Hometown News May 21, 2015

FREE Publication

Hometown News

Atkinson Well & Pump Ltd.

• GEO Thermal• Pump & Water Systems• Sales, Service & Parts

State Licensed • Nationally CertifiedServing You Since 1942

320-836-2597800-450-2597 Rodney Atkinson • Freeport

MN Lic. #2114

Grey Eagle, Burtrum, St. Rosa, Freeport, Upsala, Albany, Holdingford, St. Anna, Avon, Swanville, MelroseMay 21, 2015

Long Prairie (320) 732-2131Melrose (320) 256-4228Sauk Centre (320) 352-6591

Family health care - where you need it

www.centracare.com

On TheInside...

Harvey Mackay Page 2Obituaries: Tiemann, Imdieke, Baum, Klein, Pages 4-5 Kierzek, Tuorila Sheila Ripplinger Page 6Dave Says Page 6Notes from the Capitol 0Local Municipality Minutes Page 11 Burnhamville Township

Equal Housing Opportunity

Email: [email protected]

www.lakehomesbybrandon.com

Brandon Kelly, Broker-Realtor320-491-6107 or 320-285-3222

NEW LISTINGS WANTED! Call Me For A

Free Market AnalysisSee

Waterfront Listings

on page 16!

Photo by Lori Young.

Mon. - Sat.: 7 AM - 7 PM; Sun.: 9 AM - 5 PM1241 Co. Rd 10, Albany • 320-845-4321

Albany Fleet SupplyPeternell Greenhouse

Bare Root or Potted

Roses$4.25 - $4.95

Our Greenhouse is Open!

ST. ROSALUMBER INC.ST. ROSALUMBER INC.

www.strosalumber.com29033 Co Rd 17 • Freeport, MN

56331 - In St. Rosa

320-836-22841-888-276-1751

The solid PVC Decking has enhanced surface technology allowing the capabilities to offer variegated color options which incorporates the authentic color variations

of natural wood into every board without sacrificing performance.

• Low Maintenance Decking• Fade, Mold & Stain Resistant• Lifetime Warranty

Have a Safe & Enjoyable Memorial Day Weekend!

www.freeportstatebank.com

Freeport • 320-836-2126 Melrose • 320-256-7208

New Munich • 320-837-5297 Greenwald • 320-987-2265

Freeport State Bank will be CLOSED on Monday, May 25 to observe Memorial Day.“Customer Service Is Our Priority.”

320-285-4318

4:30 PM DAILY DINNER SPECIALS

Mon-Thurs: 3 pm-1 am • Fri-Sun: 10 am-1am

Monday: 1 Topping Pizza & Pitcher $10Tuesday: App., 2 entrees & desert $30Wednesday: All You Can Eat Crab Legs Thursday: Chicken & Rib Dinner $10Friday: Prime Rib • Fish & Shrimp • Lobster Tail Saturday: Prime Rib • Chef Special Sunday: Brunch 10-1 p.m. • Black ‘n’ Bleu Prime Rib

Sunday, June 7th: • 2-6 PM Alan Godage & Sundown

Friday, May 29th

DJ & Karaoke

Starting Wed., June 3rd: Summer

Beanbags & Volleyball Leagues

Friday, June 12th: GEM Fest Karaoke Contest

Real Estate ServicesBenchmark

www.benchmarkrealty.com

Melrose Just Listed: Nicely maintained Rambler in quiet neighborhood close to school and church. Maintenance free siding, newer shingles, large deck with private back yard, nicely finished on all levels! Loft with double whirlpool, kitchen slide outs and other extras! See website!

320-256-8000

208 Main St W • Freeport, MN320-836-2177

Hours: Mon.-Fri. 7 am-5 pm; Sat. 8 am-12 pm

HennenFloor Covering

TRUCK LOAD SALEON CARPET REMNANTS!

“The Complete Flooring Store”

12 ft. & 15 ft.Wide

Phone: 320-746-2819 • Toll Free: 800-510-2819Hours: Mon.-Fri. 8 am - 4:30 PM; Sat. 8 am-noon.

www.opatzmetalsinc.com

Family Owned & OperatedGary & Jordy Opatz, Owners

120 Washington West, Holdingford, MN

Remember The FallenHave a Safe & Happy Memorial Day

We will be open Saturday, May 23 from 8am until noon, but closed Monday, May 25 in observance of Memorial Day!

320-285-8085 800-645-6336

Building Supplies

HOURS:M-F: 7:30-5;

Sat.: 8-12Grey Eagle, MN

Porch & Patio Enclosures

Hometown News29442 120th St.

Grey Eagle, MN 56336Phone: 320-285-2323

Website: www.hometownnews.biz

Email: [email protected]/hometownnews

Published ByJohn and Lori Young

The Hometown News is a weekly publication, which is published and

distributed every Thursday.

Ad & News DeadlineThe deadline for news and advertising

in the Hometown News is 5 P.M. MONDAY.

Sales Staff• Jan Theisen

Cell: 320-333-9774Email: [email protected]

• Lori YoungOffice: 320-285-2323Cell: 612-597-2998

Email: [email protected] Hosting - John Young

Office: 320-285-2323Cell: 612-597-4499

Classified AdsPersonal Classifieds: Garage Sales, For Sale Items, Wanted (Personal) Free up to 20 words; 25¢ for each

additional word. 20 words or less can be emailed. Classifieds over the word

limit must be prepaid.Business Related Classifieds:

Wanted (Items for Profit), Help Wanted, For Rent

$5.00 for the first 20 words, 25¢ per each additional word.

Mail to: Hometown News, 29442 120th St.,

Grey Eagle, MN 56336.email: [email protected]

Card of ThanksCards of Thanks is $2.50 for the first

50 words, 10¢ per each additional word. Must be prepaid. To be billed: a

$5 minimum applies.

Press ReleasesPress releases are welcome. They MUST be emailed to:

[email protected].

Letter to the EditorLetters and articles of opinion are welcomed. Letters should be short

and to the point. We reserve the right to edit lengthy letters.

Email to: [email protected].

AnnouncementsAnniversary open house, births,

birthday open house, engagements, weddings and obituaries are free of

charge for one publication. To have it published twice costs $10.

A prestamped, self addressed envelope is required to return photos.

SubscriptionsThe subscription rates for

13 weeks is $16.50 26 weeks is $33.0052 weeks is $66.00

Mail to: Hometown News, 29442 120th St.,

Grey Eagle, MN 56336

• Hometown News • Thursday, May 21, 2015

Upcoming Events

If you have an upcoming event or meeting, please let us know by email: [email protected] or call 320-285-2323.

FRIDAY, MAY 22 • Swanville 2K/5K Fun Run/Walk be-ginning at 1 p.m.

SUNDAY, MAY 24 • Grey Eagle/Swanville Knights of Columbus Sausage & Egg Breakfast from 8 a.m.-12:00 noon, at St. Joseph’s Church Hall, Grey Eagle.

MONDAY, MAY 25 • Grey Eagle: 8:45 a.m. Program at St. Joseph’s Cemetery, 9:15 a.m. Parade, 10:15 a.m. Program at Lakeview Cem-etery. • Burtrum: 11 a.m. Parade, Program at Moses Dane Cemetery, Potluck to follow at the Community Center.

WEDNESDAY, MAY 27 • Grey Eagle Senior Center Potluck/Bingo Party at 5 p.m. at the center.

SATURDAY, MAY 30 • Pelican Peak 4-H Recycling Event from 8-11 a.m. at the Freeport Fire Hall. See ad on page 6.

WEDNESDAY, JUNE 3 • Helping Hands Outreach for Elders Annual Meeting at 7:30 p.m. at the Hold-ingford City Center.

THURSDAY, JUNE 4 • Diocesan Council of Catholic Wom-en 25th Annual Fun, Food and Fund Day starting at 8 a.m. at St. Benedict Church, Avon. • Grey Eagle Burtrum Lions American Red Cross Blood Drive from 1-7 p.m. at St. Joseph’s Catholic Church, Grey Eagle.

FRIDAY, JUNE 12 • Grey Eagle St. Joseph’s Church

Dinner & Auction starting at 5:30 p.m. at the American Legion, Melrose. See ad on page 6. • “Grandpa, My Best Friend” Book Launch Party from 6-8 p.m. at the Red Barn in Freeport.

ALBANY TOWNSHIP • Meets the fourth Monday of the month at 7:30 p.m. at the Albany City Hall. • Planning Commission meets the second Tuesday of the month at 7:30 p.m. at the Albany City Hall.

BURNHAMVILLE TOWNSHIP • Meets the last Tuesday of the month at 7 p.m. at the Burtrum City Hall.

BURTRUM CITY COUNCIL • Meets the first Monday of the month at 7 p.m.

FEET FIRST CLINIC • Meets every 1st Tuesday morning at Holdingford City Hall.

FOOD DISTRIBUTION • Ruby’s Pantry Food Distribution first Saturday of the Month from 10-11 a.m. at River of Live Church, Sauk Centre.

FREEPORT CITY COUNCIL • Meets the last Tuesday of the month at 7 p.m.

GREY EAGLE CITY COUNCIL • Meets the second Tuesday of the month at 7 p.m.

GREY EAGLE SENIORS • Exercise Classes every Monday, Wednesday, Friday at 9:30 a.m. at the Grey Eagle Senior Center.

GREY EAGLE TOWNSHIP • Meets the first Monday of the month at

8 p.m.HELPING HANDS EXERCISE

• Exercise and Line Dancing meets ev-ery Wednesday at 9:15 a.m., Holdingford City Hall.

HELPING HANDS LUNCHEON • Monthly Community Luncheon meets every 2nd Thursday at 2 p.m., Hold-ingford Legion. HELPING HANDS LUNCH BUNCH

• Meets the last Wednesday of each month. SUCCESSFUL SINGLES FOR WOMEN • Meets every Friday at 7 p.m. at Ti-tus-2 Ministry Center, Alexandria.

SUNSHINE CLUB • Meets every Monday, weigh in at 9 a.m. at the Village View Apartments, Grey Eagle.

ST. CLOUD SINGLES CLUB • Dance & Activities every third Fri-day from 8-12 at the Waite Park Legion.

ST. ROSA CITY COUNCIL • Meets the third Monday of the month at 7 p.m. at the Community Park building.

SWANVILLE CITY COUNCIL • First Tuesday after the first Monday of the month at 7 p.m.

SWANVILLE TOWNSHIP • Meets the second Tuesday of the month at 8:30 p.m. at the Swanville Fire Hall.

UPSALA CITY COUNCIL • Meets the first Monday of the month at 7 p.m.

Weekend WeatherSaturday Sunday

Partly cloudy. High: 67 Low: 51

Partly cloudy. High: 67 Low: 51

Temperatures Date High Low 5/13 69 43 5/14 58 49 5/15 62 45 5/16 65 45 5/17 73 40 5/18 40 34 5/19 56 34

Friday

Mostly sunny. High: 73 Low: 48

not in school once in your lifetime; you are in school all of your life. Education is an investment, not an expense.

My father taught me about time management. I still remember him telling me if I wanted to go fishing, I should be on the dock at 2 p.m. sharp. There I was at 2:05 p.m., waving bon voyage to my dad who was driving away in the boat without his fishing buddy. Tough love, lesson learned.

There were several tough love lessons that really helped me in business. I remember one in particular.

“Just slide down the banister, and I’ll catch you,” he urged.

“But how do I know you’ll catch me?” I asked.

“Because I’m your father, and I said I would catch you.”

I slid and landed on the carpet. As I dusted myself off, my dad announced, “Be careful whom you trust when it comes to business. Remember that business is business.” This bumpy ride lesson stuck with me and helped me make sure that any business arrangements are backed up with yards of paper. Agreements prevent disagreements.

My folks also taught me that I could make a difference in the world. They always pointed out how ordinary people did wonderful things. It only takes one person to make things better. Harvey Mackay continued to pg 3

Lessons learned from my parents -By Harvey MackayAs we

c e l e b r a t e Mother’s Day and Father’s Day, I get a little nostalgic thinking about some of the life lessons I learned from these two remarkable people in my life.

When I speak to corporate audiences, I often

include a lesson about integrity and corporate ethics: “Act like your mother is watching.” I’ve lived my life that way, and it’s never failed me.

My mother was a school teacher and taught me the power of education. I didn’t always listen eagerly, but it instilled in me a desire of continuous education throughout my life. You are

My dad insisted that 25 percent of my time should be spent on volunteering, advice I’ve continued to follow. When you volunteer, in addition to the benefit to the organization, you have an unusual opportunity to hone your selling skills, learn how to run meetings, prepare

Hours: Wed. - Fri:

11-6; Sat: 9-12

Style ‘n Go320-285-7780 Grey Eagle

SHOW OFF Your PRETTY TOES

with a Pedicure!

Harvey (top left) and his sister, Margie, with their parents.

Hometown News • Thursday, May 21, 2015 •

reports, serve on committees, supervise others, handle rejection and many other skills that can help you in your career, all while serving your community.

One of the most powerful things you can do to influence others is to smile at them, my dad said. Not to be outdone, my mother used to tell me that a smile is an inexpensive way to improve my looks, “If you’re happy, tell your face.”

About reputation, my dad quoted the adage, “You spend your whole lifetime building a good name and reputation, and one foolish act can destroy it.”

I took his words to heart, and aside from building long-term relationships, there is nothing more important than a good reputation in building a successful business. Without a positive reputation, success is elusive.

There are many people who were at the top of their game when they made one fatal mistake – due to poor judgment, arrogance or the inability to do the right thing. Reputations are destroyed, and all the money in the world can’t buy them

back. Also important, Jack Mackay taught

me about networking. I was fortunate. My father headed the Associated Press in St. Paul, and was a master networker. He got me started at age 18. He sat me down and gave me the simple yet effective suggestion of putting every person I met for the rest of my life onto a Rolodex card, now called a contact management system. He told me to put a little information about each person on the back of the card, and to update it.

And now here is the real key. You must find a creative way to keep in touch. Little did I know how much my father’s

Harvey Mackay continued from page 2 advice would dramatically help me in the future and actually change my life.

When I was a kid, my dad would take me to his office. It was a wonderful place. The walls were covered with photos, tickets and other memorabilia. Linking everything together were my dad’s favorite aphorisms. Some were straight from fortune cookies. I discovered that these little gems were a great way to remember a lesson. As a result, I’ve been an aphorism junkie all my life, and end all my book chapters and columns with a Mackay’s Moral. Thanks, mom and dad.

Mackay’s Moral: Lessons learned in childhood are anything but child’s play.

Reprinted with permission from

nationally syndicated columnist Harvey Mackay, author of the New York Times #1 bestseller “Swim With The Sharks Without Being Eaten Alive,” “We Got Fired!...And It’s the Best Thing That Ever Happened to Us,” “The Mackay MBA of Selling in the Real World,” and “Use Your Head To Get Your Foot In The Door.”

