaches the pumps which transfer it to the main sewer.

It can be installed into an existing concrete channel or in a fabricated frame, complete with guide rails, into an existing submersible pump station as a VLPSOHDQGTXLFNUHWUR¿W(DFK0XQFKHULVVXSSOLHGZLWKDSURJUDPPDEOHlogic controller to protect the machine against damage and overloading.

For more details visit www.mono-pumps.comor call +44 (0)161 339 9000

NOV® MONO® Invites Distributors to Share in its M RANGE pump SuccessFollowing the recent successful launch of its popular M Range of ‘mini’ progressing cavity (PC) pumps onto the European market, NOV® Mono® is now inviting applications from companies operating in France who wish to become stockists and resellers for the product.

“The response we received to the launch has been extremely encouraging, particularly from the French market, so we are now looking to strengthen our distribution network and increase the number of M Range outlets we have in France,” explains NOV Mono Key Account Manager, Ian Davies. The Mono M Range includes a variety of highly versatile, general purpose, small-to-medium sized capacity PC pumps, which offer an ideal off-the-shelf solution for a wide range of both domestic and industrial uses.

Interested parties should contact Gabriel Kieser, T: +33 (0)3 29 94 26 88 Email: [email protected]

PECM113.indd 40 23/02/2013 15:40:18

Page 41: PECM - Issue 2 2013

January-March 2013 PECM 41

Fluid Handling

Health & Safety

AOD® (air operated diaphragm) pumps DUHDYDLODEOHLQVL]HVWRKDQGOHÀRZrates from a few cc/min to 52m3/hour. Selection of this type design is important for maximum performance and minimum maintenance.

Optimum pump selection is now possible with the PSI computer selection program available over the Internet.

7KHFRPSXWHUSURJUDPVWDUWVZLWKWKHÀRZUDWHVKHDGVYLVFRVLW\DQGÀXLGLWVHOI$IWHUHQWU\YDULRXVPRGHOVDUHGLVSOD\HGWRPHHWWKHLQVHUWHGVSHFL¿FDWLRQV2QHPRUHFOLFNDQGWKHFXUYHVDUHSUHVHQWHGfor the respective offered models. This allows the comparison of various sizes to meet the application needs.

Full details from [email protected] www.ese.tc

AOD® pumps computerselection advantage

Whisper Vane Pumps For Extreme DutyThe design of this range of vane pumps has been widely used in prelube pump systems for lubrication of large engines prior to startup. Xd has now moved the pumps into extreme service applications, available with either dc or ac powered motors .

Xd 4 pump is a 12/24 vdc powered vane pump to 15 l/min and 4 bar pressure rating. Xd4 is a continous duty design built for industrial and marine systems. Performance has been proven in a wide range of transfer applications, where extreme temperatures , both high and low ,are a system requirement.

:LWKWKHOPLQÀRZUDWHWKHSXPSLVVHOISULPLQJTXLHWUXQQLQJwith a permanent dc motor providing long life service.

Full details from [email protected] www.ese.tc

Deb’s Global Range; Universally Understood

Every day, every single employee is faced with a choice as to whether they use a skin care product or not. We take a look at how the Deb Global Product Range has provided a simple, yet cost-effective solution to help employers and employees make the right choice.

With an approach to Product Development that focuses on both Chemistry & Dispensing Technology, the Deb Global Product Range was created to PHHW WKH VSHFL¿F VNLQ VDIHW\needs and cultural diversity of both local and international organisations; showcasing Deb’s latest technologies, providing ‘best in class’ formulations and rigorously engineered dispensing systems.

With Deb’s Product Development philosophy being to design SURGXFWV ZKLFK DUH LQQRYDWLYH ¿W IRU SXUSRVH SOHDVDQW WRuse; convenient; cost effective and tested to the highest internationally recognised protocols, the Global Product Range is a simple skin care solution that meets the universal needs of employees and visitors alike.

So, when your employees are faced with the choice as to whether they use a skin care product, help them to make the ULJKWGHFLVLRQE\SURYLGLQJ'HE¶VVLPSOHVROXWLRQ

Tel: +44 (0)1773 855134 www.debgroup.com

The new Snickers Product and Price Catalogue is now available with loads of new garments and accessories for working effectively wherever you are on site – whatever your trade.

The proof of Snickers’ quality and innovation can be seen in every garment – the sign of a company that knows what it takes to get the job done.

Whatever the task, whatever the season, the Snickers Workwear System provides the ultimate solution to make every man and woman’s workday easier and safer. So get to know the cutting-edge range from Snickers Workwear…in every stitch, it’s miles better.

To get this FREE Catalogue, call the Snickers Helpline on 01484 854788.

This full colour brochure is now available FREE to discerning professional tradesmen and women.

Snickers New Product And Price List Catalogue

www.snickersworkwear.com

PECM113.indd 41 23/02/2013 15:40:39

Page 42: PECM - Issue 2 2013

A range of personal protective equipment supplied by Arco, the UK’s leading safety company, was put to the XOWLPDWHWHVWWKLVZHHNDWWKH¿UVW¿ULQJRIWKHXQLTXHhybrid rocket system that will be used to power the BLOODHOUND supersonic car in its challenge for the world land speed record.

The test took place at the Aerohub, Newquay in Cornwall and was streamed live over the web. The rocket burned for 10 seconds, generating 14,000lbs of thrust with sound levels at the rocket nozzle reaching 185dB, many times that of a Boeing 747 during takeoff. Bloodhound’s engineers are now reviewing the GDWDIURPWKHH[SHULPHQWHQRXJKWR¿OODWHOHSKRQHdirectory, to further develop the system, leading up to a planned challenge for the world land speed record on the Hakskeen Pan in South Africa in 2013.

The team also used the event to practice the safety protocols and rocket handling procedures developed by R.I.S. and the Falcon Project Ltd that are necessary in order to maintain a 100% safety record. The BLOODHOUND team has partnered with Arco to provide expert advice and guidance on the correct PPE required to keep the engineers and designers safe during the build and testing process.

Daniel Jubb, the 28-year old rocketeer who designed the BLOODHOUND rocket system and his colleagues were fully protected by Arco for this week’s test event. Working in this high-risk environment with FRUURVLYHDQGKLJKO\R[LGLVLQJFKHPLFDOV¿UHDQGKHDWa real hazard, R.I.S. & the Falcon Project Ltd’s risk assessment showed the engineers were required to be equipped with Chemsol Plus coveralls with chemical SURWHFWLRQÀDPHUHWDUGDQF\DQGDQWLVWDWLFSURSHUWLHVand Chemmaster protective headgear. For hand

protection, Arco supplied pairs of Marigold Emperor Gauntlet gloves that are acid and alkali resistant and their feet were protected with Workmaster Hazmax safety wellingtons that are anti-static, slip resistant and have chemical protection.

'DQLHO -XEEVDLG ³7KH URFNHW¿ULQJDW1HZTXD\ WKLVweek was a major milestone in the BLOODHOUND project. It’s the culmination of years of hard work and dedication by the team and we hope this goes some way to inspiring young people in the excitement of science and engineering. However, this type of experiment is high risk and we need to be sure that the BLOODHOUND teams are kept safe as we work towards our goal of beating the world land speed record.

“We are relying on Arco to provide us with world class products that will protect us from any possible danger and its developing into a very effective partnership. Arco experts are on hand to advise and guide us on the correct protective equipment we need for each step of the journey, so that we can concentrate on running the ZRUOG¶VODUJHVWHQJLQHHULQJDGYHQWXUH´

Thomas Martin, Arco’s Joint Managing Director, said: “We are delighted to be working with the BLOODHOUND team to provide the personal protective equipment they need to keep safe in the lead up to the record challenge. We are also encouraging young people to become excited about engineering and science through the BLOODHOUND Ambassador programme. Over 40 Arco Ambassadors have been visiting schools across the UK and holding sessions developed to engage youngsters in a fun and exciting way. In fact the whole company has got behind this project and we are proud to say that we have provided the most number of Ambassadors to the programme.”

Arco Helps Keep Rocket Men Safe At Bloodhound Test

www.arco.co.uk

PECM113.indd 42 23/02/2013 15:40:44

Page 43: PECM - Issue 2 2013

January-March 2013 PECM 43

Hydraulics & Pneumatics

Following a very successful entry into the marketplace over the last 18 months, which has seen Torishima (Europe) Projects Ltd develop a sector-leading position in the turnkey delivery of steam and hot water energy systems, the Wiltshire-based company is pleased to announce a number of strategic acquisitions.

As well as having a strong reputation within their sector, MGR Fluid Power Ltd will bring excellence in providing hydraulics and lubrication solutions required by Torishima’s core pump manufacturing business across the globe.

MGR Managing Director and Founder, Mike Retford,

commented: “It’s a pleasure to be teaming up with a global solutions provider and it is a feather in the cap for British manufacturing that work previously undertaken in the Far East is now coming to the heart of the UK.”

ICI Caldaie UK Ltd has also become a member of the Torishima Group, which will further enhance the group turnover of $630 million. Having worked closely with the leading boiler manufacturer for a number of years, it was a logical step to formally bring the two companies together to further improve both Torishima and ICI Caldaie’s offering to the marketplace in terms of competiveness, innovation and service support.

Previously based in the North West of England, ICI Caldaie UK is in the process of relocating its operation to Torishima’s new Centre of Excellence in Westbury, Wiltshire.

Torishima announces a number of strategic acquisitions.

MGR’s Preventative Maintenance Service keeps expensive oil changes in hydraulic and lubrication systems to a minimum.

REDUCEdowntime // costly repairs // emergency call outs

Save money without any compromise on equipment reliability

Time for a change..? Time to call MGR on 01926-420847

KEEP YOUR BUSINESS RUNNING

SMOOTHLY

www.mgrfluidpower.co.uk

HYDRAULIC SYSTEMS O LUBRICATION SYSTEMS O HYDRAULIC SERVICES

PECM113.indd 43 23/02/2013 15:55:19

Page 44: PECM - Issue 2 2013

44 PECM January-March 2013

Machining

Hodge Clemco has sold two specially adapted ,%,; EODVW PDFKLQHV WR FHUHDO JLDQW .HOORJJ¶Vto help improve the convenience and speed of PDLQWHQDQFHRSHUDWLRQVRQLWVFRUQÀDNHVRYHQV

The nine ovens in the Manchester factory --- the biggest specialist cereals production unit in the world – are shut for maintenance every four weeks in order to ensure product quality and reliable operation. Each oven typically toasts a tonne of cereal an hour at about 300ºC by passing it continuously through a tunnel of perforated steel.

Part of the maintenance procedure involves deep-cleaning the inside of the ovens, which measure some eight metres long x two metres high, to remove residue and small particles.

