Pascal Chourrout - Albi 2008. C GNLST C MLGTYTQDFNKFHTFPQTAIGVGAP-NH2 + ----- + Amide.
-
Upload
gauthier-bianchi -
Category
Documents
-
view
111 -
download
1
Transcript of Pascal Chourrout - Albi 2008. C GNLST C MLGTYTQDFNKFHTFPQTAIGVGAP-NH2 + ----- + Amide.
Pascal Chourrout - Albi 2008
Pascal Chourrout - Albi 2008
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2+-----+ Amide
1968- Radioimmunoassay for thyrocalcitonin
1973- Alcohol-stimulated calcitonin release in MCT
1974- Calcitonin release provoked by intravenous pentagastrin in MCT
1974- Multiple immunoreactive forms of Calcitonin in human plasma
1980- Biosynthesis of human Calcitonin: Evidence for a prohormone
1984- The human calcitonin gene is located on the short ARM of chromosome 11
1984- The complete sequence of human preprocalcitonin
Pascal Chourrout - Albi 2008
Pascal Chourrout - Albi 2008
Pascal Chourrout - Albi 2008
Cancérologie (Ghillani et al -1989)• PCT corrélée à CT dans CMT• PCT élevée dans tumeur NE et HC
Grands brûlés (Nylen ES et al. – 1992)• Serum procalcitonin as an index of inhalation injury in burns
Pascal Chourrout - Albi 2008
Mise au point d’un test IRMA spécifique de CT-KC (valeurs normales inf à 0.1 ng/ml)
Etude chez les grands brûlés (Percy):• PCT < 5 ng/ml ↘: patients sans infections• PCT ↗ 20 ng/ml: sepsis• PCT ↗↗ chez 3 patients présentant un
sepsis sévère avec complications(dont un thyroïdectomisé)
Pascal Chourrout - Albi 2008
79 enfants (1 jour à 12 ans) hospitalisés en pédiatrie.
Pascal Chourrout - Albi 2008
Dandona et al (1994) Volontaires sains LPS
Pascal Chourrout - Albi 2008
Brunkhorst et al (1998) Iatrogène Acineto baumanii
Pascal Chourrout - Albi 2008
Chez Hamsters infectés, PCT corrélée à mortalité
Pascal Chourrout - Albi 2008
Administration de PCT augmente la mortalité
Administration d’Anticorps anti-PCT diminue la mortalité
Dosage des cytokines sur sang total après addition in vitro de LPS(The immunomodulatory role of PCT - Bienvenu et al. 2001)
Pascal Chourrout - Albi 2008
Pascal Chourrout - Albi 2008
Pascal Chourrout - Albi 2008
Grands brûlés Polytraumatisés (premiers jours) Maladie de Kawasaki
Certains carcinomes bronchiques, HC Cancers médullaires de la thyroïde
Malaria Infections fongiques systémiques
Insuffisant rénal en dialyse péritonéale Premiers jours du nouveau-né (48h)
3–4h avant la sécrétion sérique de PCT Antibiothérapie efficace initiée Infections localisées (appendicite aiguë non
compliquée) Infections à bactéries intracellulaires
(pneumopathies atypiques, tuberculose, brucellose, maladie de Lyme)
Pascal Chourrout - Albi 2008
(selon les seuils utilisés)
Marqueur diagnostique
Marqueur pronostique
Aide à la conduite de l’antibiothérapie
Pascal Chourrout - Albi 2008
Diagnostic différentiel du SIRS
Pascal Chourrout - Albi 2008
Evaluation du pronostic
Evaluation de l’efficacité du traitement
Pascal Chourrout - Albi 2008
Pascal Chourrout - Albi 2008
Procalcitonin to Distinguish between Bacterial and Aseptic Meningitis: a European Multicenter Validation Study - F Dubos et al, ESPID, Basel 2006
Pascal Chourrout - Albi 2008
Meningitest European Society for Paediatric Infectious Diseases, Porto, May 2007- F Dubos
ProResp: décision instauration ATBChrist-Crain Lancet 2004
Pascal Chourrout - Albi 2008
ProCAP: durée ATBChrist-Crain
Am J Respir Crit Care Med. 2006
Guibourdenche J et al. and Porquet D. Ann Clin Biochem 2002
Pascal Chourrout - Albi 2008
Joram N et al, Arch Dis Child Fetal Neonatal, 2006
Dosage sur sang de cordon
Nouvelles perspectives(Généralisation de dosages
sensibles)
Autres hormokines Pro-ANP Pro-AdrenomedullinAdrenomedullin, a hypotensive peptide found in human pheochromocytoma, consists
of 52 amino acids, has 1 intramolecular disulfide bond, and ws a slight homology with the CGRP
(Pro-BNP)
Pascal Chourrout - Albi 2008