DK’S Tree & Landscaping, LLC.DK’S Tree & Landscaping, LLC.Trim & Remove Trees, 55 ft. Boom, Brush Removal,

320-630-0670 - David KuhlFree Estimates, Fully Insured

Swanville • www.dkstree.comAccept VISA, Discover

or Master Card

Stump Grinding & Removal,Hedge Trimming,Firewood Available Including Delivery, Residential Landscaping & Bobcat Work

Art Johnson Contruction

320-285-5430

Room Additions to full Home Construction

Grey Eagle, MN

Licensed • InsuredBonded

Nancy’sBait & Tackle

320-285-2405

Located Between Grey Eagle & Upsala along Co. Rd. 24 miles west of Upsala - 4 Miles East of the Rock Tavern

OPEN 7 DAYS A WEEK!Areas Largest Selection of Bait & Tackle

Golden Shiners, Silver ShinersSpottail Shiners, Rainbow Chubs, Leeches- All Sizes by the Box or Pound

Suckers-All Sizes

Hot Meat deals!

May 21 thru May 27, 2015

Small town stores working together to

bring big savings to our home towns!

Upsala • 320-573-5050Mon.-Fri. 7:30 am-7 pm; Sat. 7:30 am-6:30 pm; Sun. 8 am-12:30 pm

Paul & Kathy’s Supermarket

Bob & Frans Supermarket

Swanville • 320-547-2311Mon.-Fri. 7:30 am-8 pm; Sat. 7:30 am-6:30 pm; Sun. 8 am-12:30 pm

Jolly Time Popcorn 10.5 oz. 2/$4.00

Ritz Crackers 8 oz. 2/$6.00

Ribeye $10.99 lb.

Our Lean Ground Beef 3 lb. or more $4.29 lb.

Lays Potato Chips 2/$5.00

Mrs Gerry’s Potato Salad, Coleslaw or Macaroni Salad

40 oz -3 lb. tub $3.99

Velveeta 2 lb. block

$6.99

Nabisco Easy Cheese 8 oz. $3.99

Top Sirloin $6.99 lb.

Keebler Cookies Stripes, Deluxe Grahams,

Peanut Butter Dreams, etc. $2.99

Also makes a great smore w/melted chocolate.

Bush’s Baked Beans 28 oz. 2/$4.00

Kraft BBQ Sauce 18 oz. $1.59

PRODUCE SPECIALS

Country Style Ribs $1.59 lb.

Smores PackageHershey’s Candy Bars 6 pk. $4.49

Kraft Marshmallows 10 oz. $1.39

Nabisco Honey Grahams 14.4 oz. $3.49

Scweigert Old Fashioned Wieners

25 oz. $7.99

• COUPON •

Expires 5-27-15

Jell-O 3 oz. 5/$4.00With Coupon (kraftjel-.50 #805)

Abby’s Large Hamburger Buns

8 ct. 2/$5.00

$3.99 for 15 lb. or more!

• COUPON •

Expires 5-27-15

Kraft Miracle Whip 30 oz.

$2.99 With Coupon (whip-200#802)

• COUPON •

Expires 5-27-15

Kool-Aid 8 qt. $1.99

With Coupon (Kool-1.00 #809)

Philadelphia Cream Cheese 8 oz. $2.39

Cantaloupe $2.99 each

Honey Dew $2.99 each

Cherries $3.99 lb.Broccoli $1.99 bunch

Sweetcorn 10/$5.00Baby Carrots 1 lb. $1.19

Red Potatoes 5 lb. $1.69Celery $1.19

Kraft Dressings 16 oz. $2.79

Heinz Tomato Ketchup 38 oz. $2.99A-1 Steak Sauce

10 oz. $3.99

Royal Oak Charcoal 16.6 lb.

$6.99

MEMORIAL SALE

Nabisco Wheat Thins variety 7.6-9 oz.

2/$6.00

Creamette Noodles 7 oz. pkg. 5/$5.00

MN Gold Wieners 24 oz. $7.99

MN Gold Thick Bacon 20 oz. $5.99

Paul’s Specialty Brats 5 pks. $20.00

Over 30 varieties to choose from!

Only Available at Paul & Kathy’s

Pepsi 12 pks 3/$12.00


Obituaries

Lorraine H. ImdiekeLorraine H.

Imdieke, age 88 of Meire Grove, died peacefully on Thursday, May 14, 2015 at the CentraCare Health Nursing Home in Melrose, Minnesota.

A Memorial Mass of Christian Burial was held Tuesday, May 19

at St. John the Baptist Catholic Church in Meire Grove with Rev. Marvin Enneking officiating and Rev. Ken Thielman concelebrating. Inurnment was in the parish cemetery.

Lorraine Helen Worms was born July 31, 1926 in Spring Hill Township, Stearns County, Minnesota to Lambert and Agnes (Ellering) Worms. On May 21, 1946 she married Anthony Imdieke at St. John’s Catholic Church in Meire Grove. The couple farmed south of Melrose; retiring in 1970. Lorraine then worked at the Melrose Hospital for seven years.

She was a member of St. John the Baptist Catholic Church in Meire Grove, St. Mary’s Society, St. John’s Mission Group, and Poor Soul’s Society.

Lorraine enjoyed golfing and won the title Meadowlark Ladies Champion at the age of 75 years. She also enjoyed fishing and spending the winters in Arizona.

Survivors include her children, Dick (Joni) Imdieke of Meire Grove and Sandy (Patrick) Braegelmann of Big Birch Lake; four grandchildren, Shawn (Kristi) Imdieke, Kristi Imdieke, Nicole Braegelmann, and Ashley (Cory) Groves; three great-grandchildren, Aliya, Aiden Imdieke, and Everly Groves; and brothers, Ray Worms of Melrose and Melvin (Edna) Worms of Melrose.

Lorraine was preceded in death by her husband, Anthony “Tony” Imdieke on July 9, 2012; parents; brothers, Herbert, Luverne and Leonard Worms; sister, Bernice Athmann; sisters-in-law, Frances, Alma, Loretta, and Mary Ann Worms; and brother-in-law, Norb Athmann.

Arrangements were made with Patton-Schad Funeral & Cremation Services of Melrose.

Irene TiemannI r e n e

Tiemann, age 101 of Melrose, died peacefully on Thursday, May 14, 2015 at the CentraCare Health Nursing Home in Melrose, Minnesota.

A Mass of Christian Burial was held at 11 a.m. Saturday, May 16 at St.

Mary’s Catholic Church in Melrose with Rev. Vincent Lieser officiating. Interment was in the parish cemetery.

Irene Otte was born March 15, 1914 in Melrose, Minnesota to Bernard “Ben” and Catherine (Hemmesch) Otte. She married Christ Tiemann on May 28,

1940 at St. Boniface Catholic Church in Melrose. She was a member of St. Mary’s Catholic Church in Melrose where she was a member of St. Mary’s Choir for 67 years, Christian Mothers, and Sts. Bernard and Elizabeth’s Society. Irene enjoyed socializing, family functions, traveling, and playing cards, especially 500.

Survivors include her sisters, Anna Mae Denne of Melrose, Bonnie Mickels of Moorhead, and Betty Dickhaus of Melrose; sister-in-law, Irma Otte of Sauk Centre; and many nieces and nephews.

Irene was preceded in death by her husband, Christ Tiemann on August 8, 1974; brothers and sisters, Joseph Otte, Catherine Otte, Casimir Otte, Marie Rademacher, and Sister Edna Otte.


Steven P. “Steve” BaumS t e v e n

P. “Steve” Baum, age 59, of Burtrum, died after c o m p l i c a t i o n s from leukemia on Friday, May 15, 2015 at the St. Cloud Hospital in St. Cloud, Minnesota.

A funeral service was held

Tuesday, May 19 at Brighter Days Family Church in Burtrum with Rev. Anna Payne officiating. Interment followed at Moses Dane Cemetery in Burtrum.

Steven Paul Baum was born December 24, 1955 in Little Falls, Minnesota to William and Donna (Oldakowski) Baum. He grew up on the family farm in Center City, Minnesota and later settled in Burtrum. He married Connie Husom and later divorced. He then married Kay Sharp and they later divorced. Steve owned and operated Baum’s Logging & SPB Machining in Burtrum. He was the Mayor of Burtrum in the early 90’s and a

member of Brighter Days Family Church in Burtrum. Steve had a love for God, his family, and church family.

He enjoyed camping, fishing, blueberry picking, and had a passion for Classic Mopars. His hobby was repairing, restoring, and showing his cars.

Survivors include his dear friend, Sheila McCoy of Burtrum; children, Paul (Gina) Baum of Litchfield and Marlea (Jamie) Eggerth of Little Falls; four grandchildren; brothers and sisters, Tom (Aeron) Baum of Little Falls, Sue (Doug) Hampson of Maple Grove, Michael (Julie) Baum of Long Prairie, Scott (Brenda) Baum of Sauk Centre, and Deb (Wade) Wittwer of Little Falls; and many nieces and nephews.

Steve was preceded in death by his parents, William “Bill” and Donna Baum.

Serving as casket bearers were Darrell, Darren, Luke, Shane, Nathan, and Mathew Baum. Honorary bearers were Dana Ritter, Jamie Hampson, and Michael Hampson.

Arrangements were made with Patton-Schad Funeral & Cremation Services of Grey Eagle.

Three Private Meeting Rooms Available Handling Groups of 20-150 Call for Info & Reservations

Kitchen Restaurant Hours:Monday - Thursday: 7 a.m. - 9 p.m.Friday - Saturday: 6 a.m. - 10 p.m.

Sunday: 6 a.m. - 9 p.m.

320-845-21681 Block off I-94 Albany Exit

1004 Shamrock Lane • Albany

Family RestaurantSTUBBY’S TAVERN

MONDAY: VALUE MEAL $6.25(Includes Cup of Soup or Salad)

TUESDAY 4:30-9 PM : CHICKEN FRY (All You Can Eat) $7.99 • Senior Price $7.50 • Kids 8 & under: $4.00

WEDNESDAY: (All You Can Eat) BBQ RIBS $8.99

THURSDAY: (All You Can Eat) Spaghetti $8.99

FRIDAY: (All You Can Eat) FISH FRY $7.99

SATURDAY 5-Close 8 oz. SIRLOIN STEAK & SHRIMP $13.99

SUNDAY 10:30-1:30 PM

3-MEAT SMORGASBORD $8.992-Close: Chow Mein (Includes Cup of Soup):

Full Order $6.99; 1/2 Order $3.99

• WEEKLY SPECIALS •

Tuesday: 5-9 PMAll you can eat

PIZZA & WINGS only $6.95

Wednesday: 5-9 PMAll you can eat

TACO BAR $6.50 Includes Beef & Chicken!

Thursday: 5-9 PMAll you can eat

CHICKEN & SWEDISH MEATBALL BUFFET $8.95

Includes Salad Bar

Friday: 5-10 PMAll you can eat

FISH FRY DINNER $9.95 Includes Salad Bar

Join Us for our Nightly Dinner Specials!Saturday: 5-10 PM 12 oz. PRIME RIB

DINNER $14.95 or ½ RACK RIB DINNER

only $10.95 Both Include Salad Bar

Sunday: 11 AM-2 PM All you can eat

CHICKEN & SMOKED SAUSAGE

(from Meat Shoppe, Melrose) $9.95

Includes Salad Bar

Every Friday & Saturday: 9-CloseBe Your Own DJ - FREE Juke Box

HAPPY HOUR SPECIAL Every Day from 3-6 PM: $2.50 Domestic Beers

& Rail Drinks

Summer Hours: Closed Mondays Tues.-Sun.: Open at 11 AM

Help Wanted: Bartender

2 Miles North of Grey Eagle on Hwy. 28, then Right on Co. Rd. 103 on Mound Lake • 320-285-4541

Linda B’sSt. Rosa • 836-2152

EVENING SPECIALS • 5-10 PMFriday: FISH FRY & SHRIMP or PAN FRIED WALLEYESaturday: STEAK & SHRIMP, CHICKEN & RIBS PRIME RIB, or PAN FRIED WALLEYE

Monday: PIZZA & Pitcher of Beer/PopTuesday: CHICKEN FRY with Real

Mashed Potatoes, Gravy & All the Extras! (Free Coffee for Seniors)

Wednesday: Taco Bar Thursday: BBQ RIBS & CHICKEN

Noon Lunches

Back Room Available For Parties

Take-N-Bake Pizza, Pizzas To Go,Bucket of Chicken To Go

** All Meals Include Salad Bar! **

Monday, May 25Stop in for

Memorial Day Food & Drink

Specials!Have a Save & Fun Memorial

Weekend!Food Available for Graduation

Parties!-Salads-Chicken

Ervin E. “Billy” KleinErvin E.

“Billy” Klein, age 86 of Albany, died unexpectedly and peacefully on Sunday, May 17, 2015 at the St. Cloud Hospital in St. Cloud, Minnesota.

A funeral service will be held at 11 a.m. Thursday, May 21

at Our Savior’s Lutheran Church in Albany with Pastor Stephen Cook officiating. Interment will be in Our Savior’s Lutheran Cemetery in Albany with military honors by the Albany American Legion.

Visitation will be from 10 to 11 a.m. Thursday at the church in Albany.

Ervin Edmund Klein was born December 23, 1928 in Albany, Minnesota to Paul and Rose (Baggenstoss) Klein. He served in the U.S. Army from 1952 through 1954. On October 27, 1956 he married Ruth Kotzer at Ebenezer Lutheran Church in Albany. They farmed together near the Holdingford area until 1981. Billy retired in 1981 but continued helping on the farm. He was a member of Our Saviors Lutheran Church. Billy loved being outdoors where he enjoyed farming, mowing the lawn, and cleaning the yard. He also enjoyed spending time with his family; including “coffee clutch” with his sisters, going to the sales barn, and going out to eat, especially to KFC and Charlie’s Café!

Survivors include his children, Alan

(LuAnn) Klein of Sauk Rapids, Jeffery (Mary Jo) Klein of Holdingford, Russell (Sheila) Klein of Clarissa, and Cheryl (Andrew) Hollermann of Albany; 12 grandchildren, Daniel (Brenda) Klein of Holdingford, Brian Klein of St. Cloud, Kevin Klein of St. Joseph, Adam (Kayla) Klein of Sauk Rapids, Jason (Melinda) Klein of Waite Park, Mitch Klein of St. Cloud, Kyle (Yalanda) Klein of Clarissa, Paul Hollermann of Albany, Ethan Hollermann of Clarissa, and Garrett Hollermann of Albany; seven great-grandchildren, Abigail, Hannah, Austin, Daisy, John, Paige, Kellie, Kendrick, and Kylee; sisters, Sharon Lehner of Albany, Carol (Jerry) Rodenwald of Albany, Jenny Cigelske of Hewitt, Arlene Landowski of Albany, and Doris (Ted) Koehn of Long Prairie; brothers-in-law, Donald Kotzer of Holdingford and Donald Litchy of Holdingford; and sisters-in-law, Janice Klein of Albany and Vera Klein of Minneapolis.