The IBIX machines are much easier to use than Kellogg’s previous method, and the sodium bicarbonate abrasive DXWRPDWLFDOO\ ÀDVKHV RII ZKHQ WKH RYHQV DUH KHDWHGBecause of their compact size and light weight, operators can easily move the machines into position, and the blast and air control hoses are also light and convenient. Air pressure can be adjusted from 0.2 to 7 bar to control abrasive output, and the nozzle is a comfortable pistol-style component with safety button.

The IBIX machines have been specially designed to HQVXUHJRRGPDWHULDOÀRZIRU WKHVRGLXPELFDUERQDWHand two moisture traps and a non-return valve to protect

WKH¿OWHUKDYHEHHQLQFOXGHG&OHDQLQJHDFKRYHQQRZtakes about 45 minutes, which is half the time with the previous system.

Tel: 0114 254 8811 Fax: 0114 254 0250E-mail: [email protected]: www.hodgeclemco.co.uk

Blast Machines Help To Keep The Corn Flakes Perfect

HARDINGEMANUAL REBUILDS

Contact ZMT ! e UKsNo1 Hardinge Recommended

Rebuild Specialists

Tel/Fax: 01626 830090Email: [email protected]

Web: www.zmtservices.co.uk

PECM113.indd 44 23/02/2013 15:40:55

Page 45: PECM - Issue 2 2013

January-March 2013 PECM 45 January-March 2013 PECM 45

0RUHDQGPRUHFRPSDQLHVDUHVHHLQJWKHEHQH¿WVRIlaser engraved control panels and labels, according to laser cutting and engraving specialist Cutting Technologies.

Based in Barnsley, South Yorkshire, the Cutting Technologies team is reporting an increase in demand for laser engraving on items such as control panels DQG LGHQWL¿FDWLRQ SODWHV /DVHU HQJUDYLQJ ZRUNV E\using lasers to burn a mark into the surface of the steel which turns it black.

&OLHQWVEHQH¿WWLQJIURP&XWWLQJ7HFKQRORJLHV¶HQJUDYLQJH[SHUWLVHLQFOXGH&KHVWHU¿HOG6SHFLDO&\OLQGHUVDZRUOGleading designer and manufacturer of engineering solutions for high pressure gas containment markets. The company commissioned Cutting Technologies to engrave name plates for offshore application.

Jane Robinson, Director and co-founder at Cutting Technologies, explained the advantages of laser engraving over traditional printing: “Laser engraving leaves a completely indelible mark that can withstand the harshest of environments making it suitable for a huge range of engineering applications. It’s legible even when the text or design is very small and we can programme our lasers to engrave any characters, graphic or logo.”

“As we offer traditional laser cutting services too, our FOLHQWVHQMR\WKHDGGHGEHQH¿WRIKDYLQJFRPSRQHQWVcut and engraved in one place, making the process VLPSOHPRUHHI¿FLHQWDQGPRUHFRVWHIIHFWLYH:H¶UHdelighted that more and more of our customers are seeing the value in laser engraving and incorporating it into their processes and designs.”

Cutting Technologies opened in 2003 and now employs 30 people at its 18,000 sq ft premises in Barnsley. Formed by people who had been involved in laser processing, materials science and engineering for around 20 years, Cutting Technologies now has six lasers ranging from a small machine used for engraving metal parts to a 4.4kw machine with all the capability to cut incredible detail in metal.

With over £2 million invested in technology, Cutting Technologies offers the best range of laser cutting and laser engraving services in the UK. Few, if any, laser specialists have Cutting Technologies’ capacity to cut a 3000mm x 1500mm sheet of stainless steel and then engrave across the whole surface.

Laser Engraving Gives Manufacturers the Edge

www.cut-tec.co.ukwww.cut-tec.co.ukwww.cut-tec.co.uk

Manufacturers the Edge

PECM113.indd 45 23/02/2013 15:41:18

Page 46: PECM - Issue 2 2013

Heason Technology has completed the integration of a vertical positioning system for a CT scanner used for geological studies at the Department

of Chemical Engineering at Imperial College London. The CT scanner is the centrepiece of the new Qatar Carbonates and Carbon Storage Research Centre (QCCSRC) - a $70 million, 10 year programme in conjunction with sponsors Qatar Petroleum, Shell and the Qatar Science and Technology Park to improve the understanding and development of the storage of CO2 in carbonate reservoirs to help mitigate climate change. The QCCSRC is a multi-scale imaging facility that evaluates the characteristics of various core rock samples combined with high temperature and high pressures in specially prepared capsules which can be up to 100kg in weight and 1000mm in length.

The Universal Systems CT Scanner has a horizontal positioning table which is used to present smaller core rock samples into the machine. To accommodate the larger capsules, and remove the effects of load overhang for the precision measurement required, the CT scanner is rotated through 90 degrees and samples are introduced vertically. For this part of the machine Heason supplied a motorised heavy load hoist mechanism and a large fabricated steel gantry which houses a vertical two-stage positioning table. The complete solution included a motion and machine control system together with relevant safety relays/interlocks for safe operation. The vertical positioning axis control interfaces seamlessly with the existing CT scanner controller via a LabView programmed GUI operator control interface located on the gantry platform as part of the electrical enclosure.

The custom-built vertical positioning mechanics form a two-part telescopic vertical stage. A manually adjusted and lockable axis is used for approximate sample SRVLWLRQLQJDLGHGE\WKHRYHUKHDGKRLVW)RU¿QDOKLJKprecision sample positioning the second axis comprises a servo driven Thomson M75 Movopart linear actuator ¿WWHGZLWKDKLJKUHVROXWLRQOLQHDURSWLFDOHQFRGHU%RWK

axes utilise linear guide bearing support for maximum stiffness and rigidity.

Jon Howard, Heason Technology’s Managing Director comments, “From a design perspective this was a very challenging and varied application due to the number of elements within the system – and with the space constraints of the laboratory, which is located in one of WKHROGHUEXLOGLQJVRQWKHFDPSXVLQFHQWUDO/RQGRQthe solution need to be extremely compact. The project allowed Heason Technology to demonstrate its diverse set of skills from designing the custom steel gantry framework and actuator to installing & programming WKH¿QLVKHGV\VWHP´

Dr Sam Krevor, the principle scientist for the CT scanner project at QCCSRC, worked closely with Heason Technology engineers throughout the design and installation of the gantry system and was more than pleased with the service and support he received. “Heason Technology took the design brief and was able to competitively manage the complete gantry and high precision positioning system as a single source supplier. This was important as we only needed to deal with one company which made the process easier and faster for us. The design, manufacture and installation ZRUNZDVFDUULHGRXWTXLFNO\DQGHI¿FLHQWO\DQGWKHseamless integration with our CT scanner control system has been particularly effective.”

Heason Technology worked in conjunction with a number of contractors involved in the build at the QCCSRC laboratory to ensure that all requirements were met and timescales adhered to. The Company works closely with a selected number of global distribution partners for motion control components and systems; and through its own in-house design and assembly service offers custom-built motion system solutions that help customers across manufacturing and research to excel in their own technologies, with the advanced positioning performance they require.

Heason Technology supply custom motion system for CT scanner sample manipulator at the

Imperial College QCCSRC Imaging Laboratory

7HO(PDLOMKRZDUG#KHDVRQFRPZZZKHDVRQFRP

PECM113.indd 46 23/02/2013 15:41:23

Page 47: PECM - Issue 2 2013

The Hiden IG20 high-brightness gas ion gun is further enhanced by the introduction of a new beam optic DQGLRQVRXUFHFRQ¿JXUDWLRQWRHQDEOHERWKLQFUHDVHGbeam brightness AND beam contrast, together with a VLJQL¿FDQWUHGXFWLRQLQXOWLPDWHVSRWVL]H

With a raster scanning area of 4x4mm the IG20 LV HTXDOO\ VXLWHG WR GHSWK SUR¿OLQJ DQG WR VXUIDFHimaging applications, and is the preferred gas ion gun for secondary ion and secondary neutral mass spectrometry, for Auger and for XPS. Parameter selection and gun operation are fully under PC control, and the gun is operable with both oxygen and with inert gas primary sources.

Two interchangeable ion sources are available for RSHUDWLRQ ZLWK WKH VDPH EHDP RSWLF FRQ¿JXUDWLRQOne is optimised for general analysis with maximum brightness and a beam current of 800nA, one is RSWLPLVHG IRU KLJK G\QDPLF UDQJH GHSWK SUR¿OLQJapplications with minimised beam scatter and supporting a beam current of 200nA within a beam diameter of just 80 micron.

The IG20 ion gun is differentially pumped and includes full raster scanning, incorporation of a neutrals dump, '1&)LQFKGLDPHWHU&RQÀDWW\SHPRXQWLQJÀDQJHDQGVLPSOHUHSODFHPHQWRIWKHLRQVRXUFH\WWULDFRDWHG LULGLXP WZLQ¿ODPHQW &RPSDQLRQ SURGXFWVinclude the IG-5C metal ion gun with caesium source

and a choice of quadrupole SIMS detectors

For further information on this or other Hiden products please contact Hiden Analytical at [email protected] or visit the main website at www.HidenAnalytical.com.

O2/Ar Ion Gun Spots the Difference

PECM113.indd 47 23/02/2013 15:41:25

Page 48: PECM - Issue 2 2013

48 PECM January-March 2013

Measurement & Monitoring

CONNECTS for the Paperless LabCONNECTS for the Paperless Lab is a combined methodology, technology and services offering that transforms laboratories into tightly integrated paperless environments.ł*HWUHDOWLPHDFFHVVWRLQIRUPDWLRQł,PSURYHUHJXODWRU\FRPSOLDQFHDQGGDWDLQWHJULW\ł$XWRPDWHSURFHVVHVDQGUHGXFHPDQXDOGDWDKDQGOLQJCONNECTS for the Paperless Lab leverages existing investments in software systems, databases and laboratory instrumentation from a wide variety of commercial vendors. By bridging the islands of data generated in the lab and transforming that data into information that can be used across the enterprise, RUJDQL]DWLRQVZLOOUHDSWKHEHQH¿WVRILPSURYHGDFFHVVWRUHDOWLPHLQIRUPDWLRQregulatory compliance, data integrity, as well as time and cost savings by automating processes and reducing manual data handling.For more information, visit ZZZWKHUPRVFLHQWL¿FFRPSDSHUOHVVODE

New-format Fluke VT02 Visual Infrared Thermometer fills the gap between thermometers and thermal imagers

Fluke, the global leader in portable electronic test and measurement technology, has introduced the Fluke® VT02 Visual IR Thermometer, a troubleshooting tool with an infrared heat map. Until now, electricians and industrial, HVAC and automotive technicians have had to choose between single-point infrared thermometers and high-resolution thermal imagers (infrared or “IR” cameras). 7KH )OXNH 97 9LVXDO ,5 7KHUPRPHWHU ¿OOV WKH JDS IRU ZKHQ Dsingle-spot temperature reading is not enough and a high-resolution thermal image is more than users need. ZZZÀXNHFRXN

6,/5$7(',167580(17$7,217\SLFDOO\6,/

6,1*/($1''8$//(9(/75,3$03/,),(560$,16$1''&32:(5('

/HH'LFNHQV/WG5XVKWRQ5RDG'HVERURXJK.HWWHULQJ1RUWKDQWV114:7HO)D[VDOHV#OHHGLFNHQVFRXNZZZOHHGLFNHQVEL]

ZZZOHHGLFNHQVEL]

&$//7+((;3(576&'520&DWDORJXH$YDLODEOHRQ5HTXHVW

LEE-DICKENS LTD.

