From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP...

38
From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4 th Singapore Sarcoma Meeting Academia, SGH, Singapore November 6th, 2016 Marius Sudol, Ph.D. Thanks to Richard Quek, Mark Puhaindran, Amos Loh and Kenneth Chang

Transcript of From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP...

Page 1: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

From RSV Oncogene Src to YAP

Oncogene of the Hippo Tumor

Suppressor Pathway

4th Singapore Sarcoma Meeting Academia, SGH, Singapore

November 6th, 2016

Marius Sudol, Ph.D.

Thanks to Richard Quek, Mark Puhaindran,

Amos Loh and Kenneth Chang

Page 2: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Peyton Rous at The Rockefeller Institute of Medical Research. in 1911 Rous reported on a virus-induced sarcomas in chickens

Page 3: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

One of the seminal experiments in biology, which led to identification of the first oncogene, Src

Rous P. (1911). A Sarcoma of the Fowl Transmissible by an

Agent Separable from the Tumor Cells. J Exp Med 13: 397–411.

Page 4: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

SH3 KINASE SH2

Modular and X-Ray Structure of Src - CLOSED CONFORMATION

M

SRC

Page 5: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Normal Transformed

Light

Microscopy

Scanning

Microscopy

Page 6: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Reiko Imai, Toru Akiyama, Akira Kawai

Hidesaburao Hanafusa The Rockefeller University

Page 7: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

WW TAD YAP (1)

WW WW TAD YAP (2)

WW domain was identified

as a differentially spliced-in coding exon

in cDNA of Yes- and Src-associated protein

SH3-BM

ASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPR

Sudol, M. (1994) Oncogene 9, 2145-2152.; Bork, P., & Sudol, M. (1994) TiBS. 19, 531-533; Chen H.I., & Sudol, M. (1995) Proc. Natl. Acad. Sci. USA. 92,

7819-7823.

Page 8: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

W

NH2

COOH

P

Y P

P

S

Y

V WW domain is the smallest among protein modules

X-Ray Structure of WW Domain-Ligand Complex

Macias, M.J., et al., (1996). Nature, 382, 646-649 Huang, X., et al., (2000) Nature Struct. Biol. 7, 634-638.

Page 9: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

SH3 WW

pYxx PxxP PPxY

SH2

WW domain complexes share binding modes with those of SH3 and SH2 complexes

Chen H.I. & Sudol, M. (1995) Proc. Natl. Acad. Sci. USA. 92, 7819-7823 Sudol, M & Hunter, T. (2000) Cell 103, 1001-1004

PPxpY

Page 10: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

WW

WW WW WW WW

WW

WW WW

WW DOMAIN IS PRESENT IN ADAPTORS ENZYMES AND REGULATORS OF TRANSCRIPTION

ABD SPECTRIN Repeats

HECT C2

ISOMERASE

TAD

DR ER

Dystrophin

Nedd-4

PQBP1 Pin1

YAP 1-1

WW WW TAD YAP 1-2

Page 11: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Hippo-YAP signaling pathway

– Loss of function

increased growth

• Well conserved

• Two effectors

– Paralogous proteins

– Yes-associated

protein (YAP)

– Transcriptional

coactivator with PDZ-

binding motif (TAZ)

• Tumor suppressor signaling pathway

• Originally identified in Drosophila

http://www.mechanobio.info/topics/mechanosignaling/signaling-pathways/hippo-signaling/

Page 12: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Hippo-YAP signaling pathway

– Loss of function

increased growth

• Well conserved

• Two effectors

– Paralogous proteins

– Yes-associated

protein (YAP)

– Transcriptional

coactivator with PDZ-

binding motif (TAZ)

• Tumor suppressor signaling pathway

• Originally identified in Drosophila

http://www.mechanobio.info/topics/mechanosignaling/signaling-pathways/hippo-signaling/

W = WW domain

W W

W

W

W

W

W

W

Page 13: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

HIPPO-YAP is a main regulatory pathway for tissue growth and organ development

YAP-8

weeks

YAP-3

months

YAP Normal YAP Normal

Dong & DJ Pan, Cell, (2007) 122, 421-434

Page 14: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Michael Sheetz

MBI, Singapore

Page 15: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

1. Dense vs. sparse cultured cells (Zhao et al. 2007)

1. Small vs. large surface (Wada et al. 2011)

1. Soft vs. stiff substrate (Dupont et al. 2011)

1. Stretching contact inhibited

cells (Aragona et al. 2013, Yidan et al.