Ervin was preceded in death by his wife, Ruth Ann Klein on September 14, 2013; parents; granddaughters, Brittany and Alyssa Klein; brothers, Alvin, Earl, Marvin, Lloyd, and Jerry; and sisters, Hildegard, Verna, Rose, Bernice, Amanda, Beverly, Erma, and Ardell.

Serving as casket bearers will be Daniel Klein, Kyle Klein, Adam Klein, Mitch Klein, Paul Hollermann, and Ethan Hollermann. Cross bearer will be Garrett Hollermann. Honorary bearer will be Brian Klein.



Tony (Roman) A. KierzekMass of

Christian Burial celebrating the life of Tony (Roman) A. Kierzek, age 84, of Avon, will be at 11:00 AM on Thursday, May 21, 2015 at the Immaculate C o n c e p t i o n Church in St. Anna. Father Greg Mastey will

officiate and burial will take place in the parish cemetery with military honors. Tony passed away early Sunday morning with his loving family by his side.

There will be a visitation after 10:00 AM until the time of service on Thursday morning.

Tony was born on October 9, 1930 to Thomas and Mary (Hennek) Kierzek in Avon. He was raised alongside his eight siblings and attended the local school. Tony joined the U.S. Army in 1952 and proudly served his country overseas, spending time in Germany. On September 12, 1955, he married Jeanette Panek at St. Hedwig’s Church in Holdingford and together they raised 7 children. Tony worked as a farmer and a laborer with Landwehr Heavy Moving. He was proud that his farm, which has been used for dairy,

beef, and crops, was designated a Century Farm in 2010. Tony was devoted to his faith, family, and country. He was actively involved in his church and was a valued member of the community. Tony has been an usher, lector, and bazaar chairman for over 40 years and a trustee for over 30 years. He was a selfless, compassionate man who gave of himself and would help anyone in need. In addition to his church, Tony belonged to the Avon American Legion Post 538 where he was recently recognized for his 50 year membership, Knights of Columbus Council 3628 in Albany, Catholic Order of Foresters Court 733 in Avon, and the Labor Union 563 in St. Cloud.

Tony is survived by his wife of nearly 60 years, Jeanette; his children Gary (Jean) Kierzek, Avon; Ron Kierzek, Avon; Mary Kierzek, Holdingford; Steve (Julie) Kierzek, Avon; Jodi (Dave) Stocker, Avon; Mark (Michelle) Kierzek, Avon; Ann (Glenn) Richards, Cold Spring; his siblings Helen Kvarnlov, St. Cloud; George (Donna) Kierzek, St. Wendel; Richard (Karen) Kierzek, Sauk Rapids; 22 grandchildren; 7 great-grandchildren; as well as many other family and friends.

He is preceded in death by his parents Thomas and Mary, his siblings Al Kierzek, John Kierzek, Anna Brinkman, Lucille Shephard, and Edmond Kierzek.

Wyatt Joseph TuorilaWyatt Joseph Tuorila was born on

Wednesday, May 13, 2015 at 10:59 PM to parents Clinton and Cheryl (Hallermann) Tuorila at the St. Cloud Hospital. He weighed 12 oz. and was 11 in. long. Wyatt’s parents were blessed with a half hour with him before he was called to his heavenly home at 11:18 PM. In his short time, Wyatt experienced being held by his parents, hugs and kisses, and being told he was loved countless times.

Wyatt is deeply loved by his mommy and daddy in Albany; his big sister Makenzie Tuorila, St. Cloud; his great-grandpa Elmer Essen, Nashwauk, MN; his grandparents James (Diane) Tuorila, St. Cloud; Pam (Ed) Adams, McAllen, TX; Eugene (Gloria) Hallermann, Long Prairie; his aunts and uncles Michelle (Steve) Mace, Clearwater; Rachel (Matthew) Chapin, Albany; Scott (Nicole) Hallermann, Albany; Chad (Beth) Hallermann, Glenwood; his cousins Kylie Doege, Staples; Kaitlin Doege,

Clearwater; Logan Chapin, Albany; Gracie Chapin, Albany; Rylin Hallermann, Albany; Avery Hallermann, Glenwood; Charlie Hallermann, Glenwood; and many others. He will always remain his parents’ precious baby boy and they will hold him again in Heaven one day.

There will be a private gathering of family to love and support each other and to come together in Wyatt’s memory.

Our Daily Bread285-2800

Main St., Grey Eagle

Open 6 AM-1:30 PM

Daily

Wanted: Weekend CookBreakfast and Lunchtime320-285-4244, or leave an

application at the cafe.

BURTRUM Liquor

320-285-2196On/Off Sale • ATM • Pull Tabs • Lottery

Monday-Thursday: 12 PM-10 PMFri.-Sat.: 12 PM-1 AM; Sun.: Closed

Open at 2 pm

Mon-Fri; Noon

on Sat.Memorial DayOpen at 2:00 PM

Enjoy the Holiday Weekend.

320-285-3576

Historic Rock

Tavern & EateryThe Last Great

Tavern Since 1937!Saturday

Delicious Prime Rib & Features.

Wednesday Fajitas and Margaritas

are back for the season!

Tuesday BBQ Ribs

Basket $7.50

With Bruce (Bruno) Rohde & Staff. Call for Reservations! Upstairs Dining Only!

Thursday: Steak & Shrimp

$14.95

Located on Big Birch Lake

Grey Eagle

GreatFood!

GreatService!

Friday Walleye Sandwich or

Garlic Herb Chicken w/Broccoli Saturday, May 23

8:30 PM • On the Patio

KODIAK

Open Tues.-Sat.: 4-10 PM

God Bless and Thank you

All Veterans!

Downstairs Bar & Patio Now Open!Open Tues.-Fri.: 3-Close; Sat.-Sun.: Noon-Close

Happy Hour: Tues.-Fri.: 4-6 PM • A la carte menu

Corner Pub & GrillFreeport, MN • 320-836-2120

Sat., May 23:$1.50 Burgers

4-8 PM

memorial Day Weekend at The Corner Pub

Sat., May 23: Soundstorm

will be cranking out the tunes 9-1 Backroom available at no charge.

Sat., May 30th GREGORY JAMES BAND

Live 4 Piece Country Band.(No Cover Charge).

Help Wanted: Bartender

Celebrate the kick off to summer

at The Corner Pub!

fri., may 22:Serving 5-9 PM

Enjoy a Steak Dinner Served with Choice of Potato, Coleslaw & Toast

Grey Eagle • 320-285-2965Double R Bar &

Grillwww.doublerbarandgrill.com THURSDAY • 5-9 PM

Chicken & Ribs...................... $10.958 oz. Ground Sirloin................. $9.95

FRIDAY • 5-9 PMChef’s Choice Steak............... $18.95Teriyaki Chicken over Rice Pilaf.. $9.95Deep Fried or Broiled Cod........ $9.95Broiled Shrimp or Chicken Fettuccine Alfredo............. $9.95

Includes Choice of Potato & Salad Bar

Serving 5-9 PMMONDAY

Taco Bar $5.75 or Irish Italian

Spaghetti $7.95TUESDAY BURGER

NIGHT $1.50$5 WEDNESDAY

Baskets, Wings, Nachos or Quesadillas

Busch 24 pk. cans (Reg. or Light) $13.89

E&J Brandy 1.75 Liter $15.34

Fri., May 22: Hot Beef SandwichSat., May 23: Prime Rib BurgerSun., May 24: Bar & Kitchen Opens at Noon; Porterhouse, 1/4 or 1/2 Chicken, Pork ChopMon., May 25: Sub SandwichTues., May 26: LasagnaWed., May 27: $5 Baskets Thurs., May 28: BBQ Ribs

Noon Lunch Specials

SATURDAY • 5-9 PMBeef Kabobs................ $13.95Prime Rib.................. $16.95Sirloin & Shrimp........ $15.95Ribs........................... $12.95 Walleye Broiled or Deep Fried $12.95

SUNDAY • 3-9 PMChef’s Choice Steak... $18.95Pork Chop................. $11.95 1/2 Chicken................. $8.951/4 Chicken................. $6.95

MEMORIAL WEEKEND SPECIALS

ALL STARSSPORTS BAR & GRILL

St. Rosa • 320-836-2154

Drink of the Month:

REDD’S Apple Ale, Strawberry Ale or Green Apple Ale

$2.50/Bottle

Sat., May 23: BULLET BOB

Stop In For All Your Off Sale Needs!

BARTENDERS WANTED: Stop in for application.

Busch Light 24 pk. cans

$14.00 + tax

Memorial Day Breakfast: 9-11 AM3 Options to Choose From:

Tuesday NightServing from 5-9 PM

Buy Any Pizza, Get Family Size Bread Sticks FREE •Stuffed Hashbrowns $750

•Pancakes w/Choice of Bacon or Ham $700

•Ground Sirloin Steak w/2 Eggs, Hashbrowns & Toast $750

Check Out Our Bloody Mary Bar

Bud & Bud Lite Bottles $2.50!

Café Open Daily 6 AM-2 PM; Fri. Evenings 4-8 PM

Every Friday Night • 4-8 PM PASTA, PIEROGIES & PRIME RIB

(Full Dinner, Burger & Sandwich Menu also Available)

Full Service Catering Any Event Big or Small.

Call Today!

Sunday • 10 AM-1 PM 3 Meat Smorgasbord Only $9.50

320-547-0050 • www.unclebscatering.com • Swanville, MN

Open Memorial Day 6 AM to 2 PM

Dining Menus: May 25 - 29Albany Senior Dining

MON., MAY 25: Closed.TUE., MAY 26: Country fried steak,

whipped potatoes, gravy, Scandinavian blend vegetables, pears.

WED., MAY 27: Chicken a la king, biscuit, peas/carrots, oranges, Missis-sippi mud bar.

THUR., MAY 28: Taco salad w/beef/cheese/lettuce/tomato, dinner roll, applesauce, snickerdoodle cookie.

FRI., MAY 29: Lemon pepper fish, potato bake, broccoli, cheese sauce, fruit cocktail.

~ The Lighter Side Menu ~MON., MAY 25: Closed.TUE., MAY 26: Chicken enchilada

w/cheese/tomato/onions, black bean salad.

WED., MAY 27: Baked potato w/ham/cheese, lettuce salad, breadstick, oranges.

THUR., MAY 28: Turkey/bacon sandwich w/lettuce/tomato, minestrone soup, snickerdoodle cookie.

FRI., MAY 29: Mandarin almond

Swanville Senior CenterTUES. NOON MAY 26: Soup,

grilled cheese, dessert.THURS. 5 PM MAY 28: Chef salad,

breadstick, dessert.* Dessert, milk and coffee served with each meal.Call Kim 320-630-4046 a day before your meal!

Swanville Senior Center

Upsala - All AgesMON., MAY 25: Closed.TUE., MAY 26: Baked fish, baked

potato, baked squash, fruit.WED., MAY 27: BBQ chicken,

cheesy hash browns, corn, fruit cobbler.THUR., MAY 28: Taco salad, corn

muffin, Jell-O chiffon.FRI., MAY 29: Cook’s choice.

* Bread and skim milk served with each meal.Call by 10 a.m., dine at 11:30 a.m.

Upsala Community Center: 320-573-4435

salad w/chicken/lettuce/mandarin or-anges, chicken dumpling soup, fruit cocktail.

Albany: 320-845-4070

Grey Eagle Senior Center Pot Luck/Bingo Party to be held May 27

The Grey Eagle Senior Center is planning a “May Pot Luck/Bingo Party” for Wednesday, May 27th, at 5:00 p.m. Anyone who is 55 years of age or older is invited to attend. Please bring a “dish

to share”. Following the meal, we will play “Buck a Card” bingo. Please come, bring a friend, and join in the fun and fellowship.


Dave Says -By Dave Ramseyfor our home, and we’re currently putting money aside for our fully loaded emergency fund of three to six months of expenses. Currently, we have our emergency fund account in the same bank as our checking and savings accounts. Do you think we should move it to a different bank?

-SteveDear Steve,

I wouldn’t worry too much about that if I were you. The only exception to that might be if you had loans that you owed to that same bank. Then, I would probably move my emergency fund out of there just in case something went wrong with the loans.

Some commercial loan documents now give the bank the right to take money out of your account to pay the loan — without your permission. If you had a car loan, for instance, with that particular bank, I wouldn’t keep a bunch of money in that bank. They normally don’t do that unless you’re way behind on the bill — and then it gets pretty adversarial.

Sometimes there can be things like a simple clerical error, and there’s no chance of that happening if the money’s in another bank. But in your situation, I don’t see any harm in you being there.

-Dave* Dave Ramsey is America’s

trusted voice on money and business. He’s authored four New York Times best-selling books: Financial Peace, More Than Enough, The Total Money Makeover and EntreLeadership. The Dave Ramsey Show is heard by more than 6 million listeners each week on more than 500 radio stations. Follow Dave on Twitter at @DaveRamsey and on the web at daveramsey.com.

Dear Dave,I have a

question about budgeting. I give myself and my husband $150 a month each for blow money to be used on whatever we want. I’m upset because he spends all his eating out, then he buys other things he wants

that he has no money for. Am I being too stingy?

-CherylDear Cheryl,

I think you guys are handling your money poorly. You’re acting like his mother instead of his wife, and he’s acting like a little boy instead of a man. You don’t want to give your husband an allowance and then not be happy when he spends money “he didn’t have” because he went over what you dictated to him. That’s a bad budget process.

The budget process, if you’re the nerd in the family, should start with you writing it all out. Then he sits down with you, has an equal say in the decisions and you two okay it together. He needs to understand that this is you asking him to man-up and be part of the decision-making process, so that you can both be in agreement as to what’s best for the family. In one sense, you may not like it at first, because right now you’ve got control of things. But in another sense, I’ll bet you’re pretty tired of carrying the weight of all the financial decision making and being the only adult in the household.

He doesn’t even have to work on all that much. I want you to lay it out, but I expect him to sit down and go over it all with you. You’re not asking him to be an accountant with a pocket protector, but you have every right to expect him to be in on the decisions that are made about your family and your finances!

-DaveDear Dave,

My wife and I are debt-free except

Tickets Are On Sale Now!Be sure to get your early bird tickets to be in a drawing for $500 at the conclusion of the auction.