PECM113.indd 48 23/02/2013 15:41:28

Page 49: PECM - Issue 2 2013

January-March 2013 PECM 49

Sensor-Technik UK is the UK and Ireland representative of the Wiedemann Group, the sister company alongside Sensor-Technik Wiedemann GmbH in Germany and STW-Technic LP in the USA. Sensor-Technik Wiedemann is one of the foremost pressure sensor manufacturers and suppliers in Europe. Since 2001, our primary activity has been the promotion, distribution and integration of control and measurement solutions utilising hardware manufactured by Sensor-Technik Wiedemann GmbH. Sensor-Technik UK is also a distributor and integrator for a number of other companies including Wachendorff GmbH, Graf-Syteco GmbH and F.W. Murphy Limited.

Here at Sensor-Technik UK, we take great pride in our ability to develop comprehensive electronic control V\VWHPVWKDWDUHWDLORUHGWRVXLWHDFKFXVWRPHU¶VVSHFL¿Fneeds. Our controllers can be integrated into a CAN-bus network, relaying and receiving thousands of data packets every day.

One of the types of control system that we can provide is teleservice (telemetry), thus allowing complete systems WREHPRQLWRUHGUHPRWHO\7KHFKLHIEHQH¿WRIWHOHVHUYLFHis that machine problems are detected early and timely restorative action can avoid expensive repairs.

Sensor-Technik are also able to provide HMI panels to provide direct feedback and control for any system. The range of programmable, graphical interfaces can be FXVWRPGHVLJQHGWR¿W\RXUUHTXLUHPHQWVZLWKIHDWXUHVsuch as video, ethernet and touchscreen all available.

We also design and manufacture bespoke wiring looms DQGWKHVHFDQEH LQFRUSRUDWHG LQWRWKH¿QLVKHGFRQWUROsystems. Once assembled, each loom is tested to ensure that it functions as intended before it is released to the customer. If required, our engineers can then undertake the on-site installation of the full system.

The pressure sensors that we supply conform to exacting quality standards and have proven to be extremely durable and robust and are ultimately very reliable.

Similarly to our electronic controllers, we have a variety RIVHQVRUVWKDWZHSURGXFHHDFKZLWKGLIIHUHQWSUR¿OHVDQG VSHFL¿FDWLRQV 6HQVRU7HFKQLN VHQVRUV KDYH EHHQutilised in pneumatic, hydraulic and marine applications.

Customers have the freedom to specify important variables, such as electrical connection, output signal (voltage, current CANopen or J1939). The sensors we supply can measure up to a range of 3,000 bar and a temperature range of -25 degrees to 200 degrees Celsius.

Sensor-Technik UK’s range of controllers, sensors and HMI’s and all the associated engineering services make it a ‘one-stop shop‘ for your control, measurement and instrumentation needs, using industry leading technology and expertise to enhance system functionality and capability. Sensor-Technik UK’s team has over 50 years combined experience in control and measurement LQWHJUDWLRQ DQG ZH ¿UPO\ EHOLHYH ZH RIIHU WKH PRVWpractical service and solution for your application. From project management, software, hardware design and build, through to full wiring harness design prototype and series production, Sensor-Technik UK can take care of all your control and measurement requirements.

Contact us to discuss your requirements today.T: 01234 270770F: 01234 348803E: [email protected]: www.sensor-technik.co.uk

Your Ideas. Realised

ESX®-Range

Mobile Control Solutions

ESX®

ESX®

-3XL

ESX®

-IOX

ESX®

-TC3

Sensor-Technik UK Ltd.Unit 21M, Bedford Heights Business CentreManton Lane, Bedford, MK41 7PH, UKTel. +44 (0) 1234-270770

Freely Programmable (C / IEC61131-3) Wide range of digital and analogue I/ODesigned to operate in the toughest environmentsCAN, RS232 & Ethernet communications

WWWsensor-technikCOUK

PECM113.indd 49 23/02/2013 15:41:31

Page 50: PECM - Issue 2 2013

50 PECM January-March 2013

Measurement & Monitoring

Accurate Measuring Of Chain Now AvailableIn response to customer demand, global chain manufacturer Donghua has added a new chain length measuring machine to its UK distribution centre’s workshop, making Donghua one of only a few chain manufacturers to have this equipment in the UK.

Designed and built by Donghua, the machine is exceptionally accurate measuring to within 10 microns per metre (a human hair is PLFURQVZLGWKDQGLVFDSDEOHRIPHDVXULQJXSWR¿YHPHWUHVof chain.

The equipment can also pre-load (pre-stretch) chain, eliminating the initial elongation often found in built ‘in-house’ attachment chain.

www.donghua.co.uk/workshop

World first for tuning fork level switchThe latest addition to the VEGA portfolio of vibrating limit switches for liquids, 9(*$6:,1* LV D ZRUOG ¿UVW ,W LVdesigned for reliable, self monitoring and fail safe switching in applications with process temperatures up to +450 °C and process pressures up to 160 bar. Until now, vibrating level switches have been limited to process conditions up to +280 °C and 100 bar. By developing a revolutionary new tuning fork drive, it makes deployment of the instrument possible far beyond these limits. The resulting performance capability is impressive: process temperatures from -196° C to +450° C and pressures from 0 to 160 bar.

Email: [email protected] www.vegacontrols.co.uk

Electrifying resultsContinuous and synchronous acquisition of electrical and mechanical power. Optimized eDrive testing with HBM:

www.hbm.com/edrivetesting

Simultaneous measurement of high voltage signals, currents, torque and rotational speed

Continuous acquisition of raw data for detailed analysis

Power calculation per half cycle

HBM United Kingdom Ltd. +44 (0) 208 515 6100 [email protected]

testing by HBM

Visit HBM at the EIS Exhibition

Silverstone on 12th March

PECM113.indd 50 23/02/2013 15:41:34

Page 51: PECM - Issue 2 2013

[email protected]

The 2nd generation of the Beamex MC2-IS intrinsically safe multifunction calibrator ATEX and IECEx certifi ed calibrator with powerful processor , display with LED backlight and improved battery shelf life

The 2nd generation of MC2-IS is a high accuracy, user-friendly and practical tool for calibration in hazardous environments. Features, such as display visibility with LED backlight, more powerful processor and improved battery shelf life have been realized. The ATEX and IECEx certifi ed 2nd generation of MC2-IS is robust and able to perform calibrations for pressure, temperature and electrical measurement. It connects to almost 20 available Beamex intrinsically safe external pressure modules and has a multilingual interface and complete numerical keyboard.

PECM113.indd 51 23/02/2013 15:41:37

Page 52: PECM - Issue 2 2013

52 PECM January-March 2013

Measurement & Monitoring

New items addedto the T24Many new items have been added to the T24

license-free, wireless, radio telemetry range,

DYDLODEOH IURP $SWL¿UVW 7KHUH¶V WKH 7WSS wind speed sensor or anemometer, a

solar panel and rechargeable battery pack,

and the T24-RDC data collector, which can

collect data from up to 200 channels and

transmit the data via GPRS, ie email, HTTP

to a website, or SMS text message. The

V\VWHPLVIXOO\SURJUDPPDEOHDQGKDVPDQ\DSSOLFDWLRQVLQWKH¿HOGmanufacturing, R&D, automotive, sports technology etc. A choice of

LQSXWDQGRXWSXWRSWLRQVLVDYDLODEOHWRSURYLGHDQH[WUHPHO\ÀH[LEOHSRZHUHI¿FLHQWDQGYHUVDWLOHGDWDPRQLWRULQJV\VWHP

7HOZZZDSWL¿UVWFRP

The MTL4850 Hart Multiplexer gains SIL3 rating for functional-safety related loops

MTL Instruments is pleased to announce

the launch of the SIL3 rated MTL4850

Hart Multiplexer. MTL is known worldwide

as an intrinsic safety interface specialist,

and now takes the lead in functional safety

components by introducing the SIL3

rated MTL4850 Hart Multiplexer for connection to instrument

loops performing safety functions up to and including Safety

Integrity Level SIL3.

Further detailed information is available via www.mtl-inst.com

RUGLUHFWIURP\RXUORFDO07/RI¿FH

Portable viscometerSpectro Inc’s portable viscometer, the SpectroVisc

Q3000, is available in the UK and Ireland from

Analysco.

The 1.8kg, self-contained and portable instrument

gives an accurate kinematic viscosity measurement by

the side of the machine in question from just a couple

of drops of oil. No temperature measurements, sample

DYHUDJLQJRUUHIHUHQFHÀXLGVDUHUHTXLUHGDQGQHLWKHUare solvents nor other hazardous materials.

The Q3000 can measure the kinematic viscosity of

OXEULFDQWRLOVFRRODQWVV\QWKHWLFÀXLGVDQGJO\FRODQGis able to accurately handle dark, sooty samples as

well as transparent samples without pre-checks. Operators can dispense

D IHZGURSV/RIÀXLG LQWR WKH WRSRI WKHVSOLWFHOO FDSLOODU\FKDQQHOThe sample is accurately timed by the internal processor as it traverses the

channel at a constant temperature of 40°C to report its kinematic viscosity.

The low volume of each sample means less waste.

Email: [email protected] www.analysco.co.uk

Test Tools ShopCheck out the latest test

instruments from the Test

7RROV6KRSThe Test Tools Shop offers a

unique range of professional

test and measurement tools all available via a free next day delivery

service.

The latest products include ‘Flip Clamps’ from Hioki... a current clamp

VPDOO HQRXJK WR ¿W LQ \RXU SRFNHW \HW ELJ HQRXJK WRPHDVXUH XS WR$2UDVLQJOHPXOWLPHWHUIURP*RVVHQ0HWUDZDWWQRWRQO\GRHVLWoffer you 17 standard multimeter functions but it also adds temperature

PHDVXUHPHQWDQGDQLQVXODWLRQUHVLVWDQFHWHVWXSWR9These are just two special products from 15 different test tool categories

covered on the Test Tools Shop website....