2015)

Hippo-YAP signaling is regulated by

mechanical cues

http://www.mechanobio.info/topics/mechanosignaling/signaling-pathways/hippo-signaling/

Page 16: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Mechanical stretch of MKN28 cells causes

fast translocation of YAP effector

Page 17: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Verification of CRISPR-Cas9 KO

of YAP in MKN28 cells

Page 18: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

YAP- KO cells show prominent stress fibers

Page 19: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

F-Actin is increased in YAP KO cells

Page 20: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

YAP KO cells express less ARHGAP29, a suppressor of RhoA

Qiao, Y., and Sudol, M. – unpublished

Zhang, H., et al., (2009) J. Biol. Chem. 284, 13355-13362

Page 21: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

***

YAP-null cells express less ARHGAP29, a suppressor of RhoA. RNA was harvested from wild-type, YAP-null (YAP K/O) and YAP-rescue (YAP K/O+Flag-YAP) cells and reverse-transcribed into cDNA before real-time PCR analysis (n=4).

Promoter of ARHGAP29

Chromatin Immuno-Precipitation

EXON1 EXON2

-1356 -1351 Locus #1

-536 -531 Locus #2

GGAATT GGAATT

+1

Page 22: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

YAP KO cells have more active RhoA, leading to increased phosphorylation of Cofilin (Ser3)

Page 23: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

YAP KO cells have more active RhoA, leading to increased phosphorylation of Cofilin (Ser3)

Page 24: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

YAP KO cells have more active RhoA, leading to increased phosphorylation of Cofilin (Ser3)

Page 25: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Atomic Force Microscopy was used to measure stiffness of adherent YAP KO MKN28 cells

Page 26: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

**

Young’s Modulus of single adherent YAP KO MKN28 cells and YAP rescued cells

Page 27: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Aspiration flow rate (ml/hr) Volume aspirated ∆V(ml) Corresponding aspiration pressure (Pa) Pipette Radius (μm)

Wild-type YAP K/O

Micropipette aspiration assay of YAP KO in MKN28 cells

Page 28: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

CONTROL YAP+/+

Page 29: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

KNOCK-OUT YAP-/-

Page 30: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

YAP in Cancers Potent oncogene in HCC, Dj Pan, JHSM, Baltimore, USA PTPN14–YAP WW domain partner is mutated in relapsed neuroblastoma, Angelika Egger, Berlin-Charite Germany YAP is nuclear in pediatric liver cancers, Kashayar Vakili, Boston Children Hospital, USA YAP-TEF3 fusion in 10% of Epithelioid Hemangio- Endothelioms, Brian Rubin, Cleveland Clinic, Ohio, USA Activated YAP causes embryonic rhabdomyosarcoma in mice, Fernando Camargo, Boston Children Hospital, USA

Page 31: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Persistent YAP hyperactivity in activated but

not quiescent satellite cells causes tumours in

vivo

Pax7-YAP1 S127A

Yap P S127A

Yap P S127A

Pax7, Myf5, MyoD-YAP1 S127A + activated satellite cells

No tumourigenesis apart from small tumour at injection site

Persistent Yap hyperactivity & activated satellite cells tumours in 100% of mice.

Tremblay et al Cancer Cell (2010)

Page 32: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

YAP knock down in ERMS (RD) cells reduces

transformation and xenotransplant size

A B

Tremblay et al Cancer Cell (2010)

Page 33: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Src is the first oncogene, it causes spindle cell sarcoma in birds

YAP oncogene is amplified in liver cancer and may paly a role in

embryonic rhabdomyosarcoma

Cells without YAP proto-oncogene are more rigid than control cells

Changes in ARHGAP29 impinge on RhoA-LIMK1-Coflin to stabilize

F-actin

Mention a new modality for treating cancers

Page 34: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

My Laboratory

Yiting QIAO Ashwini

KARANATH

Megan FINCH EDMONDSON

Bowen ZHU Pearlyn TOH Max HOSELBARTH

Page 35: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Acknowledgements 1

Yiting QIAO Megan FINCH EDMONDSON Ashwini KARANATH IMCB - Collaboratios and Advice: Walter Hunziker, Wanjin Hong, Ed Manser, Phil Kaldis, Uttam Surana, Haiwei Song, Vinay Tregaonkar, Nic Plachta

Collaborators: YAP-RIGIDITY - Himanshu Singh, Bena Lim and Chwee Teck Lim EBOLA - Prakash Amurugam, Fan Hao, Max Hoeslebarth, Gautam Sethi Ron Harty, Mark Bedford, Dev Sidhu, Amjad Farooq GIH-Francesco Gervasio, Yan Jie, Gene Yeo

Page 36: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

Alberta Innovates –Health Solutions

Acknowledgements 2

Page 37: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,

?

Page 38: From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor ...€¦ · From RSV Oncogene Src to YAP Oncogene of the Hippo Tumor Suppressor Pathway 4th Singapore Sarcoma Meeting Academia,