Contact the Parish Office at 320-285-2545 or Thom Muellner at 320-533-1082.

$2000

All For Only

Dinner Starts Serving at 5:30 PMLive Auction Begins at 7:30 PM

Featuring: Chicken Roast Beef, Real Mashed Potatoes, Gravy, Dressing, Coleslaw, Pasta Salad, Corn, California Medley,

Bread, Cranberries, Pickles, Coffee, Milk & Cupcakes.

St. Joseph’s Church Dinner and Auction(of Grey Eagle)

FRIDAY, JUNE 12, 2015American Legion Club in Melrose

Pelican Peak 4-H Club Recycling Event May 30 • 8 - 11 AM at the Freeport Fire Hall

For more information call Amy 320-836-7098.The 4-H Club reserves the right to deny any item.

This is a safe and secure way to dispose of your personal items.Come support your local 4-H club and help keep our world clean!

Electronic (E-Waste) Items Include: Computers • Monitors Printers • Cell Phones • Copy Machines • TV’s/VCR’s/DVD’s

Stereo Equipment • Power Cables/Wires • Refrigerators All Appliances • Tools/Shop Items • Fluorescent Bulbs

Charges may apply.

The Greenhouse

is Open

Hours:Mon.-Sat.: 8-5:30 PM Sun.: 8-Noon

Behind Chris’ Country Store, Grey Eagle

• Herbs• Vegetables• Hanging Baskets• Bedding Plants• Geraniums

Mockers of the Truth -By Sheila RipplingerHow sad and heart wrenching it is to

watch or listen to the news in our world today. We are bombarded with ‘bad news’ from around the globe.

For those of us who are believers in the One True God, who was responsible for inspiring and protecting the Sacred Words of the Holy Bible, we can have hope even in the darkest and gloomiest days because we know the Truth!

We believe that the Holy Scriptures hold all that we need to survive and thrive even in the midst of the chaos that sometimes surrounds us. No, it does not mean that we are protected and ex-empt from troubles and trials, or that it is easy, but it does give us assurance that we have an anchor that securely holds as we get tossed around through the storms of life.

One day, we who are true Chris-tians, will be ‘harvested’ from this cor-rupt and evil world. This world that is succeeding in turning people away from the Truth of God and towards the mock-ers. All that the Lord has declared despi-cable is now being called good.

The Ten Commandments are not only being taken down- they are being called void and irrelevant for our times. Even the highest leaders of our Country are mocking the ‘signs of the times’ that are found inside the Truth in the Bible. They do not know and do not care that the Word of God does not change with the times.

This does not take a Follower of Christ by surprise, however. It hurts, indeed, because we know the certain destiny of the mockers if they do not re-pent and believe in the Truth. They stand condemned not by people, but by God Himself!

The Apostle Peter wrote about the mockers and the scoffers that would come in the last days. He also wrote in 2 Peter 3 about the ignorant and unsta-ble people during these times that will distort the Scriptures, to their own de-struction. These people could be church leaders, or other top officials that will try to sway the innocent to believe in their teachings. We are each responsible for knowing what the Truth really is so that we do not fall under deceptive teachings that are contrary to the Word of God.

The Apostle Paul wrote a lengthy

list of godlessness in the last days- 2 Timothy 3... ‘terrible times, people will be lovers of themselves, lovers of mon-ey, boastful, proud, abusive, disobedient to their parents, ungrateful, conceited, lovers of pleasure rather than lovers of God- having forms of godliness, but de-nying its power.’ That was not even the whole list! Wow!

We cannot sit quietly and be afraid to speak up about what is good and right and true. If we live in fear of being mocked and scoffed at, then we should re-evaluate where we stand with Jesus. He said very clearly in Mark 9:38, ‘If we are ashamed of Him and His Words, in this adulterous and sinful generation, the Son of Man will be ashamed of him when He comes in His Father’s Glory with His holy angels.’

Matthew 24 tells us what we need to watch for so that we are prepared for Jesus’ return. We are not to know the day or the hour- but we will recognize the signs and we will feel the birth pains that foreshadow this coming Day.

We who believe in the Truth of the Bible will be ridiculed and called all sorts of names- and this should not sur-prise us... Jesus also experienced this. He warned us in His great Love, ‘In this world we will have trouble.’ One of the most recent disturbing names about us came from the mouth of a presidential candidate. She said we are ‘bias’ and need to ‘get on board’ with them to sup-port the killing of unborn babies. Do not be afraid to be called bias. In this case, it is a compliment to those who fight for the Truth!

We need to strengthen our roots by reading and honestly seeking out the Truth for ourselves, or we are at risk of being the coward and the hypocrite that hangs his head in shame when he stands on that Day before a Holy God to give an account for how he lived. Every hu-man will stand in that place one day.

So pack your suitcase with the Truth and have it ready to go! You do not want to be left behind for the punishment that is up ahead! God in His Grace gave us His Word- He also gave us free will to take it or leave it.

Proverbs 9:12~ ‘If you are wise, your wisdom will reward you; If you are a mocker, you alone will suffer.’

FLUFF-N-FOLDOpen 24/7 • Under New Ownership

Swanville Laundromat: 320-360-2548 Tony Maciej

Across from Red’s Irish PubChange & Vending Machine On-Site

Free WiFi

Dingmann’s LockerCustom Processing

On the Farm ButcheringUpsala, MN: 320-573-2162


To Submit a Card of Thanks the cost is $2.50 for the first 50 words, 10¢ for each additional word. MUST BE PREPAID. Mail to:

Hometown News, 29442 120th St., Grey Eagle, MN 56336.To be billed: a $5 minimum applies.

Card of Thanks

Sales &Service

Roll-in Dock System

320-285-2000Grey Eagle, MNBITZ HARDWARE Central MN Westwind

Corner of Hwys 27 & 28 • 12 Mi W Little Falls & 12 Mi E Long Prairie • 4 Mi N Swanville

Spring Hours:Tuesday -Friday 10-5, Saturday 9-5Closed Sunday & Monday

NewAppliances

for yourhome or

cabin.

The Grey Eagle United Methodist Church would like to thank all of our family, friends and neighbors who attended our ninth annual Waffle Supper on Saturday, May 9th. Your support is very much appreciated by all of the members of GE UMC, and by the Youth Groups and Eagle’s Healing Nest who benefitted from the pro-ceeds of the supper.

We also want to thank the Central Minnesota Credit Union for their generous donation of the milk served at the supper. They are a true supporter of local events and activities.

For the first time door prizes were offered to all who came to enjoy Dad’s Bel-gian Waffles. The four recipients of a $20 gift certificate each from The Rock Tavern were Derry Anderson, Harry Grammond, Melissa Hesch, and Sharon Uecker. Con-gratulations to these Waffle Supper attendees!

We hope to see all of you next year - bring a friend or neighbor! Once again Thank You.

Grey Eagle United Methodist Church

Junior Sam Mettler has been chosen as the Swanville April Student of the Month for grades 10-12. He is the son of Randy and Marge Mettler.

Tom Bzdok High School teacher states, “Sam is very de-serving of this recognition. He is a very mature

young man who has become a leader by setting positive examples for his class-mates to follow. He always has a smile on his face and puts everyone around him in a better mood. He has a posi-tive attitude, an eagerness to learn, and works hard to achieve his goals. Sam is the type of student who will always put his best effort into whatever he attempts. Congratulations Sam!

Sam has many interests including hanging out with siblings and friends. He very much enjoys playing basket-ball. He is planning on going to college to become a broadcaster.

Sam has stayed very active so far in his school career. He played football as a freshman and sophomore. He has par-ticipated in basketball since sixth grade and track since seventh grade. He is a three-year veteran of student council. He joined the Healthy Communities last year and continued his role in that orga-nization this year. He was inducted into the National Honor Society this past fall. He also has participated in both theatre and speech since seventh grade. Sam has been awarded three outstanding acting

Swanville Sr. High Student of the Monthawards in various theatrical productions. He has advanced to sections in speech for four straight years. He also advanced to sections in track last year. He has two superior awards for performances at Section/State solo ensemble.

“I have had Sam in class for years and he has been a teacher’s assistant for me this year. I really enjoy having Sam as a teacher’s assistant,” states Marv Poegel, Physical Education teacher. He goes on to add, “I have a great deal of confidence in the work he does for me. He is an intelligent person who commu-nicates well when writing or speaking. Sam is also a very positive and caring individual who possesses a full measure of characteristics, which are identified with successful and effective leaders. He is involved in almost every activity at school that is offered. I am convinced that no matter which endeavors Sam chooses to take on, he will be highly successful, and his contributions will ex-tend well beyond school and his future work place. Sam shows great respect for staff and students and he is eager to go well beyond the minimum in class ex-pectations. Sam is a very hardworking, responsible individual and has proved his worth year after year as a school-wide mentor for others. I trust Sam to keep making great decisions to help ev-eryone make our world a better place. Congratulations to Sam and his parents for this nice honor.”

Sam’s day extends beyond the school day also. He is actively involved in the St. John’s Youth group and also plays piano for church. He has been ac-tive in 4-H for eleven years. He advice to fellow students is to “always turn your work in on time and don’t let the stress get to you.’

The flag should be hoisted briskly and lowered ceremoniously.

The flag is never allowed to touch the ground or the floor.

When hung over a sidewalk on a rope extending from a building or pole, the union stars are always away from the building.

When vertically hung over the cen-ter of the street, the flag always has the union stars to the north in an east/west street, and to the east in a north/south street.

The flag of the United States of America should be at the center, and at the highest point of the group when a number of flags of States or localities

How to Display The United States Flagor pennants of societies are grouped and displayed from staffs.

The flag should never be festooned, drawn back, nor up in folds, but always allowed to fall free.

The flag should be displayed at half-staff until noon on Memorial Day, then raised to the top of the staff.

Never fly the flag upside down, ex-cept as a signal of distress in instances of extreme danger to life or property.

The flag is never flown in inclem-ent weather, except when using an all-weather flag.

The flag can be flown every day from sunrise to sunset and at night if il-luminated properly.

The Summer Moon Festival at The Olive Branch Retreat will be held June 6, 2015. This is an uplifting, inspira-tional, fun event meant to be an educa-tional celebration of life and is open to the public. This event has been created to educate the public about the benefits and availability of holistic health options in MN.

The festival includes lakeside booths providing a sampling of integrated well-ness and healthful food vendors. Visitors can tour the former convent, now retreat. Harp music and inspirational keynote will fill the outdoor sanctuary with feel-ing throughout the day.

Joan Steffend, who has spent almost thirty years in the media, first as a na-tional Emmy-winning news reporter/an-chor at the NBC affiliate in Minneapo-lis- Paul, and then as a top-rated host on HGTV (Decorating Cents, White House Christmas, Dream Home Specials) has appeared on Oprah, Live with Regis and Kelly and the Today show. Now, as the author of “and she sparkled” and “peace in, peace out” Joan will keynote at the

Olive Branch Retreat to hold Summer Moon Festival June 6

Summer Moon Festival. Joan is aware of the energy around us that runs the world, and considers life more magical than most people allow themselves to believe. She speaks about living your authentic, brilliant life.

Learn more about the Olive Branch at www.OliveBranchRetreat.com, email us at [email protected], or call 320-393-7212 with questions.

The Olive Branch Retreat is located on a semi-private lake in Grey Eagle, MN; between St. Cloud and Alexandria.

Upsala Farm Store Inc. LP Gas Refill

320-573-2216211 S. Main St., Upsala

7 Days/Week: Mon.-Sat. 8-6; Sun. 9-2

• Garden Seeds• Onion Sets• Seed Potatoes

FishingTackle & Worms

Custom Designs, Building & RemodelingResidential, Agriculture & Commercial

Bobcat Work, Concrete & Spray-Foaming

Call Jeremy: 320-285-7785Larry: 320-285-7595

Upsala Jr. High Student of the MonthThe Up-

sala Junior High Student of the Month for March is Alexis Krebs. Alexis is the daughter of Don-ald and Marsha Krebs of Little Falls.

Alexis keeps very busy. She is involved in

many extra curricular activities includ-ing Volleyball, Track, Knowledge Bowl, FFA and Drama Club. Alexis was team captain of her Knowledge Bowl team, which took third at Regions this year. She is a past 4-H club Vice President and currently serves as Reporter.

Academically she continues to ex-cel, making the A honor roll. Alexis has competed at the Geography Bee for two years in a row and is the 2015 Upsala Area School District Champion.

Her favorite class is Art, because “Mrs. Poissant comes up with new ways for students to express their creativity.” Alexis has proven her creativity earning third place in the Cardinal Media Cen-ter Bookmark competition the last three years.

In her free time she enjoys volun-teering, taking pictures, shopping and hanging out with friends.

Mrs. Henry states, “I have known Alexis for two years as a student and Knowledge Bowl participant. In both endeavors, she has shown herself to be a responsible, mature, conscientious, and trustworthy young woman. This year she also proved her leadership skills as captain of her Knowledge Bowl team. Overall, I am happy to have the oppor-tunity to work with Alexis, both as her teacher and as her coach.”

The advice Alexis has for her class-mates is to “Never stop doing your best, just because someone doesn’t always give you credit.”

MEMBERFDIC

320-836-2126 320-256-7208 320-987-2265320-256-7342Freeport • New Munich • Melrose • Greenwald

www.freeportstatebank.com

Stop By and See OurLoan Professionals

Stop By and See OurLoan Professionals


Community Snapshots EMAIL US YOUR PHOTOS! • [email protected]

315 Main St. • Next to the Dam BarMelrose City Meat Market

Summer Sausage, Breakfast Links, Smoked

Bacon, Ham, Sirloin, Flat Iron, T-Bones

... All the Specialty Steaks!

Venison & Beef Processing

320-256-3750 Mon.-Fri. 8-5:30Sat. 8-Noon

See Us for All Your Venison

Processing Needs

Under New Ownership: George Kuhlmann & Marilyn Gaebel

Kutter Insurance Agency

107 Main Street, Grey Eagle

Insuring cars, homes, boats, farms & recreational vehicles for the past 20 years! Michael W. Kutter • Janine L. Kutter

FOR ALL YOUR INSURANCE NEEDS!

320-285-2299 • 800-955-6051

kutterinsuranceagency.com

Mound Lake Association road clean-up crew were hard at it again on Saturday, May 9th. Submitted by Carol Johnson.

The Upsala FFA chapter hosted their annual petting zoo on May 7th at the Upsala Rec Building. There were no feathered animals at the petting zoo, but there was an assortment of other farm animals present. The Morrison County Dairy Princesses Sara Herzog and Renee Hebig dished out ice cream for visitors, FFA president Audrey Schleper gave a hoof trimming demonstration, and younger children were able to take a bag of coloring books and agricultural books and pencils. Pictured is Anne Malisheske feeding the goat with an open hand. Submitted by McKenzie Barth Upsala FFA Vice President.