Check them out at www.testtoolsshop.com

PECM113.indd 52 23/02/2013 15:41:40

Page 53: PECM - Issue 2 2013

January-March 2013 PECM 53

Compressed air is the most expensive form of energy in production plants. Many companies are not aware that the generation and treatment of compressed air accounts for up to 20% of their overall energy costs. Continuous monitoring reduces operational costs, cuts the investment required for new plant, and ensures round-the-clock availability.

Measurement of the consumption of FRPSUHVVHG DLU LV WKH ¿UVW VWHS WRZDUGVD FRVW FRQVFLRXV DQG HI¿FLHQW DSSURDFKto energy consumption. E+E Elektronik Gmbh, manufacture instruments to DFFXUDWHO\PHDVXUHPDVVÀRZRUVWDQGDUGYROXPHWULFÀRZLQGHSHQGHQWRISUHVVXUHand temperature. The EE771 /776 series

measure consumption accurately ( +/- 2.5% ) in duct sizes from DIN15 to DIN300, DWSUHVVXUHVXS WR%DU7KHXQLWVZLOORSHUDWH LQ QRQÀDPPDEOH QRQFRUURVLYHJDVHVDQGDUHVHQVLWLYHWRYHU\ORZÀRZrates.

A full range of mounting sleeves is available, giving the option to subsequently replace D SUREHZLWKRXW VXSSO\ LQWHUUXSWLRQ DQGE+E have patented their probe safety non-return feature.

0HDVXUHPHQW RI KXPLGLW\ DQG GHZSRLQWin compressed air is essential to reduce the risk of corrosion, machine failures, and poor quality end products. The EE371 'HZSRLQW7UDQVPLWWHUPHDVXUHVGHZSRLQWGRZQWR'HJ&DWSUHVVXUHVXSWRBar.

7KH LOOXVWUDWLRQ VKRZV DQ (( PDVVÀRZ WUDQVPLWWHUPRXQWHGZLWKDQ((GHZSRLQW WUDQVPLWWHU DW D VLQJOH DFFHVVpoint.

[email protected] www.sensorsandtransmitters.com

Compressed air monitoringOmni Sensors and Transmitters Ltd.

EE771 Compact with Ball Valve Fitting

PECM113.indd 53 25/02/2013 12:20:26

Page 54: PECM - Issue 2 2013

54 PECM January-March 2013

Measurement & MonitoringAccess Key Energy Data

Without Leaving Your Desk!

With the new SPC DTM data transfer module from Elcomponent, users of the company’s renowned SPC range of portable energy data loggers can now access information from instruments installed anywhere in the world, without leaving their desk.

The SPC DTM module uses GPRS (General Packet Radio Service) to upload logger surveys to the web. As such the data is available at any location with a PC and an Internet connection and, with the software supplied, the information collected from remote instruments can be reviewed and analysed just as easily and in exactly the same way as it would be if the logger were physically present.

Email: [email protected]

Cirrus Research Makes the Customer King Cirrus Research, specialists in the design and manufacture of noise monitoring equipment makes their customers king by regularly listening to feedback and where necessary improving products to make them work better. Some examples of recent changes include:

8SGDWHVWRWKH2SWLPXVUDQJHRIVRXQGOHYHOPHWHUV8SGDWHVWRWKH1RLVH7RROVVRIWZDUHXVHGE\WKH2SWLPXVVRXQG level meters, the Trojan noise nuisance recorder and the doseBadge noise dosimeter.

7R¿QGRXWPRUHLQIRUPDWLRQSOHDVHYLVLWwww.cirrusresearch.co.uk

PIXELTEQ Takes Spectral Sensing and Imaging Mainstream New source for OEM

multispectral device development and manufacture

Ocean Thin Films announces its new PIXELTEQ™ spectral sensing and imaging solutions focused on creating innovative multispectral devices for aerospace, biomedical, industrial, laboratory and security applications.The patented technology behind PIXELTEQ is an exclusive micro-patterned optical coating coupled with electro-optical integration expertise to deliver high-performance OEM multispectral cameras, sensors and optical coatings. The PIXELTEQ portfolio includes PixelCam™ and SpectroCam™ cameras, 3L[HO6HQVRUQDUURZEDQGSKRWRGLRGHVDQGSDWWHUQHGRSWLFDO¿OWHUVSXUSRVHbuilt for OEM applications. The company has unveiled a new website, PIXELTEQ.FRPIHDWXULQJWKHIXOOSRUWIROLRRI3,;(/7(4SURGXFWV±IURPWKLQ¿OPFRDWLQJVto integrated electro-optical devices.7R¿QGRXWPRUHDERXW3,;(/7(4SOHDVHYLVLWPIXELTEQ.com, email [email protected], or call +1 303.273.9700.

Modbus Humidity and Temperature Transmitter for HVAC from E+E Elektronik

The EE160 HVAC transmitter with Modbus RTU output is the ideal solution for cost-effective installation in a bus system. The precision of E+E’s advanced sensor technology is combined with the latest manufacturing techniques to create a product with an outstanding price/performance ratio.The E+E HCT01 humidity and temperature sensor used in the EE160 features outstanding protection against pollution which leads to excellent long term stability and to accuracy of ±2.5% across the entire working range.

Email: [email protected] www.epluse.com

icenta Controls introduce a new range of industrial inline paddlewheel

icenta Controls in the UK is introducing a new range of industrial inline paddlewheel ÀRZPHWHUVWKDWRIIHUVFRQVLGHUDEOHEHQH¿WVIRUFRQWLQXRXVOLTXLGÀRZPRQLWRULQJ7KH ,&/30 VHULHV RI SDGGOHZKHHO PHWHUV SURYLGHV DFFXUDWH ÀRZ UDWHmonitoring over the range of 0.5 to 1200 l/min with nominal sizes up to 50 mm. A simple yet robust stainless steel construction offers excellent corrosion resistance and a versatile design with custom options can be HDVLO\DGDSWHGWRPHHWYDU\LQJÀRZPRQLWRULQJUHTXLUHPHQWVWKUHDGHGRUÀDQJHGFRQQHFWLRQVDVHOHFWLRQRIRXWSXWVDQGÀRZLQVWUXPHQWVDFKRLFHof 3 temperature ratings (up to 120°C, 230°C or 350°C) and pressures up to 100 bar.

Email: [email protected] www.icenta.co.uk

Reduce energy usage by 20% - Discover the Next Generation of X-ray Inspection Combining new technology, an ergonomic design, improved user experience and greater sustainability credentials, the X3310 x-ray system from METTLER TOLEDO is the next step in product inspection for food manufacturing. Its advanced technology achieves a detection VHQVLWLYLW\¿YHWLPHVWKHVWUHQJWKRISUHYLRXVsystems - meaning it uses 20% less power.Developed with feedback and collaboration from customers and manufacturers, the evolutionary X3310 x-ray system has been VSHFL¿FDOO\GHVLJQHGIRUWKHLQVSHFWLRQRIVPDOODQGPHGLXPVL]HGpacked products, such as baked goods or ready meals.Learn more by visiting: www.mt.com/uk-xray-nextgen

07/ LV WKH ¿UVW VXSSOLHU RI SURFHVV LQVWUXPHQWDWLRQ WREH FHUWL¿HG DV D )XQFWLRQDO 6DIHW\ 0DQDJHPHQW )60Company.:LWK )60 DFFUHGLWDWLRQ FHUWL¿HG WR ,(& 07/demonstrates its competence to design and market products in accordance to the International standard, giving our customers FRQ¿GHQFHZKHQXVLQJ07/SURGXFWVLQDVDIHW\LQVWUXPHQWHGV\VWHP6,6ZLWKRXWWKHQHHGIRUIXUWKHUYHUL¿FDWLRQThe International standard mandates that everyone involved in the safety systems lifecycle must demonstrate Functional Safety Management. MTL has demonstrated its compliance through an external certifying body (SIRA) and is audited by an accredited national body (UKAS).07/¶V )60 LV FHUWL¿HG WR FRYHU D UDQJH RI 6LJQDO LQWHUIDFHVIS barriers, Isolators, Fieldbus Instruments, Alarm systems, Communication devices and Instrument Power Supplies.

Email: [email protected]

PECM113.indd 54 23/02/2013 15:41:48

Page 55: PECM - Issue 2 2013

January-March 2013 PECM 55

Process Technolgies

Tel: 0208 339 7370Fax: 0208 339 7371

462 Ewell Road, Surbiton, Email: [email protected] KT6 7EL, England Web: www.blackfast.com

Moving at the Speed of Business

A Complete W ork Order S ystem Designed t o Reduce C osts, Increase Productivity and Improve Quality. Contact Us Today and Get Moving!

UK Office:32 Norwell RoadLondon SW13 9BSUK

World Headquarters: 3917 Research Park Dr. Suite B4 Ann Arbor, MI 48108 US

www.ashcomtech.com [email protected] +1 734 665-17800800 011 2667

PECM113.indd 55 23/02/2013 15:41:54

Page 56: PECM - Issue 2 2013

56 PECM January-March 2013

Process Technolgies

The Classes You Need. Anytime and Anyplace You Want.

Visit www.aiche.org for more information and to register.

eLearning

Add the skills you need with self-paced, online courses from AIChE.

Offering courses in:

Process Safety Separations Solids Handling Fundamentals Fluid Mixing

And much more.

Choose from a list of more than 20 courses available now.

,QGXVWULDO)DQVIRUDOODSSOLFDWLRQVDQG

SURFHVVHV

ͻdžŝĂůͻŝĨƵƌĐĂƚĞĚͻĞŶƚƌŝĮƵŐĂůͻWĂĚĚůĞůĂĚĞͻŚŽƉƉĞƌ

ͻůŽǁĞƌͻŽƵďůĞ/ŶůĞƚͻĞƐƉŽŬĞ/ŵƉĞůůŽƌƐͻ,ŝŐŚĸĐŝĞŶĐLJͻ^ŵŽŬĞdžƚƌĂĐƚ

ϬϭϯϴϰϮϱϯϰϳϱƐĂůĞƐΛŵŝĚƚŚĞƌŵĨĂŶƐŶĞƚ

DŝĚƚŚĞƌŵ&ĂŶƐ>ŝŵŝƚĞĚdŚĞ^ůŝŶŐƵĚůĞLJtĞƐƚDŝĚůĂŶĚƐ

zϮϵ:

ĞƐŝŐŶDĂŶƵĨĂĐƚƵƌĞŽĨ/ŶĚƵƐƚƌŝĂůĨĂŶƐĂŶĚŝŵƉĞůůŽƌƐ^ƵďͲŽŶƚƌĂĐƚĂůĂŶĐŝŶŐŽĨ/ŵƉĞůůŽƌƐĂŶĚKƚŚĞƌWƌŽĚƵĐƚƐ

'ĞŶĞƌĂů&ĂďƌŝĐĂƟŽŶtŽƌŬ

PECM113.indd 56 23/02/2013 15:42:43

Page 57: PECM - Issue 2 2013

PECM113.indd 57 23/02/2013 15:42:50

Page 58: PECM - Issue 2 2013

)LNH8.(DUO6WUHHW0DLGVWRQH.HQW0(3)8QLWHG.LQJGRP

7(LQIR#ÀNHFRXNZZZÀNHFRXN

7RWDO([SORVLRQ3URWHFWLRQ

&RQWDFW)LNH7RGD\

&DOOXVRQ2XUVSHFLDOLVWVZLOOSURYLGHVRXQGDGYLFHHYHU\VWHSRIWKHZD\WRHQVXUHWKHVXFFHVVRI\RXUSURMHFW

3UHYHQWVH[SORVLRQSURSDJDWLRQEHWZHHQWZRLQWHUFRQQHFWHGYHVVHOV

3URWHFWVDQLQGLYLGXDOLWHPRISURFHVVHTXLSPHQW

8VHGLIDUHVHWWDEOHPHFKDQLFDOEDUULHULVUHTXLUHGRUSUHIHUUHG

8VHGZKHUH\RXKDYHWRYHQWLQVLGHRULQWRDQDUHDZKHUHSHUVRQQHOPD\EHSUHVHQW

7KH(3$&2FRQWUROOHUFDQEHORFDWHGORFDOO\RULQDFRPSXWHUURRPDQGOLQNHGWRD6&$'$V\VWHP

(LWKHUSUHVVXUHRUÁDPHVSDUNGHWHFWLRQGHSHQGDQWRQV\VWHPGHVLJQFULWHULD

&+(0,&$/,62/$7,21

'(7(&7,21

&21752/6<67(0

0(&+$1,&$/,62/$7,21

&+(0,&$/68335(66,21

)/$0(/(669(17,1*

PECM113.indd 58 23/02/2013 15:42:51

Page 59: PECM - Issue 2 2013

January-March 2013 PECM 59

Euromixers unique range of IBC mixers have been

designed for use on industry standard 800 and 1000

litre Intermediate Bulk Containers (IBC’s) with a 150mm

screwed cap, E-400 folding impellers have been designed

WR ¿W WKURXJK WKH VWDQGDUG RSHQLQJ WR WUDQVIRUP WKHIBC into a versatile mixing vessel quickly re-mixing

the contents when settled out during transportation or

storage in preparation for use directly from the IBC.

Improved product performance and consistency together

with cost savings on transfer and cleaning time are

EHQH¿WVUHSRUWHGE\XVHUVRQDZLGHUDQJHRIDSSOLFDWLRQVincluding – dyestuffs and pigments, paints and varnish,

ZDWHU WUHDWPHQW FKHPLFDOV DQG ÀRFFXODQWV JHQHUDOchemicals.

³8VLQJ WKH ,%& DV D PL[LQJ YHVVHO RIIHUV VLJQL¿FDQWEHQH¿WVLQFOXGLQJFRVWVDYLQJVRQWUDQVIHUDQGFOHDQLQJtime on a range of applications”

6WDQGDUG,%&PL[HUVDUHDYDLODEOHZLWKHQHUJ\HI¿FLHQWelectric motors or air drives mounted on a stainless steel

frame and secured to the IBC with quick action toggle

clamps the mixer shaft and E-400 folding impellers are

manufactured from 316 stainless steel as standard or

plastic materials i.e. Polypropylene for corrosive products.

Options include a powder hopper or liquid inlets for

the addition of powders or liquids into the IBC with the

mixer in place to transform the IBC into a cost effective

production vessel, E-400 folding impellers are suitable

for a wide variety of applications including viscous liquids

settled solids and slurries that need to be stirred agitated

or mixed, for viscous materials Dual E-400 folding

impellers are recommended for effective mixing and a

strong top to bottom turnover of the product.

For ease of use IBC mixers are supplied with an eye bolt

for lifting with a hoist or the option of a fork lift module to

facilitate lifting with a fork lift truck

Free trials are offered by Euromixers to ensure the IBC

PL[HUVUHFRPPHQGHGPHHWWKHFOLHQWVVSHFL¿FQHHGVElectric and Air drive options are available.

New additions to Euromixers product range for 2011

include IBC Mixing StationsZKLFKFDQEHZDOORUÀRRUmounted, designed for ease of use and include with

automatic or hand operated raise and lower with integrated

industry recognised safety features and controls, mixing

stations use the same drives and E-400 folding impellers

DVWKHVWDQGDUG,%&PL[HUVLQD¿[HGLQVWDOODWLRQ

1HZ+LJK VKHDU KRPRJHQLVHUV GHVLJQHG WR ¿W WKURXJKthe standard 150mm opening in an IBC are also now

available for use with the standard IBC mixer mounting

or with a mixing station.

The new range also includes 200 litre Drum Mixing

stations which are designed for ease of use and include

industry standard safety features to compliment the

range of portable drum mixers.

'UXPPL[LQJVWDWLRQV FDQEHFXVWRPLVHGPHHW VSHFL¿FQHHGV LQFOXGLQJ ¿WWLQJ GUXP SXPSV WR IDFLOLWDWH WKHproduct being fully mixed whilst being pumped to the

production line or the safe addition of product into the

drum whilst the mixer is operating.

Floor mounted, wall mounted or mobile versions are

available with electrically or air operated drives.

Please contact Euromixers RI¿FHZHZLOOEHSOHDVHGWRhelp with your application.

Telephone : 44 (0) 161 449 8559Email : [email protected] : www.euromixers.co.uk

IBC Mixers – Free Trial

PECM113.indd 59 23/02/2013 15:42:53

Page 60: PECM - Issue 2 2013

60 PECM January-March 2013

Process Technolgies

6(385$7HFKQRORJLHV/WG8QLW/RQJIRUG,QGXVWULDO(VWDWH/RQJIRUG5G%ULGJWRZQ&DQQRFN6WDIIV:6'*(PDLOVDOHV#VHSXUDWHFKQRORJLHVFRP:HEZZZVHSXUDWHFKQRORJLHVFRPSKRQHID[

ŝƚĂůůďŽŝůƐĚŽǁŶƚŽĨŝůƚƌĂƚŝŽŶ

KƵƌƉƌŽĐĞƐƐĨŝůƚƌĂƚŝŽŶĚŝǀŝƐŝŽŶĞdžŝƐƚƐƚŽŵĞĞƚƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨĚĞŵĂŶĚŝŶŐĞŶŐŝŶĞĞƌƐtĞůůǁŽƌŬǁŝƚŚLJŽƵƚŽƉůĂŶŽƵƌƐƚŽĐŬŚŽůĚŝŶŐƚŽŵĂƚĐŚLJŽƵƌŵĂŝŶƚĞŶĂŶĐĞƐĐŚĞĚƵůĞƐŐƵĂƌĂŶƚĞĞŝŶŐƚŽƉƌĞͲĂůůŽĐĂƚĞĞůĞŵĞŶƚƐĨƌŽŵŽƵƌŚƵŐĞƌĂŶŐĞŽĨŽƌŝŐŝŶĂůĞƋƵŝƉŵĞŶƚĂŶĚϯƌĚƉĂƌƚLJƌĞƉůĂĐĞŵĞŶƚĞůĞŵĞŶƚƐŵĂŬŝŶŐůŝĨĞĞĂƐŝĞƌĨŽƌLJŽƵdŚĂƚƐĂƐƵƉƌĞŵĞƐĞƌǀŝĐĞĨƌŽŵ^WhZͶĂŶĚƉƌŽďĂďůLJĨŽƌůĞƐƐĐŽƐƚƚŚĂŶLJŽƵƌĐƵƌƌĞŶƚƐŽůƵƚŝŽŶůůŽƵƌƉƌŽĐĞƐƐĨŝůƚƌĂƚŝŽŶƉƌŽĚƵĐƚƐĐŽŶĨŽƌŵƚŽŽƌĞdžĐĞĞĚƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨ/^KϴϱϳϯͲϭĂŶĚǁŚĞƌĞĂƉƉƌŽƉƌŝĂƚĞĐŽŵƉŽŶĞŶƚƐŵĞĞƚ&ƌĞƋƵŝƌĞŵĞŶƚƐĨŽƌĐŽŶƚĂĐƚǁŝƚŚĨŽŽĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞŽĚĞŽĨ&ĞĚĞƌĂůZĞŐƵůĂƚŝŽŶƐ;&ZͿƚŝƚůĞϮϭ^WhZ Ζ^>dΖƉƌŽĐĞƐƐ ĨŝůƚĞƌŚŽƵƐŝŶŐƐĂƌĞĂǀĂŝůĂďůĞ ŝŶƉŚĂƌŵĂĐĞƵƚŝĐĂůƋƵĂůŝƚLJϭϰϯϬϭƐƚĂŝŶůĞƐƐƐƚĞĞů ;ϭϰϰϬϰŽŶ ƌĞƋƵĞƐƚͿĂŶĚ ƉŽůŝƐŚĞĚ ƚŽ ZĂ ϭϲ sĂĐƵƵŵ ĂŶĚ ŶĂƚƵƌĂů ŐĂƐ ĨŝůƚĞƌƐ ƵƚŝůŝƐĞ ǀĂĐƵƵŵ ŝŵƉƌĞŐŶĂƚĞĚ ĐĂƐƚ ĂůƵŵŝŶŝƵŵ ŚŽƵƐŝŶŐƐtĞ ŽĨĨĞƌŵƵůƚŝƉůĞƉƌĞƐƐƵƌĞƌĂƚŝŶŐƐĨƌŽŵϭϲƚŽϰϬϬďĂƌůĞŵĞŶƚƐĐĂŶďĞĞŝƚŚĞƌƐŝŶƚĞƌĞĚ/ŶŽdžŵŝĐƌŽĨŝůƚĞƌƉĂƉĞƌďŽƌŽƐŝůŝĐĂƚĞŵŝĐƌŽĨŝďƌĞƐĂĐƚŝǀĞĐĂƌďŽŶŽƌƐƚĞƌŝůĞĂƐƌĞƋƵŝƌĞĚ

YƵĂůŝƚLJǀĂůƵĞĂŶĚƐĞƌǀŝĐĞĨƌŽŵ^WhZ

Web / ckf.co.uk Email / [email protected]

Tel / +44 (0)1452 424565THE AUTOMATIC SOLUTION

From global brands to manufacturing start-ups, CKF is a provider of integrated robotic solutions that deliver you a competitive advantage and long term sustainability.