Evan Kraska sits on the horse at the petting zoo.

These Swanville Elementary students were “Caught Being Good” during the month of April. Of these, Ethan Wimmer’s name was drawn, and he received a free book. Pictured (front from left) Harlee Schultz, Reese Jackson, Isaac Gapinski, Emily Johnson, Ethan Wimmer, Hunter Moore; (back) Lakiesha Kuhl, Sammy Primus, Ethan Jacobson, Gavin Moyle, Zach Elias and Malachi Landowski.

TMR MIXERS

GUTTER CLEANERCHAIN & PARTS

www.hartungsales.comKen & Peg Hartung

310 Industrial Dr. - Freeport, MN

Oldest & Most Experienced Patz Dealer in Central MN!

NEW & USED TMRs

All Sizes On Hand

320-836-2697After Hours: 320-267-8568

Lawn & Garden Sales - Service - Parts

Freeport Farm Center320-836-2171Just Off I-94 • Freeport

• Massey• Simplicity• Snapper

HINMAN LAWN SERVICENOW OFFERING

Barrier Mosquito Spraying

Fully Licensed & Insured

Mowing • Trimming Fertilization • Weed Spraying

320-285-3811 • GREY EAGLE

For All Your Lawn Care

Needs!

• Redmond Salt & Minerals• Water Fountains• Gallagher Scales• Calf Hutches & Shelters• Self Standing Panels• Feeder Wagons

Gertken Dairy Sales & Service

Portable Cattle Crowding Tub System

Phone: 320-597-2207Cell: 320-249-8237

www.gertkendairysales.comDisplay lot in Albany, MN

North side of I-94

PRODUCTS• Skid Loader Attachments• Tree Shear Skid Loader Attachment• Cattle Chutes & Headgates• Dairy & Beef Semen & Supplies• Creep Feeders & Self Feeders


Minnesota Through The Lens: Submitted by: Ron Kuehne

To submit a photo for Minnesota Through The Lens, email it in it’s original (large) size to [email protected].

www.fiedlerpumping.com320-252-9916 • 320-630-6703

$5 OFF ANY SERVICE with this ad!

MPCA Certified • Licensed/Insured/BondedYour Pumping Specialists

Residential • Commercial • IndustrialSpecializing in Septic Tank Maintenance and Service

Now Offering Septic Pump Replacements! Now Offering Riser and Cover Replacements!Quality Work Built Our Business... Ask Our Neighbors

Birth Announcements

Nice cabin on Mound Lake. 2 bdr., nicely updated. Excellent water clarity, great boating & fishing lake. Only 2 hrs from metro. Beautiful

views from the deck. Great Price $179,900

Judy Frieler, Realtor

320-491-0024

Real Estate ServicesBenchmark

For More Listingsor a Free Market

Analysis Give Me a Call!

Mound Lake - Grey Eagle

NEW LISTINGS WANTED!

Little Birch Lake: Enjoy the beautiful sunsets & gorgeous view of Little Birch Lake. Build your dream home on this large lot. Next to Big Birch State Park. Great Price $85,400

God Bless the Brave Men & Women Who Have Given So Much for the Freedom We Embrase in America.

God Bless the Brave Men & Women Who Have Given So Much for the Freedom We Embrace in America.

Last Saturday the Albany, Avon and Holdingford Fire Departments held a training burn on a house just South of Wells Concrete, Albany. Photo submitted by Joe Lang.

1 bedroom patio home. Beautiful living. Level property from lake to sheds.

Amazing sunsets, fishing, loons. Home has been completely remodeled with cape cod high end custom design. Sleeping porch designed for added guests. Quiet furnace. 2 oversized sheds 1 heated. $209,900

Call 320-249-0175

Lake Home For Sale17243 Downy Dr.,

Grey Eagle

Rebates Up To

On Set of 4 Tires

$120

320-836-2130 • FreeportHOESCHEN AUTO

Expires June 30, 2015.

33578 Co Rd 30, Melrosewww.whisperingoakswinerymn.com Free wine tasting on the May 23rd & 24th!

Your Local Winery is opening for the season!Beginning May 23rd & 24thwe will be open Every Saturday & Sunday from 1 - 5 PM

Chris & Terri Ellering

320-256-7118

Michael and Samantha Viere of Freeport are proud to announce the birth of their son, Mac Kevin Viere, born Tuesday, May 12, 2015 at 11:41 p.m. at the CentraCare Health-Melrose.

Mac weighed 8 pounds, 9 ounces and measured 21 ½ inches in length.

Welcoming Mac home is his big brother Chase, 2, and big sisters, Chloe, 6, and Alexis, 3.

Grandparents are Mike and Laura Kerfeld of Melrose, Kevin and Ann Viere of Melrose and Pat and Carol Middendorf of Grey Eagle.

Mac Kevin Viere

Justin and Jamie Heurung of Holdingford are proud to announce the birth of their son, Jonas Jendro Heurung, born Wednesday, May 13, 2015 at 7:24 a.m. at the CentraCare Health-Melrose.

Jonas weighed 7 pounds, 1 ounce and measured 19 inches in length.

Welcoming Jonas home is his big brother Jace, and big sister Jemma.

Grandparents are Kevin and Kim Marstein of Browerville, Cindy Heurung of Cold Spring and Dan Heurung of St. Joseph. Great grandparents are Bob and Audrey Goligowski of Brooklyn Park, Rosella Marstein of Coon Rapids, Bernie Heurung of St. Joseph, Darlene Heid of St. Cloud and Patrick

Kieke of St. Cloud. Great-great grandma is Vera Goligowski of Browerville.

Jonas Jendro Heurung

Jose and Diana Morelos of Melrose are proud to announce the birth of their daughter, Zoey Harmony Morelos, born Sunday, May 17, 2015 at 2:17 a.m. at the CentraCare Health-Melrose.

Zoey weighed 7 pounds, 4 ounces and measured 21 inches in length.

Welcoming Zoey home is her big sister Melody. Grandparents are Jose and Marcela Morelos of Melrose.

Great grandparents are Martin and Maria Hernandez of Melrose.

Zoey Harmony Morelos

Grey Eagle Burtrum Lions are spon-soring an American Red Cross Blood Drive on Thursday, June 4 at St. Jo-seph’s Catholic Church in Grey Eagle from 1-7:00 pm.

Call Jim or Linda at 320-285-2670 for more information or to set an ap-pointment time.

Blood Drive in Grey Eagle June 4


Sunday evenings were always a spe-cial time in our small church in North-ern Ohio. After singing a few hymns, Pastor Stanley would walk to the pul-pit and ask, “Who would like to stand up tonight and thank the Lord publicly for His goodness and blessings dur-ing the last week?” We would all wait anxiously to hear what God had “been doing” since last Sunday evening. It was a time of sharing and rejoicing. We were always happy when someone was healed or helped. God got all the credit but we all rejoiced with the one who He had honored. We believed that when we asked, God would answer. And when He answered we all enjoyed the results and gave thanks together.

God heard and answered David’s prayer. But the nature of his prayer or the problems he was facing are not defined. However, in his concluding remarks he writes of God being “delighted in the well-being of His servant.” Well-being includes everything and anything that concerns us. Big or little, large or small. Whatever concerns us concerned God first because His goodness and grace has no limit. They exceed our imagination.

The answer to his prayer was the beginning of an important event in his life. He did not go quietly to his room and thank God by himself. No! He in-sisted on sharing his joy with others and said, “Come and join me. Let those who are happy with God’s blessings on me rejoice with me - all day!” What a way to grow.

After we pray together, let’s praise together.

STRANGE BREED by Steve Langille

LATE MODEL CARS & TRUCKS

These are clean, one-owner lease and rental returns & All are loaded with equipment!

Unlimited Mileage Warranty • 90-Day Bumper to Bumper12-Month Internal Powertrain Coverage

UPSALA MOTORS, INC.320-573-2563 • 1-800-257-5871

Check Out The Inventory at

www.upsalamotors.com

Always a fresh selection of luxury, family and sports cars, pickups,

vans and SUVsYou Name It!

NO GIMMICKS • NO HASSLE • NO PRESSUREYou'll Like Dealing With Us!

Notes from the Capitol By State Rep. Paul Anderson

Things are fairly quiet this Monday morning here at the State Office Building, following a Sun-day floor session of the House of Representatives that lasted well into the night. Adjourning just past 5:30 a.m., legislators were

finalizing bills that will fund state gov-ernment for the next two years. Good progress has been made but the threat of a veto from Gov. Mark Dayton on the education finance bill casts a big shadow over the final day’s session. It’s somewhat challenging trying to write this column to keep readers up-to-date on what’s happening here at the Capi-tol when the situation is so fluid and can change at a moment’s notice.

Several bills returning from confer-ence committees were acted on Sunday, among them the K-12 spending bill, which at just over $17 billion for the up-coming two-year biennium, is the larg-est single outlay in state government. The per-pupil funding formula increase was set at 1.5 percent the first year and 2 percent for the second year. That comes out to roughly $205 per student and

represents over 70 percent of the entire $400 million increase in funding for this part of the budget. In addition, one of the schools in our district, Sauk Centre, would also become eligible for funding under the Q-Comp program as they were among six schools on a waiting list.

Some good policy issues were also included in the funding bill, among which is wording to allow local districts to determine their school calendars in re-gard to the four-day week. Also included is a one-year provision allowing schools to begin classes this fall on Sept. 1 be-cause Labor Day falls so late on the cal-endar. This education bill gives school districts greater flexibility in areas such as student testing and also allows the Board of Teaching to expedite the li-censing process for out-of-state teaching candidates.

It does not contain language for the governor’s pre-kindergarten initiative, which has caused Gov. Dayton to issue his veto threat. What makes a veto even more problematic is the fact the legisla-tive chambers in the Capitol are sched-uled to be closed off for major remod-eling work beginning the day following adjournment. So, if no changes are made to the bill after its passage by both the House and Senate and the governor fol-lows through on his veto threat, there is no place for the Legislature to meet in special session. Dayton has said he

would erect a tent on the Capitol lawn and have us meet there. Stay tuned on this one as things could get interesting.

Good news on the health and hu-man services bill, also passed early Monday morning, as language giving nursing homes additional state funding for reimbursement rates was included. Hopefully, this bill doesn’t generate a gubernatorial veto as it gives our nurs-ing homes a much-needed boost in state payments. The total cost of this one pro-vision is around $150 million per year. Another positive feature of the HHS bill is additional funding in the area of child protection.

On the transportation front, agree-ment was not reached on major new funding. The two bodies could not come together on the gas tax issue as the DFL Senate wouldn’t give up its position on a gas tax increase while the Republican-controlled House held firm in saying “No” to the proposal to raise the gas tax by at least 16 cents per gallon. As a re-sult, a “lights-on” transportation bill will keep the status quo in effect. The pro-vision calling for $25 million for cities under 5,000 population was reduced to $12.5 million in the new transportation bill.

The environment and agriculture finance bills, rolled into one, are sched-uled to be heard in debate on the final day of session. The ag language pro-vides a good level of funding for the agencies dealing with the avian flu situ-ation that’s affecting our state’s poultry industry. It also contains a loan program for producers needing assistance in get-ting back into production. Also included in the bill is language pertaining to buf-fers. It is a much-scaled back version of the 50-foot initiative proposed earlier this year by Gov. Dayton. Under this bill, public ditches would be required to implement buffers measuring one rod or 16.5 feet. Additional funding will be allocated to county Soil and Water Con-servation Districts to implement the pro-gram, which for the most part, will be locally controlled.

Rep. Anderson can be contacted by email at [email protected]

Situation ‘fluid’ as Session Nears AdjournmentTry not to become a man of success, but rather try to become a man of value. -Albert Einstein

Thought for the week:

The Biggest little Propane store in town now has the best new

customer deal in townYou receive: Super Low First Fill PricingVariety of Guaranteed Price Programs

24/7 Professional Service

AmeriGas®

America’s Propane Company320-356-7377 • PO Box 328 Avon

or by phone at 651-296-4317. To re-ceive email updates sign-up on his web-page at www.house.mn/13a.


Local Municipality Minutescheit made a motion to keep prices the same as last year. Sup. John-son seconded the motion. Motion passed.

In the road report the contrac-tor will start dust control spray-ing when road restrictions and the weather allow and do the intersec-tions and hills like last year. Con-tractor will watch frost boil by Buck Lake. Sup Johnson made a motion to have the contractor clean the culvert on 331st Ave and add extension if needed. Sup Berscheit seconded the motion. Sup John-son made a motion to hire Ervin Muellner to mow ditches and trim brush with contract same as last year. Sup. Berscheit seconded the motion. Motions passed. An ac-cess permit from Jim Dreger was received and a supervisor will view.

Burnhamville TownshipApril 28, 2015

These minutes are not ap-proved.

The regular meeting of the Town Board of Burnhamville Township was held April 28, 2015 at the Burtrum Community Center. The meeting was called to order at 7:00 p.m. by Chair Mike Berscheit. Members present include Supervi-sors: Mike Berscheit and Bruce Johnson; Clerk Shirley Hulinsky, Treasurer Pam Throener. Absent: Louis Thompson. Others present: Erv Herdering and Ervin Muellner.

The minutes from the regular meeting of March 31, 2015 were approved as presented on a motion by Sup. Johnson. Motion was sec-onded by Sup. Berscheit. Motion passed.

For correspondence the board received letters from the county public works on county road im-provement plans and mileage veri-fication, feed lot expansion notice, CenturyLink construction courtesy notice, and an access permit.

Board heard a report from the county township officer meeting.

The board reviewed the road inspection list from April 10. Board recommended some of the excess brush on Dunlin Road be trimmed back now. Sup. Johnson called the county about trimming trees. Sup. Johnson made a motion to hire Sentence To Serve crew trim trees in the road-right-of-way on Dunlin Road and 331st Ave. in the fall. Sup. Berscheit seconded the mo-tion. Motion passed. Two residents complained of the dangerous ap-proach of Buck Lake public access. Board will contact the DNR to see if it can be moved to top of hill.

A motion was made by Sup. Berscheit to pay all bills numbered 5102 through 5112: Rev. $960.44; R&B $5,209.33; Fire $ 8,528.00. Sup. Johnson seconded the motion. Motion passed.

Saturday, May 16 will be township clean-up day. Sup. Bers-

The “No Turn Around Within” sign on Flicker Road was reported missing. The township will order another one to replace it. The street sign for the intersection of Flicker Rd. and Ermine Dr. as well as the stop sign were missing. A supervi-sor found and reinstalled the street sign; the stop sign was ordered and the board will replace.

Treasurer’s report showed a balance of $93,316.36. Treasurer’s report was approved by Sup. Ber-scheit and seconded by Sup. John-son. Motion passed.

A motion was made by Sup. Berscheit to adjourn the meeting which was seconded by Sup. John-son. Motion passed. Meeting was adjourned at 7:41 p.m. Next regular meeting will be on May 26, 2015 at 7 p.m. in the Burtrum Community.

Shirley Hulinsky, Clerk

Job AdvertisementPosition: City Deputy Treasurer

CITY OF FREEPORT Population 636IMMEDIATE OPENING-Part Time position up to 20 hours/week. Hours are flexible

and will vary depending on time of year and current/future city projects. Responsible for performing all financial duties of the City including financial management and budgeting, accounts receivable, accounts payable, payroll,

general ledger, and account and fund reconciliation. Attends and participates in City Council meetings and other meetings with

official bodies as directed.Reports to and works collaboratively with City Clerk-Treasurer.

Associate Degree in accounting, finance; Bachelor Degree preferredConsiderable finance/accounting experience required. Prior experience in municipal

accounting and finance preferred. Must have experience using Microsoft Office, computer systems, and software applications. Oral and written communication abilities.

A response time of 20 minutes to Freeport is preferred.Hiring Range: ($14-$17)

Job description may be viewed on city website www.freeportmn.orgDownload application from city website: www.freeportmn.org

Send resume, cover letter and completed application electronically to Kathleen Murphy, Murphy Management Consultants at [email protected] by May 25th.

Word Search Answers from May 14

Loven’s Auto Center320-547-2465 • Swanville, MN

STOP! Before you buy a different car.

These are just a few of the very nice vehicles we have for sale.When you compare prices, you will always find our prices lower.

• 2008 Buick Lucerne • 2006 Chrysler Town & Country Van• 2006 Ford 500 • 2004 Mercury Grand Marquis• 2005 Ford Explorer • 2008 Chevrolet Uplander

LISTEN! To the people

who have purchased cars from Loven’s.

LOOK!At the nice

selection of low priced cars at Loven’s.

Pictured is a Black Bear that’s in our back yard raiding the bird feeders in our neighborhood south of Melrose. Some have seen him on their deck and said he is about a 400 pound black bear and is about six feet tall standing. Submitted by Judy Waldvogel.

BLENKERS ROOFING, LLC

Melrose • 320-256-5400 or 320-837-5033

Free EstimatesGutters • Soffits • Fascia • Siding

Johnson Stump Removal & Tree Trimming

• Free Estimates• Reasonable Rates

• Experienced • Fully InsuredStump Grinding w/Portable Grinder

Duane Johnson 320-547-2408 • Swanville, MN

Brian’s PaintingInteriors, Exteriors, Staining, Varnishing

Brian Middendorf 320-285-4403 35 Years Experience

Congratula-tions to Upsala High School Ju-nior, Morgan Carroll, the 2015 April High School Student of the Month. She is the daughter of Megan & Shawn Sayre of Swan-ville, Minnesota

and James Carroll. Morgan is the young-est of six children.

Since coming to Upsala in 2014, Morgan is two-time recipient of the “Sub-ject Area Student of the Month.” She has become a leader amongst her peers and has placed on the UHS “A Honor Roll” all three quarters of this school year. Morgan is an active participant and stu-dent leader in extra-curricular activities including the Robotics Team, serving as its Manager/Safety Captain, and Year-book, serving as its Copy Editor. Mor-gan was also a Girls’ State nominee and will serve as a junior escort for the 2015 Commencement in May.

“Morgan is a great addition to the Upsala student body,” stated Roxann Lewis, Morgan’s American History teacher. “She is an outstanding student academically and an excellent con-tributor in the classroom. Morgan has a very positive attitude, is an independent thinker, and does well expressing her knowledge and opinions effectively. It is a joy to have her in the classroom.”

Morgan stated that the most valu-able class she has taken is her Career and College Readiness class because, “I’ve learned so much about applying for scholarships, which I’m going to rely on to pay for my education.” Addition-ally, Morgan said that the subject she has most enjoyed is English because, “Lit-erature has been a part of my life since

Upsala Sr. High Student of the MonthI was in the womb and my passion for it has not diminished.” When asked about her most valuable life lesson, Morgan stated, “Once you’ve hit rock bottom, there’s nowhere to go but up. This has helped me get through so many difficult situations.”

Outside of the academic environ-ment, Morgan has a part time job with J & S Cleaning and volunteers at the Upsala Public Library. She loves read-ing Stephen King, painting and drawing, listening to music, playing video games, and walking her dog. After graduation, Morgan plans to attend St. Cloud State University majoring in social work. She also would like the opportunity to get involved with a student exchange pro-gram where she might be able to study in Ingolstadt, Germany. When asked what advice she would give her fellow class-mates, Morgan said, “This may just be high school, but what you learn here is going to help you your whole life. Don’t waste this time just because you don’t want to be here. Make the most of it.”

Lake Alex • May 13Team Total ScoreHappy Hookers 12Flensburg Liquor 5Waltman Appraisal 4Country Boys 2Half “N” Inch Short 2Red’s Where’s the fish 2Riverside Meats 2WINK 2

Largest FishFish Date Size NameNo. Pike 5/13 21 3/4” Doug KurowskiCrappie 5/13 14” Ken KliberSunfish 5/13 8 1/4” WallieWalleye 5/13 14” Ken Kliber

Swanville 2014 Fishing League


APPEALEDBLUNTBRIEFCOASTSDECADESDEEPLYDIVEDDRAWNESCAPEFIELDFORGETINJECTING

JUDGESLEAGUELEVELLIGHTLOFTYLOWESTMEETSMETALMISTSMOVIENEEDSNOTES

PEACEPEEPSPRIDEPYRAMIDQUEUESRISESROLLSSATISFACTIONSEALSSEVENSHAKENSISTER

SIXESSQUEEZEDSUBJECTSWELLTAKENTILESTISSUESUPSTREAMUSEFULVOTESWATERYWHIRLING

HOME OF PIONEER FEEDS

ALBANYROLLER MILLS, INC.

320-845-2303Mon.-Fri. 8:00-5:00

730 Church Ave • Albany, MN 56307

www.pooptruck.com

Kirt Olson (owner)866-573-1145 • 320-360-0637MPCA Licensed • Bonded • Insured

Upsala, MN

New Customer & Referral DiscountsCan keep truck off most lawns (185 ft. hose)

LLC

Ph: 320-547-2339 • Fax: 320-547-0085

2nd. & DeGraff P.O. Box 278 • Swanville

SKI SLUMBER

FULL SERVICE LUMBERYARD

Stop in for estimates on all your building projects, big or small

Well Drilling, Service & Water Treatment

320-256-4146Residential & Commercial

24 Hour Service

Framing • RemodelingRoofing • Siding • Windows

Jim Revermann (Melrose) 320-837-5286

Cell 320-250-2786

Lic #2063 4900

Paul (St. Cloud)320-654-9643

Cell 320-333-9643

Dean’s Heating & Cooling

Central Air & Heating SystemsAir Exchange • Central Vac

320-573-4328

- Estimates on New Construction -

The old brick building in St. Rosa came down last Thursday. Photo by John Young.

The Minnesota Department of Natu-ral Resources has lifted burning restric-tions as of May 14 in numerous Min-nesota counties due to decreased fire danger because of precipitation and green-up. This means burning permits will be available for burning of vegeta-tive materials.

Although the state is lifting restric-tions, local counties or municipalities may have specific regulations or restric-tions that affect burning. Check with lo-cal authorities to obtain proper permits before burning.

Up-to-date fire conditions and burn-ing restrictions can be found at www.mndnr.gov/forestry/fire/firerating_re-strictions.html.

Also, because fire danger can change quickly, DNR foresters are able to restrict burning permits in individual

DNR Lifts Burning Restrictions in Much of Minnesota

counties whenever conditions warrant. This could occur if there is a dry, windy day where fires could start easily and burn quickly.

The DNR advises anyone doing burning to keep burn piles small, have a water supply nearby and stay with the fire until it is completely out. If fire es-capes, the person who started the fire is responsible for the damage and suppres-sion costs.

Burning permits are available through state and federal forestry of-fices, from local fire wardens or online by paying a small fee per calendar year. Online permits need to be activated on the day of the burn.

Burning restrictions will remain in place in northern Minnesota until suffi-cient green-up occurs.

Pulse on PeopleKaitlyn Marie Harren from

Swanville, graduated from Brenau Uni-versity with a Master of Science in Oc-cupational Therapy degree during com-mencement ceremonies May 1 and 2.

Founded in 1878, Brenau Univer-sity is a private, not-for-profit nationally prominent comprehensive institution of higher education that enrolls students in graduate and undergraduate studies on campuses and online. Gainesville, Georgia-based Brenau includes the resi-dential Women’s College, which repre-sents the academic and philosophical underpinnings of the liberal arts uni-versity. Brenau also provides coeduca-tional opportunities through the doctoral level, including on-ground programs in Gainesville and other Georgia locales: Augusta, Kings Bay, Norcross and Fair-burn, as well as Jacksonville, Florida. Brenau University offers doctorates in nursing, occupational therapy and phys-ical therapy, a terminal M.F.A. in inte-rior design, specialist in education, mas-ter’s, bachelor’s and associate’s degrees as well as professional certifications. The Women’s College boasts 10 nation-ally competitive intercollegiate Golden Tigers sports teams, national honor societies and national sororities with dedicated residential facilities on cam-pus. The university provides outlets for artistic expression and community ser-vice for all students. Brenau possesses an extensive and distinctive permanent collection of art and presents year-round programming that includes art exhibi-tions, lectures, debates and literary read-ings, and theatrical and musical perfor-mances. www.brenau.edu.

Mariah Prokott of Bowlus, is the recipient of a Concordia Scholarship from Concordia College, Moorhead, MN.

Prokott, a 2015 graduate of Upsala Area High School, is the daughter of Brent and Sandra Prokott of Bowlus.

High school activities in which Mariah has participated include: Year-book, B Honor Roll, Basketball, Volley-

ball and Softball.Concordia College is a four-year

liberal arts college of the Evangelical Lutheran Church in America offering more than 60 majors, including 18 hon-ors majors as well as 12 preprofessional programs.

Officials at Mayville State University are pleased to an-nounce that Sara Herzog of Free-port, has been awarded an Hon-or Scholarship for the 2015-2016 school year. Sara is the daughter of Al-len and Diane Herzog, and she

will study fitness and wellness and play basketball at Mayville State.

Mayville State scholarship awards are based on previous academic perfor-mance and participation in extracurricu-lar activities. They reflect the student’s past accomplishments and potential contributions to the Mayville State com-munity.

Mayville State University, the na-tion’s first Tablet PC campus, is a per-sonable rural campus. Featuring tech-nology-enriched education in which full-time, on-campus students are issued tablet PC notebook computers, MSU is nationally identified for teacher educa-tion, the largest academic program on campus. Business administration and physical education and wellness pro-grams are also popular programs on a campus known for the personal atten-tion provided to its students. Newest programs include nursing, special edu-cation, medical lab science, fitness and wellness, sport management, a minor in music education. The Princeton Review has named Mayville State University a Best in the Midwest College, as desig-nated by the Princeton Review.

Dave’s Unique Furniture


• Building & Remodeling of Residential & Agriculture Structures • All Types of Concrete Work

Free Estimates

Jay Blenker 320-249-4087

Morrison County Sheriff’s OfficeMay 15, 2015: At approximately

4:24 p.m., the office received a report of a two vehicle accident involving a Dodge Caravan and a Chevy pickup pulling a cattle trailer. The accident occurred at the intersection of 95th Street and 110th Ave, in Swan River Township, southeast of Sobieski.

The Caravan driven by 30 year old Jessica Allen of Little Falls was westbound on 95th Street and failed to stop at the stop sign at 110th Avenue. Allen was hit by a pickup pulling a cattle trailer traveling southbound on 110th Avenue, driven by 45 year old David Butkowski of Freeport.

Allen was transported to St. Gabriel’s Hospital by Gold Cross Ambulance with non-life threatening injuries. Butkowski and his passenger were not injured.

The Morrison County Sheriff’s Office was assisted at the scene by Bowlus First Response Team and Gold Cross Ambulance.

Upsala Elementary’s 5th & 6th grade reading class read the book “Breathing Room” by Marsha Hayles, which has recently been honored with the Maud Hart Lovelace Award. The book presented the lives of girls and staff living at Loon Lake Sanitorium in Minnesota, fighting for their lives against tuberculo-sis. Inspired by the story, several girls in the reading class requested a Skype visit from the author. The author eagerly agreed and spent an hour explaining her research process, details about the actual writing process and encourag-ing students to pursue their skills in the areas of reading & writing. Interested in learning a little about this time period in Minnesota’s history? Try reading “Breathing Room” by Marsha Hayles, it is highly recommended by students and adults who have read it in Upsala. Submitted by Linda Piasecki.

Swanville High School Athletes of the MonthSwanville High School is pleased

to announce its April Athletes of the Month: Austin Johnson for USA Base-ball, Stephanie Koetter for USA Girls’ Track, Samuel Mettler for USA Boys’ Track, and Haileigh Sales for Bulldog Softball.

C o a c h e s ’ Comments:

“I would like to nominate Austin Johnson for the Athlete of the Month for baseball. Aus-tin batted .375, scored 5 runs, and is leading the team in RBI’s with 11. Austin is also 1-0 on the mound in 8 2/3 innings pitched.

He has only given up 5 hits, struck out 11 batters and hasn’t allowed an earned run. Austin has numerous big hits for us in the first month of the season. Austin seems to relish those big moments in the game and comes through when his teammates need him the most. Congrats Austin!” - Coach Adam Gerads

“ H a i l e i g h Sales has been chosen as the April Athlete of the Month for softball. Haileigh has re-ally emerged as a leader on the softball team this year. With no se-niors and half the team being fresh-man, there was a need for leader-

Austin Johnson

Haileigh Sales

ship and she has really stepped into that role this year. Haileigh doesn’t hesitate to point out a situation or to explain something to the younger players. She maintains a positive attitude at all times and has a very friendly demeanor on and off the filed. Congratulations Haileigh!” - Coach Tom Bzdok

“The Swan-ville Track Athletes of the Month for April are Stephanie Koetter and Sam Mettler. Stepha-nie is a senior high jumper and sprinter. Sam is a junior jumper and middle dis-tance runner. Both are strong leaders, especial-ly by example for

our track team. Stephanie was a state en-trant in the high jump last year and has posted a season best of 5 foot 6 inches this year at Sauk Centre.