Our customers rely upon CKF’s accomplished team of engineers, fl exible in their approach and ready to challenge the norm to meet your objectives.

We are as eager to protect the future of your business as we are to ensure a smooth automated transition; on time and on budget.

PECM113.indd 60 23/02/2013 15:42:58

Page 61: PECM - Issue 2 2013

January-March 2013 PECM 61

Process Technolgies

T: 01256 365 605E: [email protected]

make it how you want it*profile assembly solution fast. versatile. simple.*we mean MiniTec solutions as well as sandwiches

free samplesfree design advicefree design tools

ALREADY MADE TO ORDER: » machine guards

» workstations

» conveyors

» customised enclosures

www.minitec.co.ukvisit us and we’ll show you how to adapt MiniTec for your needs

ªsee our solutions at:

Precision EformingPrecision Eforming produces a full line of electroformed nickel PHVK7KHPDWHULDOLVDYDLODEOHLQWKHIROORZLQJVSHFL¿FDWLRQVIURP5 wires per inch to 2,000 wires per inch, from 1% transmission to 95% transmission, thickness from 3 microns to 250 microns, sheet sizes up to 22 inches square, standard openings are square but can be custom made slotted, round, or rectangular, in any designable JHRPHWU\SXUHQLFNHOFDQEHÀDVKHGZLWK*ROGRU&RSSHUand also can be black nickel coated.

Tel: 001 (607) 753-7730 www.precisioneforming.com

A Low Maintenance Stainless Steel Filter Range Designed To Suit Most Liquid Applications

Axium Process’ range of 316L VWDLQOHVVVWHHO¿OWHUV LVQRZEHLQJused across a wide spectrum of industries for a diverse range of duties. It is easy to maintain, has no moving parts and does not require tools for access or cleaning. This versatile, yet robust range RI¿OWHUVKDVHYROYHGLQOLQHZLWKFXVWRPHUGHPDQGDQGFDQSURYLGH¿OWUDWLRQOHYHOVIURPPLFURQXSWRPLFURQDVVWDQGDUGDQGincludes; Compact, Standard, Economy, High Capacity, Duplex, Triplex and Jacketed options with interchangeable wedge-wire, perforated sheet and sintered mesh screens.

Email: [email protected] www.axiumprocess.com

Keeping automatic pick & place equipment going and being able to use partially used reels, without the loss of components, provides substantial cost savings. Double Splice Tape for 8mm paper SMD tapes and Cover Tape Extenders for many widths conveniently achieve these aims. New additions: Top-Splice, a cost-effective ESD safe way of connecting 8mm SMD cover tapes, and Universal Cartridge Brass Shims, which economically employ the stapler principle to SMD tape splicing.

Cover Tape and Radial Component Tape Joiners, Tape Reel Sealers plus clear adhesive foils for test printing and trial placement, make life easier for the assembly professional.

Benz LtdTel 0845 1700 123 / Fax 0845 3900 123

www.benzltd.com

PECM113.indd 61 23/02/2013 15:43:08

Page 62: PECM - Issue 2 2013

PECM113.indd 62 23/02/2013 15:43:10

Page 63: PECM - Issue 2 2013

maxwell.com

SMALLER, LIGHTER, LEANER, GREENER, Maxwell’s industry-leading

ultracapacitors are breakthrough energy storage and delivery devices that

offer millions of times the capacitance of traditional capacitors. They deliver

rapid, reliable power bursts for up to a million-plus duty cycles – even in extreme

conditions. This makes them ideal for energy-use optimization in applications

ranging from consumer electronics, wind and mass transit to hybrid cars and

industrial equipment. Maxwell. The leader in burst power delivery. Hands down.

MAXWELL ULTRACAPACITORS.THE BIGGEST IDEA IN BURST POWER DELIVERY. IN THE SMALLEST FORM FACTOR.

PECM113.indd 63 23/02/2013 15:43:13

Page 64: PECM - Issue 2 2013

%66¶VGHGLFDWHG,QGXVWULDOVDOHVIRUFHKDVJURZQVLJQL¿FDQWO\RYHUWKHSDVWPRQWKVDQGLVQRZworking closely with a number of key sectors including Water, Power Generation, Food & Beverage, Pharmaceutical and Petrochemical, as ZHOO DVPDQ\ RI WKH8.¶VPDMRUPDQXIDFWXULQJfacilities.

This has ensured that the team is well-placed to cope with the demands of legislation changes and help minimize the impact on industrial end-users.

The Energy Related Products Directive (ErP) has SURKLELWHGWKHVDOHRILQHI¿FLHQWSXPSVDFURVVWKH(8Brian Kelly, Regional Sales Director at BSS Industrial, one of the UK’s leading suppliers of pumps to UK industry, brings you up to speed.

The Energy Related Products Directive (ErP) aims to PDNH VLJQL¿FDQW FXWV LQ WKH DPRXQW RI HQHUJ\ XVHGin pumping systems across the EU. The goal is to halve the amount of energy being used by glandless circulating pumps, including small circulating pumps, operating in the European Union for heating and air conditioning systems, by 2020.

The EU has chosen to slowly tighten the regulations. From the 1st January all circulators sold have been compliant to the new regulations which means that the (QHUJ\(I¿FLHQF\,QGH[((,LVORZHUWKDQ

In 2015, the EEI index will change again and circulators will need to have an EEI lower than 0.23 to be compliant with the ErP directive. At this stage the regulations will begin to apply to the small pumps

incorporated in combi and system boilers installed on new systems or in refurbishment projects where a new boiler is attached to an existing heating system.

In the last implementation stage, the regulations starting from 2020 will apply to the replacement of integrated pumps in existing heat generators. Overall, these changes are thought to be likely to provide a reduction in EU-wide carbon dioxide (CO2) emissions of about 11 million tonnes per year.

Smoothing the way for our customersAt BSS Industrial we have been working closely with our pump suppliers to ensure compliance with the new regulations and to make certain that our own customers are fully up to speed with the changes. We have been working not just to ensure compliance with the 2013 changes but also to ensure that the 2015 changes are front of mind for our customers in our key industrial markets of power, water and food and beverage production.

Crucially, our technical team has worked closely with our pump suppliers to model return on investment and payback scenarios for industrial clients installing new compliant pumps in key sectors. We understand that major capital investment requires sign-off from multiple different stakeholders and we can equip you with the information you need to make the best case for investment within your own organisations.

)RU PRUH LQIRUPDWLRQ RQ %66 ,QGXVWULDO DQG WR ¿QGyour nearest trade counter, please visit www.bssindustrial.co.uk or call 0116 262 3232. Follow BSS on Twitter @BSSIndustrial

PECM113.indd 64 23/02/2013 15:43:26

Page 65: PECM - Issue 2 2013

January-March 2013 PECM 65

Product News

Libra Systems Re-Invests Again To Drive In New Technolgy And GrowthLIBRA SYSTEMS Limited based in Telford, Shropshire, a well known manufacturer of cold rolled metal products used in the construction of partition walls and suspended ceilings, has invested another £100k plus in new machinery, in order to drive in new processing technology to support its on-going growth, as well as raise current RSHUDWLRQDOHI¿FLHQF\OHYHOVRQFHDJDLQThis latest investment in two new machines, both detailed and delivered from Addison Saws in Stourbridge, covers the latest ‘Mecal MC 305 .RVPRV70¶&1&PDFKLQLQJFHQWUHDKLJKO\DGYDQFHGÀRRUW\SHYHUWLFDOspindle, 4-Axis CNC machining centre, which complete with its own tools IDFLOLW\DOVRPDNHVLWDKLJKO\HI¿FLHQWÀH[LEOHDQGFRPSDFWSURGXFWLRQXQLW

Tel: 0044 (0) 1384 264 950 E.mail: [email protected]

Parker’s ‘Mill’ cylinders deliver high performance under harsh conditions

3DUNHU +DQQL¿Q¶V EDU DQG EDUhydraulic ‘mill’ cylinders are an established global favourite in hostile environments and DUGXRXV DSSOLFDWLRQV 2ULJLQDOO\ GHVLJQHGfor use in steel mills, Parker’s mill cylinders are of heavy duty, all-steel construction and are fatigue-free at their PD[LPXPUDWHGSUHVVXUH1HZIRUWKHODWHVWJHQHUDWLRQRIWKHVHF\OLQGHUVH[WHQGVWKHVWDQGDUG¿WPHQWRILQGXFWLRQKDUGHQHGSLVWRQURGVRIIHULQJWKHXOWLPDWHUHVLVWDQFHWRGDPDJHLQWRXJKDSSOLFDWLRQVA new, wider range of mounting accessories offers greater versatility for WKHGHVLJQHUZKLOHZHEEDVHG&$'PRGHOVDQGDQRQOLQHFRQ¿JXUDWRUVSHHGDQGVLPSOLI\WKHVHOHFWLRQSURFHVV

Tel: 00800 27 27 5374 Email: [email protected]

*XDUDQWHHFRORUFRQVLVWHQF\LQ\RXUZRUNÀRZ6SHHGXS\RXUPDQXIDFWXULQJSURFHVVHVUHGXFHZDVWDJHSpectraLight QC, from X-Rite, is a light booth with state-of-the-art seven available light sources and a data-driven back-end that carefully monitors the performance DQGFRQGLWLRQVRIWKHODPSV,WRIIHUVDWRWDOsupply chain solution linking brand owners, RSHUDWRUV VSHFL¿HUV DQG VXSSOLHUV ZKLOHreducing human error, standardizing FRQGLWLRQVIRUYLVXDODVVHVVPHQWDQGVDYLQJWLPHDQGPRQH\Custom Harmony Room Solutions, based on SpectraLight QC technology, allow manufacturers the ability to replicate the consumer H[SHULHQFHZKHWKHULWLVRQWKHVKRZURRPÀRRURURXWGRRUVwww.xrite.com

SpectraLight QC: the next generation light booth for finely controlled visual assessment of color

These new compressors have a solid cast iron construction with modern, HQHUJ\ HI¿FLHQW GULYH DQG FRQWUROV\VWHP 7KH 3RZHU 6\VWHP &, 6HULHVare robust machines that are simple to maintain and have outstanding UHOLDELOLW\7KH\IHDWXUHKHDY\GXW\LQWDNH¿OWUDWLRQVWDLQOHVVVWHHOYDOYHVDQGYHU\ORZRSHUDWLQJVSHHGV±UHVXOWLQJLQYHU\ORZQRLVHOHYHOV$YDLODEOHDVUHFHLYHURUEDVHPRXQWHGXQLWVLQSRZHUVL]HVIURPN:WR N: VLQJOH SKDVH DW N:RU WKUHHSKDVH SRZHU DQGZRUNLQJSUHVVXUHXSWREDU7KH\DUHVXLWDEOHIRUDOOKHDY\GXW\VLWHFRQGLWLRQVLQLQGXVWULDODXWRPRWLYHPDQXIDFWXULQJDQGHQYLURQPHQWDODSSOLFDWLRQV