Sam was a section entrant in the 800 m run last year and has posted a season best of 2.13.02 in that event at Sauk Centre this year. We look forward to big things from both Sam and Stepha-nie this season!” - Coach Pete Swisher

Stephanie Koetter

Samuel Mettler

The Holy Trinity Youth Group of Holy trinity Parish in Royalton, along with the Guardian Angel Youth Group which serves the Parishes of St. Stan-islaus in Bowlus, St. Edwards in Elm-dale, St. Mary’s in Upsala, Holy Cross in North Prairie, and St. Francis of Assi-si in St. Francis, will be hosting a Fund-raising Breakfast and Raffle on May 31st from 9 am-noon, at Holy Trinity Church in Royalton. The Menu will consist of French Toast, Sausage, Eggs, Caramel Rolls, and Beverages. Raffle tickets are available from Youth Group members, and will be available at the breakfast.

Proceeds from this event will help fund our Steubenville Youth Conference trip this July.

Benefit Raffle and Breakfast

Mike Chuba: 320-360-3030Aaron Gapinski: 320-248-7343

Residential - Commercial -LakeshoreWeekly, Bi Weekly Mowing

Spring & Fall clean up

Serving Morrison & Todd CountiesLocated in Swanville


JOIN US IN WORSHIPGrace Alive! Evangelical Free Church of America

AlbanyPastor Joe Williquette

721 Lake Ave. • 320-845-7676Sunday Worship 10:00 a.m. Nursery provided.

Immanuel Lutheran Church (Missouri Synod) Albany

Reverend Fred Kutter23845 Co. Rd 40 • 320-845-2620

Sunday Worship 9:30 a.m. Sunday School & Bible Study 10:35 a.m.Our Saviors Lutheran Church-ELCA

AlbanyPastor Stephen Cook

840 Lake Ave • 320-845-2405Sunday Worship 8:00 a.m. & 10:30 a.m. 9:15 a.m. Education Hour.

Seven Dolors Catholic Church, AlbanyFather Michael Naughton, OSB

151 2nd St S • 320-845-2705Mon.-Wed. Mass 7:30 a.m. Wed. 9 a.m. HFS. Fri. 7:30 a.m. Sat. 7:30 a.m. & 5 p.m. Sun. 10:30 a.m.

Avon Community ChurchPastor Chuck Pelkey

204 Avon Ave. N • 320-356-9001Sunday School 9:00 a.m. Worship Service 10:30 a.m.

St. Benedict’s Catholic Church, Avon320-356-7121

Saturday Mass 5:00 p.m. Sunday Mass 8:00 & 10:30 a.m.Brighter Days Family Church, Burtrum

Pastor Anna Payne320-285-7262

Sunday Worship Service 10:30 a.m. Midweek Service, Wednesday, 7 p.m.Faith Community Church, Burtrum

Pastor Allen Travaille320-285-3390 • 320-763-4671

Sunday Fellowship 9:30 a.m. Sunday Service 10:00 a.m. Bi-weekly Bible Study.

St. Edward’s Catholic Church, ElmdaleFather John Odero

8550 Hwy 238 • 320-573-2132Saturday Mass 5:00 p.m. Thursday 8:00 a.m.

St. Stanislaus Kostka Catholic Church, BowlusFather John Odero

428 Main St. • 320-573-2132Sunday Mass 8:00 a.m. Friday 8:00 a.m.

Community Country Church, Holdingford Chaplain Rev. Gregg Valentine

42457 171st Ave. • 320-746-0005Worship Service 9:30 a.m. (nursery available), Small Groups (all ages) 10:45 a.m. Wednesday AWANA & Youth Group at 6:30 p.m.

Sacred Heart Catholic Church, Freeport Father Roger Klassen

106 3rd Ave NE • 320-836-2143Saturday Mass 4 p.m. Weekday Mass: Wed. & Fri. 8:15 a.m. Sacrament of Reconciliation 8:00 a.m. or by appt.

Harvest Church, Freeport Lead Pastor Mitch Wall

Youth Pastor Ricky Backhaus338 W Main St • 320-836-2997

Sunday Worship 9 a.m. Wednesday 7 p.m. Kids Classes, Youth Group, Adult Bible Study & Prayer.St. John's Evangelical Lutheran Church, Grey Eagle

Pastor Ron Tibbetts • Missouri Synod219 Cedar St • 320-285-2902

Sunday Service 9 a.m.; Sunday School 10 a.m. Holy Communion 1 & 3 Sunday.

St. Joseph's Catholic Church, Grey EagleFather Ron Dockendorf

MN & Bovee Sts • 320-285-2545Saturday Service 4:30 p.m. Sunday Service 9:00 a.m.

United Methodist Church, Grey EaglePastor Gary Taylor

30422 Co Rd 2 • 320-285-8013Sunday Worship & Sunday School 9:00 a.m.

All Saints Catholic Church, HoldingfordFather Gregory Mastey

Father John Paul Knopik, Parochial Vicar320-746-2231

Oct. 1.-April 1: Sunday Mass 8:00 a.m. SM. Wed. 8:00 a.m. SH

St. Mary's Catholic Church, MelroseFather Marvin Enneking

211 5th Ave SE • 320-256-4207Saturday Mass 5:00 p.m. Sunday Mass 8:00 & 10:30 a.m. Monday 7:30 a.m. communion service. Tuesday 5:30 p.m. Mass. Wednesday & Thursday 7:30 a.m. Friday All School Mass 8:30 a.m. www.stmarysofmelrose.com

St. Paul's Lutheran Church, MelrosePastor Kevin Mann

207 E 5th St N • 320-256-3847Sunday Worship 9:00 a.m. Wednesday Service 6:30 p.m.

Immaculate Conception Church, New MunichFather Roger Klassen

650 Main St. • 320-836-2143Sunday Mass 9 a.m. Weekday Mass: Thurs. 8:15 a.m. Sacrement of Reconciliation 8:00 a.m. or by appt.

Immaculate Conception Church, St. AnnaFather Gregory Mastey

Father John Paul Knopik, Parochial VicarCo Rd 9 • 320-356-7313

Sat. 8:00 p.m. St. Anthony Catholic ChurchFather Michael Naughton, OSB

24328 Trobec Street • 320-845-2416Thurs. Mass 8:30 a.m. Sunday Mass 8:30 a.m.

St. Francis of Assisi Catholic ChurchFather John Odero

44055 State Hwy 238 • 320-573-2132Sunday Mass 10:00 a.m. Wednesday 8:00 a.m.

St. Rose of Lima Catholic Church, St. RosaFather Roger Klassen

28905 Co Rd 17 • 320-836-2143Saturday Mass 8:00 p.m. Sunday Mass 10:30 a.m. Weekday Mass: Tues. 8:00 a.m. Sacrament of Reconciliation 15 min. before weekday Mass or by appt.

Episcopal Church of the Good Samaritan, Sauk Centre Father Roger V. Phillips 520 Main Street South 320-352-6882 or 320-285-2310Holy Communion/Morning Prayer, 10 a.m. Wed. 1 p.m. Bible Study.

St. John’s Catholic Church, SwanvilleFather Ron Dockendorf

22nd 1st St • 320-547-2920Saturday Service 7:30 p.m. Sunday Service 10:30 a.m.

St. Peter’s Lutheran Church (LCMS), SwanvillePastor Kevin Zellers

505 Berkey Ave • 320-547-2928Sunday Service 9:00 a.m.

Swanville Bible Church301 Berkey Ave • 320-547-2916

Sunday Service 10:30 a.m. Sunday School 9:30 a.m.Community Covenant Church, Upsala

Pastor Craig JohnsonYouth Pastor Joshua Hodgson

122 Main Street • 320-573-2672Sunday Worship Service 10:00 a.m. (nursery available). Wednesday 6:00 p.m. Youth Group.

Gethsemane Lutheran Church ELCA, UpsalaPastor Ken Bowman

418 S Main St • 320-573-2001 Sunday School 9:00 a.m. Sunday Worship 10:30 a.m.; Holy Communion every Sunday. Fellowship following worship.

St. Mary’s Catholic Church, UpsalaFather John Odero

308 S. Main Street • 320-573-2132Saturday Mass 8:00 p.m. Tuesday 6:00 p.m.

Word of Life Free Lutheran Church, UpsalaContact: Steve Johnson

3328 1st Ave W • 320-573-4450Wednesday Kid’s Club, Youth Group & Adult Bible Study 7:00 p.m. Sunday School 9:15 a.m. Sunday Worship Service 10:30 a.m.

THE JUNCTIONConvenience Store • Bait

Open 7 days a week Hours: 6 a.m. to 10 p.m.

320-285-2484 • Grey Eagle

Cold Spring Bakery • Schaefer’s MeatsLeanin’ Tree Gift Cards • DVDs

Central Lakes

ConstructionKen Frieler

320-285-5715

Landscape &

Grey Eagle

Patios, Decks, Retainer Walls, Ceramic Tiling, Remodeling

• Sales • Dock & Lift

Scottie’s Outdoor Services320-333-6382Your

Dealer For

• Installation & Removal• Barge Services

• New Cabinets • Refacing • Refinishing

320-285-7705Bob Asmus • Grey Eagle, MN

Bob’s WoodcraftFor All Your

Cabinet Needs...

Upsala Jr. High Student of the MonthCongratula-

tions to Alison Harren, Upsala Junior High School April Student of the Month.

Alison Har-ren is the daugh-ter of Mike and Kim Harren.

She is cur-rently approach-

ing the end of her 7th grade year. Ali-son enjoys high school activities such as volleyball, basketball, and softball. Additionally, she has received academic accomplishments this year by achieving the A and B honor roll.

Alison is looking forward to sum-mer softball, hanging out with friends and family, and playing other sports. Her plans for the future are unknown, but she lists her favorite class as health. She says that while her favorite is health, she believes that every class is important and valuable.

A character reference from Ms. Kalthoff notes that “Ali is a positive teammate, hard-working athlete, and a responsible student. With a determined attitude, Ali always puts in 100% effort to do her best. She is a well-rounded young lady who will be able to accom-plish anything she puts her mind to.”

Congratulations to the well-deserv-ing Miss Harren for Junior High student of the month.

The Great River Regional Library board of trustees has appointed Karen Pundsack as the new Executive Director of the 32-library system.

Pundsack has been serving as inter-im director since July 2014. She joined Great River Regional Library (GRRL) in 1999 as manager of the Sauk Centre branch. She transferred to the Albany branch in 2002, and began working at

Great River Regional Library Names New Executive Director

Faith Community Church in Bur-trum is excited to host a video series titled “The Family Project” every Sun-day going through Sunday, June 21 from 10-11 a.m. and Thursdays at 7 p.m.

Join Us for “The Family Project”Sunday, May 24 - Lesson 8: Fa-

thers As Image-Bearers. God as “Fa-ther” is more than a motif - it is central to His nature and core to our being. The need for the love of the father is huge in every little boy and girl’s heart, and never ever goes away. And, how each child does in life is directly impacted by how favorable the father/child relation-ship was, is and continues to be. This is huge!!

An alternative showing of this les-son will be held on Thursday, May 28 at 7 p.m. For more info. contact Jim Hobbs at 320-732-3325 or [email protected].

COUNTRYSIDE STORAGE320-285-7116 Burtrum, MN

Storage Space Available You Store It, Lock It

& Keep The Key

GRRL headquarters in St. Cloud in 2009 as Associate Director of Patron Servic-es. As interim director, she has steered the library through its annual budget process, overseen significant personnel hiring decisions, and been responsible for maintaining communication be-tween staff, administration and board of trustees.

Pundsack was one of three candi-dates interviewed in person following a nationwide candidate search and a series of Skype interviews.

A graduate of Albany High School, Pundsack has a degree in Mass Com-munications from St. Cloud State Uni-versity, as well as a Master of Library and Information Science from the Uni-versity of Wisconsin-Milwaukee. She is active in various professional library associations and has been a panel pre-senter at Minnesota Library Association conferences.

Pundsack stated, “I am excited to work with the GRRL staff in this new capacity, and I am humbled and grateful to be able to serve our residents in this role.”

Great River Regional Library (GRRL) provides library services at 32 public libraries in Benton, Morrison, Sherburne, Stearns, Todd and Wright Counties. It provides Central Minnesota residents with nearly 1 million books, CDs and DVDs, 250 public computers, programming and information services.

Deadline for Next Thursday’s Paper is Monday, May 25


OAK RIDGE MANOR APTS.Melrose


Rent based on income. Rent Includes: Water, Sewer, Refuse,

Bulk Rate-CableCall Today & Make Oak Ridge

Manor Your New Home!Office: 320-256-3630Cell: 320-219-3158


One Bedroom Apartments Available!

Townhomes For RentLong Prairie: Terrace Townhome Melrose: Village Townhome East Village Townhome

Contact Jeri at 320-250-7932 Glenwood: Gables TownhomeSauk Centre: Centre Crossing Townhome Centre Village Townhome Little Falls: Edgewater Townhome Courtyard Townhome Royalton: Platwood Townhome

2 Bedrooms • No StepsCommunity Room

All Maintenance IncludedAttached Double Car Garage Available

For Info. Call 320-632-5918

APARTMENTS FOR RENTIn Albany: 1 & 2 Bedroom

763-238-0616 Call Loreen for Details!Cats

Ok

Classified Ads

GARAGE SALE: 18528 Riverwood Drive, Little Falls, May 21-22: 8-4. We are down sizing! Large chest freezer, canning jars, cake decoration items, nu-merous house hold items, decorations, area rugs, pressure canner.

UPSALA SALE: May 22-23; 8 am. 107 Main St.; furniture, garden art.

GARAGE SALE: May 28-30. Done having kids! Lots of boys & girls clothes, toys, highchair, baby vibrat-ing chair, adult clothes, misc. 50th St., Schulte residence.

UPSALA CITY WIDE GARAGE SALES: May 29, 8-6 pm; May 30, 8- noon, maps at Paul & Kathy’s, Farm Store, Community Center, Lange’s.

UPSALA LIONS Sandbox Fill. Call Ken at 320-573-2934 or Rollie at 320-573-2845. 5/28

WANTED TO BUY: Dairy Heifers and Cows. 320-894-7175. SC-evB

FOR SALE: Aluminum pontoon Can-tilever boat lift, $350 or BO. Call 651-398-3150. tfn

FOR SALE: 1989 Dodge Ram short-box 4x4, needs carb, $800. Call 320-256-5400. tfn

FOR SALE: 1953 Ford Golden Jubilee tractor $3,800. Call 320-256-5400. tfn

FOR SALE: Black Angus bulls, calv-ing ease & gentle yearlings and 2 year olds. Call 320-632-0016.

FOR SALE: Capri 14.2 sailboat with Sparten trailer, both good condition, stored indoors, registered thru 12-31-16. Call 320-256-3824.