Tel: 01844 212233 www.fps-compressors.co.uk

Cast iron compressor design offers traditional strengths with high efficiency

([SDQG \RXU GHVLJQ KRUL]RQV ZLWK &RYH ,QGXVWULHV XVLQJ RXU \HDUV H[SHULHQFH LQ WKH GHVLJQ DQG SURGXFWLRQ RI UXJJHGLVHGVKLHOGHGHQFORVXUHVZLULQJKDUQHVVHVDQG$7(:HSURYLGHDWRWDOVROXWLRQPDQXIDFWXULQJVHUYLFHIURPGHVLJQWKURXJKWRGHOLYHU\

$HURVSDFHDQG'HIHQFH5XJJHGLVHG(0&+RXVLQJV3DQHOVDQG´5DFN6\VWHPV(OHFWURQLF'HVLJQ:LULQJ+DUQHVVHV&DEOH$VVHPEOLHV$XWRPDWLF7HVW(TXLSPHQW6KHHW0HWDO'HVLJQ&1&3XQFKLQJ)RUPLQJ:HOGLQJ:HW3DLQWLQJDQG3RZGHU&RDWLQJ

VDOHV#FRYHLQGXVWULHVFRXNZZZFRYHLQGXVWULHVFRXN

&RYH,QGXVWULDO(QWHUSULVHV/WG,QGXVWULHV+RXVH

,QYLQFLEOH5RDG)DUQERURXJK+DPSVKLUH*848

*DLQVERURXJK (QJLQHHULQJ¶V UDQJHof Vertical Form Fill & Seal machines are based on a modular concept in which the frame size is determined by the bag size, the optional components are then selected by the user enabling him to achieve PD[LPXPÀH[LELOLW\ LQKLVFKRLFHRImachine requirements to match his VSHFL¿FQHHGV)XUWKHU ÀH[LELOLW\ ZLWKLQ WKH UDQJHenables the user to specify the type of drive, pneumatics, plc and electronics through to the type of IHHGLQWHUIDFHLHDXJHUIHHGPXOWLhead weigher, in-line vibratory tray IHHGVURERWLFVHWF$VZHOODVµ)RXUCorner Seal’ bag format we also offer “Block Bottom attachments, Valve $SSOLFDWRUV *DV )OXVKLQJ &DUU\Handles, Tear Strips and a choice of Printers are just a small example as to what we are able to offer” points RXW*DLQVERURXJK(QJLQHHULQJChange over times have been dramatically reduced by incorporating easy wash down features, tool free parts and settings that are easily accessed via WKHWRXFKVFUHHQFRQWUROSDQHO7KHVFUHHQVKDYHVHOIKHOSPHQXVWKDWPDNHOLIHHDV\IRUWKHRSHUDWRUHYHQZDUQLQJKLPLIFRQÀLFWLQJGDWDLVHQWHUHG

Fault diagnostics reporting can be carried out via Ethernet or ZLUHOHVVFRQQHFWLRQWRDEDVHVWDWLRQDQGWH[WPHVVDJHDQHQJLQHHU

T: 01427 617677 E:[email protected]: Adrian Shenton 07971 121588

Gainsborough Engineering

PECM113.indd 65 25/02/2013 10:28:04

Page 66: PECM - Issue 2 2013

66 PECM January-March 2013

Product News

Weld Cleaning

Available from Elmer Wallace, two innovative weld cleaning machines have been launched to ERRVWSRVWZHOG¿QLVKLQJRIVWDLQOHVVVWHHOThe premier EASYkleen PLUS Brush has higher applicable power, delivering effective amps, which means fast operation. And with its special MIG brush MIG welds can be cleaned quickly and easily.

7KH($6<NOHHQ'&%UXVKLVDVPDOOHUPDFKLQHIRUUDSLG7,*ZHOG¿QLVKLQJand has a current optimiser and pulse wave modulation to ensure best practice by operator and to maximise speed, increase brush life and reduce solution waste.

There is a range of rushes so all joint geometry can be cleaned with speed DQGSUHFLVLRQWKHGLUHFWFXUUHQWPHDQVWKDWWKH¿QLVKHGZHOGVDUHHOHFWURpolished offering a high degree of corrosion resistance.

Tel: 0141 810 5530 www.elmerwallace.co.uk

JAI has introduced a new line of cutting edge CMOS cameras for industrial machine vision.

Leading the way is JAI’s new line of performance-driven cameras targeted at applications where the combination of resolution and frame rates is pushing data rates to QHZOHYHOV7KH¿UVWWZRRIWKHVHFDPHUDVLQFOXGHDPHJDSL[HOPRGHOoffering 30 frames per and a 5-megapixel camera capable of 250 fps at full resolution.

The new camera technology in this high performance series will allow XVHUVIRUWKH¿UVWWLPHWRUHDSWKHKLJKVSHHGEHQH¿WVRI&026DWIUDPHrates not possible in CCD technology, while still providing remarkable high-end image quality.

For further information contact:E-mail: [email protected] www.jai.com

20 megapixel cutting-edge industrial CMOS cameras from JAI.

Demag cranes are a crushing success for CMS CepcorTerex Material Handling has supplied two Demag overhead travelling cranes for CMS Cepcor’s 7HFKQLFDO&HQWUHORFDWHGQHDULWV+HDG2I¿FHLQCoalville, Leicestershire. CMS Cepcor is Europe’s largest aftermarket supplier of premium crusher components to the mining, quarrying, aggregate, demolition and recycling industries. 7RPHHW&06&HSFRU¶VVSHFL¿FPDWHULDOKDQGOLQJrequirements, Terex Material Handling supplied two Demag 24.5 m span, 12.5 t SWL single girder overhead travelling cranes, each with a Demag DR-Pro 10 electric wire rope hoist. The crane systems have two long travel speeds of 20 and 5 m/min, variable cross travel speeds of 5 to 30 m/min and hoisting speeds of 4.0/0.7 m/min.

Tel: 01295 676202 www.demagcranes.com

MOTUS®ContactronControlSmall drives and motors with a power output of up to 4kW are frequently used in machine control. In the process, sometimes both directions (forward/reverse) need to be controlled and the drives have to be protected against possible malfunctions. It must also be ensured that they can be reliably and safely shut off in the event of an emergency.A product which combines these four important requirements into one device is the MOTUS®ContactronControl. An innovation that can be used on busbars as well as on DIN rails. The MOTUS®ContactronControl is an extraordinarily durable innovation due to its hybrid switching technology, resulting in a smooth switching function with an operational life span up to 10 times longer than conventional switchgear.

For further details visit http://motus.woehner.de

PECM113.indd 66 23/02/2013 15:43:44

Page 67: PECM - Issue 2 2013

January-March 2013 PECM 67

Cog Moors sewage treatment plant in South Wales has, in the past, asked seepex to solve pump problems on site. This has

resulted in a digester recirculation impeller pump being replaced with a progressive cavity pump to resolve issues associated with gas produced in the digestate. The progressive FDYLW\ SXPS VXSSOLHG ZDV ¿WWHG ZLWK 6PDUWStator Technology, a new innovation at the time, and the rapid maintenance of this pump proved a hit with the plant engineers.

seepex pumps are used on a variety of duties on site and following the success of smart stator they were asked to look at ways to reduce downtime of pumps caused by ragging blockages and high grit levels causing wear. In conjunction with the plant management seepex proposed a plan to upgrade all the existing pumps to Smart Conveying Technology, a proposal that was taken up with enthusiasm by Welsh Water who could see the advantages of the design.

Smart Conveying Technology is a pump development which allows both the rotor and stator to be removed and replaced without the need to dismantle the pipework thus allowing blockage removal, pump inspection and planned maintenance to be carried out. The stator can also be adjusted to extend the stator life by up to 100%.

Training from seepex has reduced downtime by up-skilling the operators so that they carry out routine maintenance tasks, remove ragging blockages and adjust the stator when wear occurs.

To date over 20 pumps have been converted on this site and the extension of Smart Conveying Technology KDV GHOLYHUHG UHDO VDYLQJV ZLWK LQFUHDVHG HI¿FLHQF\through reduced downtime, reduced maintenance intervals and reduced spares and maintenance costs.

seepex use Smart Conveying Technology to improve efficiency at Cog Moors

p5OCTV%QPXG[KPI6GEJPQNQI[pRTQXKFGUVJGHCUVGUVRQUUKDNGOCKP

VGPCPEGVKOGUHQT[QWTRWOR#UUGODNKPICPFFKUOCPVNKPIUGGRGZ

RWORUJCUPGXGTDGGPGCUKGTCPFVJGNKHGE[ENGEQUVUQHQWTRWO

RKPIUQNWVKQPUJCXGPGXGTDGGPNQYGT

,QKPVJGUOCTVTGXQNWVKQPCPFVGUVQWTKPPQXCVKQP

p5OCTV%QPXG[KPI6GEJPQNQI[q

5RGGF7R5OCTV%QPXG[KPI6GEJPQNQI[

UGGRGZ7-.VF

6GN

UCNGU"UGGRGZEQWM

YYYUGGRGZEQO

VHHSH[SXPS¿WWHGZLWK6PDUW&RQYH\LQJ7HFKQRORJ\

PECM113.indd 67 23/02/2013 15:43:45

Page 68: PECM - Issue 2 2013

PECM113.indd 68 23/02/2013 15:43:48

Page 69: PECM - Issue 2 2013

January-March 2013 PECM 69

Software & Systems

T-Cards System Now On-Line- gives global multi-user accessT-Cards Direct has taken the concept of its UHQRZQHG PDQXDO ZRUNÀRZ PRQLWRULQJ V\VWHPand developed an OnLine version that provides an RSSRUWXQLW\WRPDQDJHZRUNÀRZLQUHDOWLPHXVLQJWKHVLPSOHGUDJDQGGURSWHFKQLTXHPRYLQJFDUGVDURXQGWKHERDUGWRUHÀHFWFXUUHQWVWDWXVA big advantage of the new OnLine system is that it enables multiple remote secure access from anywhere in the world using Verisign’s SSL FHUWL¿FDWHVDQGKDVSDVVZRUGSURWHFWLRQORJLQ6WDQGDUG ERDUG FRQ¿JXUDWLRQV DUH 3HUSHWXDO :HHNO\ 3ODQQHU DQG DQAnnual Board set out in the familiar T-Cards Direct format of columns and rows. Adding a project or work card could not be simpler – just click on the ADD t-card icon in the menu and a new t-card appears.

Tel: 01732 871417 www.tcardsdirect.com

Status’ New SEM1750Do The MathsStatus Instruments has launched one of the most advanced but user friendly Dual Channel Signal Conditioners of its type on the market. The SEM1750 accepts current and voltage process signals and offers 3.75kv isolation between all ports to provide ranged industrial process output signals such as (0 to 20) mA, (4 to 20) mA, (0 to 10) V, (1 to 5) V DC. In fact, any signal input or output can be programmed within the input / output range limits. Each input and output will accept a passive current loop but also has a built in transmitter power supply. 8VHUV FRQ¿JXUH WKH FRQGLWLRQHU YLD 6WDWXV¶ HDV\ WR XVH FRQ¿JXUDWLRQsoftware, USB Speed Link. For more information visit www.status.co.uk

Safely encasedThe innovative, explosion-proof signal towers EDLM (3 coloured LED modules) and EDWM (5 coloured LED modules) come with a high-strength main body made of aluminium alloy. Thanks to their pressure- and fl ame-proof housing they reach protection IP66. The signal towers are suited for fl ush mount, wall mount and horizontal mount.

Energy-effi cient LED lightsThe series AR-070 and AR-078 are signal towers with up to fi ve LED modules and a diameter of 40 or 60 mm. The signal lights are resistant against gas or dust explosions and are approved for zone 2 and 22. The energy-effi cient LED modules with a PATLITE patented prism cut provide full and brilliant illumination. The signal towers reach IP65 protection.

All explosion-proof PATLITE signaling devices comply with the standard CE/ATEX/NEC certifi cates.

Patlite Europe GmbHAm Söldnermoos 8, 85399 Hallbergmoos, Germany

Tel: +49 811 998 197700 Email: [email protected] www.patlite.com

PATLITE presents a new series of signaling devices, which have been especially designed for rough environments and explosive atmospheres.

PECM113.indd 69 23/02/2013 15:43:53

Page 70: PECM - Issue 2 2013

PECM113.indd 70 23/02/2013 15:43:56

Page 71: PECM - Issue 2 2013

January-March 2013 PECM 71

Storage, Handling & Distribution

Lendon Containers specialise in marine containers, one of our activities is in the conversion of these units as industrial modules. Once completed they can be transported to site either within the UK or shipped abroad and can be moved from one site to another in an easy and convenient manner.

In conjunction with the workshop we can offer from a part to complete fi t out, with the client either supplying equipment to us or taking the part fi nished unit to their facility, for them to complete the work

At the workshop we can offer a comprehensive service to fabricate, machine and weld – stainless steel, mild steel and aluminium

There are a multitude of potential uses from water treatment, data logging to laboratories and so we would be very happy to discuss any potential requirements you may have

For further information please contact :

Lendon Containers Ltd60 Webbs RoadLondon SW11 6SETel : 020 7350 1940Fax : 020 7350 1962email : [email protected]

Lendon Containers Ltd

6DIH6HFXUH6WRUDJH+LJKO\,QIODPPDEOH/LTXLGV

7(VDOHV#OZHOWGFRXN:ZZZOZHOWGFRXN

KU)LUH0XOWL+D]DUG$FFUHGLWDWLRQ&DSDFLWLHVWRP6LQJOH0XOWL&RPSDUWPHQWV

7UXH6HFRQGDU\&RQWDLQPHQW&ODVV/HDN'HWHFWLRQ

RapidRoll - The door you can‘Fit & Forget’

),)//-/&0".-0%/$$/)%/

0000,)".'*/-*,$+%.'*/-*,$+%.

/$$0+'0( .+*0!.+-0( $,%(*,.)

/0,/0!.+

# )',&/0.-0.+*',&/0$.%(*,.)

# ,/0-/+,-/&# //$0."0'/%+-,*!# .%($0,)&' //&0.-0 -/''+-/0.)0*/0%+-*(,)

# /+,-/&0. /),)0' //&

# ("/*!0-/+,-//)*'# -/+/)%!0()&0*! /0."0*-("",%

# .+-0 +&/*

# 0"-//0',*/0'+-/!# 0&..-0!.+0%()0,*00.-/*"-.0.+-0-()/0."00.&/$'

/+/'*(0+.*/0()&,)0()0,(&

PECM113.indd 71 23/02/2013 15:44:07

Page 72: PECM - Issue 2 2013

PECM113.indd 72 23/02/2013 15:44:09

Page 73: PECM - Issue 2 2013

January-March 2013 PECM 73

/HYHOGHWHFWLRQDSSOLFDWLRQVRIKHDYLO\ IRDPLQJDQG¿OPLQJ OLTXLGVDUHDGLI¿FXOW WDVN IRUVWDQGDUGFDSDFLWLYHsensors today. Thicker container walls require time consuming set-up procedures. Material build-up of adhesive PHGLDRQWKHLQVLGHRIFRQWDLQHUZDOOVFDXVHVHQVRUVWRUHSHDWHGO\IDOVHWULJJHU1RZIRUWKH¿UVWWLPHWKHUHLVDcomprehensive solution – a new, self-adjusting capacitive sensor technology that overcomes all these problems.

SMARTLEVEL™ sensors provide cost-effective, reliable, and easy-to-use point-level monitoring for a wide array of industries and applications. Balluff offers this technology exclusively in a wide array of sensor FRQ¿JXUDWLRQVWRDFFRPPRGDWHDIXOOUDQJHRIGLIIHUHQWDSSOLFDWLRQVDQGenvironments.

To receive a copy of the capacitive sensor application guide and catalogue contact Balluff Sales on 0161 282 4700, email: [email protected], www.balluff.co.uk.

Capacitive sensors are commonly used for presence detection of a wide range of non-metallic objects and liquids. In order to get reliable and dependable sensing results with standard capacitive sensors, the user is required to use a trim potentiometer to adjust the signal sensitivity to meet the application UHTXLUHPHQWV +HUH OLHV WKH PDMRU GLI¿FXOW\Standard capacitive sensors often false trigger when confronted by applications involving OLTXLGV ZKLFK FUHDWH ¿OPV RU PDWHULDO EXLOGup on container walls or the sensor itself. 6HWXS SURFHGXUHV DUH XVXDOO\ GLI¿FXOW WLPHconsuming, and error-prone – or just plain impossible. Frequent re-adjustments offer only short-term results and the overall operational reliability of conventional capacitive sensors is unsatisfactory.

Balluff SMARTLEVEL Technology, Accurate, Reliable Level Detection

Enter SMARTLEVEL™

SMARTLEVEL™ sensors eliminate virtually all problems associated with standard capacitive level sensor technology. SMARTLEVEL sensors accurately sense correct levels of aqueous or high conductive liquids through glass or plastic walls up to 10 mm thick. Technology allows these sensors to automatically distinguish between non-metallic tank walls, possible interferences from foaming of material build-ups, and the true level in the tank.

The sensors also re-adjust themselves when confronted with changing container compositions during checking procedures or changes in liquids during different production runs. These sensors are simple to install and require no teach-in. They ¿QGWUXHOLTXLGOHYHODXWRPDWLFDOO\IRU³PRXQWDQGIRUJHWLW´FRQYHQLHQFH

The sensors are suitable for all water-based liquids and other highly conductive liquids.

PECM113.indd 73 23/02/2013 15:44:12

Page 74: PECM - Issue 2 2013

Quality, reliability, innovation and outstanding customer service have made Thames Side Sensors Ltd a worldwide leader in Industrial and Process weighing load cell technology.

Thames Side Sensors provides the ultimate in load cells and loading assemblies for tank, vessel, silo, process and truck/axle weighing applications as well as for incorporation into many types of process machinery.

Now part of the family owned Tecnicas group, among WKHWRS¿YHFRPSDQLHVLQJOREDOORDGFHOOPDQXIDFWXUHThames Side Sensors Ltd has its origins in the 1970’s. :LWKKHDGTXDUWHUVLQWKH8.DQGRI¿FHVVDOHVSDUWQHUVand customers in over 60 countries in every kind of process industry we have a truly global presence. Over 30 years of supplying the world’s process industries in sectors as varied as offshore, cement, food, pharmaceuticals, minerals, metals, plastics and others has given us an un-rivalled, extensive, applications knowledge which allow us to properly advise customers on the correct selection and application of our products, LQFOXGLQJ$7(;FHUWL¿HGSURGXFWVIRUKD]DUGRXVDUHDV

All of our load cells are manufactured under strict quality control with full traceability and each and every one is individually tested to ensure their performance. Components and raw materials are sourced from world class manufacturers with an emphasis on quality. Our FRQ¿GHQFHLQRXUPDQXIDFWXULQJPHWKRGVDOORZVXVWR

offer a 5 year warranty against manufacturing defects on the majority of our products.

Customer satisfaction with both the products and service we provide has always been the key to the success of our business and our company goals and objectives are geared around this. Thames Side Sensors Ltd is fully committed to quality and has ,62FHUWL¿FDWLRQ

:HFDUU\DVLJQL¿FDQWVWRFNDWRXUIDFLOLWLHVLQWKH8.ensuring rapid delivery times when required.

Our mounting assemblies, which are designed in accordance with Eurocode 3 practices, form a crucial part of the weighing system. Use of the latest Finite Element Analysis (FEA) software pinpoints the optimum design of assembly for correct operation and rigorous manufacturing and test procedures ensure total reliability under the harshest of conditions. Our patented designs of mounting assembly, LeverMount® and MasterMount®, allow rapid installation and removal of the load cell without jacks or special tools even when the vessel is full, providing major savings on installation costs. Options of special anti-corrosive load cell coatings to provide additional protection in extreme environments where stress corrosion could occur and high temperature load cells for operation up to 150C are just a few examples that set us apart from the rest.

Made to Measure – Load Cells from Thames Side Sensors Ltd

Tel: 00.44[0]1189.728001 Fax: 00.44[0]1189.412004 www.thames-side.com

PECM113.indd 74 23/02/2013 15:44:20

Page 75: PECM - Issue 2 2013

Also available from Dixon:

/2

Introducing Dixon’s New Valve Actuation Shop

Dixon - The Right Connection for Actuation Valves and Bespoke Fabrication

*24 Hour Shipping available on most valve automation including fabricated specials. Contact Dixon for further information.

Dixon Group Europe Limited

24 HOUR

SHIPPING*

PECM113.indd 75 23/02/2013 15:44:25

Page 76: PECM - Issue 2 2013

PECM113.indd 76 23/02/2013 15:44:27