FOR SALE: Red Lion 1/2 HP convert-ible well, Jet pump. Call 320-285-2442.

FOR SALE: Massey Ferguson gas tractor 180, good tires, runs good, with duals. Call 320-845-2643.

FOR SALE: 1997 Weeres pontoon, $3,700, no motor. Call 320-249-0175.

FOR SALE: One pickup load of dry camp fire wood. Call 320-291-8166.

FOR SALE: 12000 btu window air conditioner. Call 320-291-8166.

FOR SALE: 275 gallon plastic totes in conduit cage. Call 320-492-8032.

FOR SALE: Anniversary clock, new batteries, $45. Call 320-547-2982.

Quality Care...Caring People

Mother of Mercy Campus of Care

Albany, MN

Now Hiring!

320-845-2195

BARTENDERS WANTEDStop in for application.

ALL STARS SPORTS BAR & GRILLSt. Rosa

Nights & WeekendsApply Within

(No Phone Calls Please)Holdingford Gas

& Grocery211 River St. Holdingford

• Cashier Help Needed •

HELP WANTEDFull Time Construction Worker Experience preferred, but not necessary.Benefits include: Health & Life Insurance,

Pension Plan, Very Competitive Pay & Bonuses, Vacation Pay

Apply in person at:

ARNZEN CONSTRUCTION29033 Co Rd 17, Freeport, MN - in St. Rosa

No Phone Calls, Please!

Give Handyman Lee a Call!320-836-7186320-217-3449

Tired of Dirty Windows?

The Minnesota State Fair and the Min-nesota Farm Bureau recognize 222 Minne-sota farms as 2015 Century Farms. Qualify-ing farms have been in continuous family ownership for at least 100 years and are 50 acres or more. Century Farm families re-ceive a commemorative sign, as well as a certificate signed by the State Fair and Min-nesota Farm Bureau presidents and Gov. Mark Dayton. Since the program began in 1976, more than 10,000 Minnesota farms have been recognized as Century Farms.

2015 Century Farm families are listed by county, then by the farm’s city, family names and year of original purchase. The list is also available at the following link: http://www.mnstatefair.org/general_info/recogni-tion.html

Here are the local farms from Morrison, Stearns and Todd Counties:

Morrison County• Pierz, The Kimman Family Farm, 1915• Pierz, John Mueller Family Farm, 1915• Royalton, Busse/Urban, 1902• Swanville, Town Line Farms, 1915

Stearns County• Freeport, Pundsack Dairy, 1915• Sauk Centre, Wehlage Farm, 1888

222 Century Farms Honored in 2015 State Fair, A Salute to Minnesota Family FarmsTodd County

• Bertha, Wilferd & Shirley Johnson, 1914• Browerville, Brichacek Farms, 1912• Carlos, Bruce & Annette Sadlemyer, 1913• Long Prairie, Hengemuhle Dairy, 1913• Long Prairie, Wettstein Farm, 1914• Staples, The Marte Farm, 1913

Information on all Century Farms will be available at the Minnesota Farm Bureau exhibit during the 2015 Minnesota State Fair, which runs Aug. 27 - Labor Day, Sept. 7. A Century Farm database is also available at fbmn.org.

The Minnesota State Fair is one of the largest and best-attended expositions in the world, attracting 1.8 million visitors annu-ally. Showcasing Minnesota’s finest agri-culture, art and industry, the Great Minne-sota Get-Together is always 12 Days of Fun Ending Labor Day. Visit mnstatefair.org for more information.

Minnesota Farm Bureau – Farmers • Families • Food, is comprised of 78 local Farm Bureau associations across Minnesota. Members make their views known to politi-cal leaders, state government officials, spe-cial interest groups and the general public. Programs for young farmers and ranchers develop leadership skills and improve farm

management. Promotion and Education Committee members work with programs such as Ag in the Classroom and safety edu-

cation for children. Join Farm Bureau today and support efforts to serve as an advocate for rural Minnesota, fbmn.org.

Now is Good Time for Farmers to Sign Up for MnDOT’s Standing Corn Row Program

The Minnesota Department of Trans-portation is interested in talking with central Minnesota farmers who are willing to leave a minimum of six rows of corn stalks stand-ing through the winter to earn payment and help reduce the amount of snow blowing onto roads.

Springtime is a good time for farmers to connect with MnDOT to learn about the program and determine if it works for them and if they are in a location where MnDOT needs snow protection. Additionally, Mn-DOT can help coordinate with farmers to look at programs that assist in planting polli-nator vegetation, which provides benefits to pollinators and complements the results of standing corn rows.

The standing corn rows are part of a MnDOT program started about 15 years ago that pays farmers to leave corn stalks up in the winter. The corn rows break the wind’s force, causing the snow to collect around the corn rows instead of drifting onto the roads. The rows improve driver visibility, road surface conditions and lower costs of road maintenance.

Payments are based on a per acre basis using a University of Minnesota calculator tool to determine fair compensation that fac-tors in yield, production costs and inconve-nience factors.

MnDOT is looking for fields on the north and west sides of state highways and interstates where drifting problems occur.

Strategically-placed standing corn rows improve driver visibility during “white out” conditions and improve road surface condi-tions. This assists MnDOT in keeping the roads safer for the traveling public and saves money, especially in fuel costs.

“Standing corn rows reduce blowing and drifting snow on roadways, improve visibility and can help reduce crashes,” said Patty Wallin-Johnson, coordinator of Mn-DOT’s District 3 corn row program in St. Cloud and Baxter. “They can also reduce the risk of ice forming on the pavement.”

Effective corn rows need to be about 200 feet from the highway center line. Agreements generally require that farmers leave from six to 16 rows of corn in various

arrangements until the end of March. Farm-ers may coordinate with nonprofit groups, such as 4-H or Future Farmers of America, to hand pick the corn to salvage the crop as long as the corn stalks are left in good con-dition. Farm operators decide whether they want a non-profit organization to handpick their corn and they coordinate with them.

The standing corn program is a one-year program. Anyone living in Benton, Cass, Crow Wing, Isanti, Kanabec, Mille Lacs, Morrison, Sherburne, Stearns, Todd Wadena or Wright County who is interested in the programs may contact Patty Wallin-Johnson at 320-223-6524 or visit http://www.dot.state.mn.us/environment/livings-nowfence for more information.

DNR QuestionBy Melissa Warhol, DNR Safety and Risk Supervisor

Q: I’m camping over Memorial Day weekend, and I want to avoid exposure to Lyme disease. How can I prevent tick bites?

A: Lyme disease-carrying deer ticks are most active during Mid-May through Mid-July, so it’s important to take precautions when enjoying the outdoors. High-risk areas include hardwood forests, woody/brushy areas and long grass. Here are some tips to prevent tick bites:

• Walk in the center of trails to avoid picking up ticks from grass and brush.

• Wear light-colored clothing so ticks will be more visible. Check and re-check yourself throughout the day.

• Create a barrier to ticks by tucking your pant legs into socks or boots, and wear-ing a long-sleeved shirt tucked into your pants.

• Use a repellent containing DEET or permethrin, and carefully follow the direc-tions on the container. Permethrin-treated clothing is also available at many sporting goods stores.

• After being outdoors in tick habitat, get out of your clothes immediately, do a complete body check, shower and vigorous-ly towel dry. Wash your clothes immediately as to not spread any ticks around your living area.

• Check pets for ticks, too.If you find an attached tick, gently re-

move it with a tweezers. Wash the area and apply antiseptic to the bite. See a doctor right away if you experience a rash, fever, headache, fatigue or other signs of illness. To learn more, visit the DNR website at www.mndnr.gov/insects/deerticks.


1____________ 2____________ 3____________ 4____________ 5_________ 6_____________7____________ 8____________ 9___________ 10_________ 11____________ 12___________ 13___________ 14____________ 15_________ 16____________ 17___________ 18___________ 19____________ 20_________ $.25___________ $.50___________ $.75___________ $1.00_________ $1.25_________ $1.50__________ $1.75___________ $2.00__________ $2.25_________ $2.50_________ $2.75_________ $3.00_________ $3.25_________

Classified AdvertisingPersonal For Sale, Personal Wanted, or Giveaway type ads are FREE up to 20 words. 25¢ For Each Additional Word. Pre-Paid.

Business Ads: For Rent, Help Wanted, Wanted (For Profit), or Service type ads are $5.00 for 20 words. 25¢ For Each Additional Word. Pre-Paid.

Did you remember your phone number?

Email to: [email protected] Mail to: Hometown News

29442 120th St., Grey Eagle, MN 56336

*We Do Not Accept Classified Ads Over the Telephone.

Centered on you.

Auto loanscentered on you.

Subject to credit approval. Membership qualification required. Rates based on past credit history. The rate reduction offered is based on a .25% discount for having a checking account and debit card and will be used to calculate the final Annual Percentage Rate (APR) to be assigned to a new loan. Does not apply to loans already financed with CMCU. Limited time offer. Other restrictions apply. Ask for details.

Federally Insured by NCUA

Finance your new ride with rates as low as 2.62%APR.

Ask us for more details!888.330.8482 | mycmcu.org |

SEARCH ALL HOMES FOR SALE AT:www.brandonkellymn.com

www.lakehomesbybrandon.comEqual Housing

Opportunity

Brandon Kelly, BROKER-REALTOR320-491-6107 or 320-285-3222

Email: [email protected]

BIG BIRCH LAKE: 44450 Birch Park Cr., Grey Eagle: Impossible To Find! Heavily Wooded Adjoining Lake Lots on Premier

Big Birch Lake. This lot has 271’ of great lake shore & over 2 acres of land. This is an extremely rare opportunity to find & buy a lake lot like this on Big Birch Lake. Don’t Delay In Viewing! $300,000

13+ Acres On Long Lake Burnhamville TWP: This property is mostly low ground but may have building eligibility. Property currently has dock access & swimming area. Excellent hunting land with state owned property

adjacent. Great Camping & Hunting Spot! $49,900

BIG BIRCH LAKE: 11751 CO 47: Great West Facing Location on Big Birch Lake. Must See Level Lake Lot with nearly no

elevation to the water. Home features 2 beds & 1 bath. Home needs work but has the potential to be very nice. Affordable opportunity to be on one of MN Premier Lakes! $169,900

BIG BIRCH LAKE: Anne Trail, Grey Eagle: Unique property for sale on W side of Big Birch Lake by Beaver Bay. Nearly 1 acre, heavily wooded buildable lake lot. Great swimming hard bottom

shoreline. A-Frame sits on waters edge, 135’ of lake shore & road frontage. Schedule a Showing Today! $179,900

NEW LISTING 20291 Fisher Drive, Long Prairie: Amazing West facing year round lake home on Latimer Lake. Original owner, barely occupied since new in 2002. Move right in & enjoy the

year at the lake. Features 3 beds, 2 full baths. Gas fireplace, detached garage & shed. Dock included, Must See! $204,777

12153 Alcott Drive, Sauk Centre: Gorgeous custom built home on beautiful Sauk Lake. Amazing West facing lake view, custom Knotty Alder cabinets & Oak millwork, maintenance free exterior,

125’ of lakeshore, asphalt drive, dock & elevator included, deck for entertaining, Must See Lake home! Reduced $299,900

17435 Dunlin Rd, Burtrum: Stunning original owner lake home on Long Lake. Featuring 4 beds & 3 baths. 158’

of lakeshore & views throughout the home you must see. Spacious floor plan, gas fireplace, deck for entertaining, dock & hot tub included, storage shed, tarred drive! $365,000

NEW LISTING BIG BIRCH LAKE: 11602 Arctic Dr.: Very Nice year round home on Big Birch Lake. East facing with spectacular views of lake. 3 bedrooms, 2 baths, gas fireplace, large deck

on lake side, large heated garage with workshop, meticulously maintained property with beautiful landscaping! $249,900

State Hwy 28, Grey Eagle: Building Lot in Birchdale Estates Plat 2. Creek access to Little Birch Lake. Tarred road,

wonderful setting overlooking creek. $39,900SALE PENDING

NEW LISTING BIG BIRCH LAKE 28895 Antelope Trail: Turn key year round home on Premier Big Birch Lake. This property has excellent level lakeshore offering great swimming. Home features 3 beds

& 2 baths, family room with spectacular lake views, screened porch & deck for entertaining. Dock included, Must See! $219,900SALE PENDING

SALE PENDING

NEW LISTING BIG BIRCH LAKE: 11828 County 47 Enjoy living on popular Big Birch Lake with 125’

of shoreline in this Spacious 4 bed, 2 bath home on over an acre lot with secluded back yard w/mature trees & abundant wildlife. Vaulted ceilings, center island, pantry, storage shed, gazebo & More! $269,900

BIG BIRCH LAKE: 10021 County 47, Grey Eagle: Premier Big Birch Lake Home for sale! West facing & property has been recently remodeled from top to bottom. Year round property! Affordable price

for Big Birch Lake. Hard bottom lake shore offering excellent swimming. Don’t Delay Viewing This Property! $185,000

NEW LISTING 32925 Lake Sylvia Road, Melrose: 6 BR, 3 bath home on Popular Little Birch Lake with sandy

shore, vaulted ceilings with loft/game room, walk-out basement, large kitchen/dining/living room area great for entertaining, patio, deck, guest house, 36x32 shed, secluded wooded lot on dead end! $225,900

17568 Dutchman Dr, Burtrum: This is an awesome large 2.90 acre wooded lake lot for sale on Moose Lake Burnhamville TWP. A Must See Lake Lot if you’re searching for

a large lake lot on a small lake. Moose Lake is a 133 acre Natural Environment Lake known for good fishing! $89,900

Congratulations to the Class

of 2015!

Hometown News

Wishing You All The Best!

FOR SALE: 1999 Smokercraft 25’ pontoon, 30 hp Mercury motor, Hoosier trailer, all options, very nice condition, $5,500, see at Loven’s Auto Center, Swanville.

FOR SALE: 1987 deck boat, a real clas-sic, I/O, runs great, see at Lake Country Storage, $1,900 or B/O. Call 320-285-4965. 5/28

FOR SALE: 1992 Chevy 4x4 auto-matic, 5.7 engine, regular cab, 1/2 ton, everything works. Call 320-630-5694.

FOR SALE: Aluminum 2800 lb. boat lift and canopy, Gray canopy like new, wheel caddy, Big Birch Lake, $800/BO. Call 612-810-2354.

FOR SALE: Lake Home, 1 bedroom, patio, newly remodeled, $209,900. Call 320-249-0175.

FOR RENT: One bedroom lake home in the area, $1,300/month + utilities. Call 320-249-0175. ShB-tfnB

Hometown News May 21, 2015

Documents

Transcript of Hometown News May 21, 2015