Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences
description
Transcript of Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences
![Page 1: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/1.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
1
Stanislav Luban1,2
Daisuke Kihara2,1
1. Department of Computer Sciences2. Department of Biological Sciences
Purdue University, West Lafayette, IN
Comparative Study of Small RNA and Small Peptides in
Complete Genome Sequences
![Page 2: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/2.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
2
Introduction: Structural Small RNA (sRNA)
Genes which produce non-coding transcripts that function directly as structural, regulatory, or catalytic RNAs
Include rRNAs, tRNAs, small nucleolar RNAs, spliceosomal RNAs, viral associated RNAs, microRNAs, ctRNAs, and others
In Rfam (RNA families) database, 34496 sRNA entries distributed among 352 known families are stored
In E. coli, about 50 sRNAs are known
(figure from Rfam database: http://www.sanger.ac.uk/Software/Rfam/)
![Page 3: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/3.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
3
Methods: QRNAModel distinctive pattern of mutation: Conserved Structural RNA
Pattern of compensatory mutations consistent with base-paired secondary structure
Pair Stochastic Context-Free Grammar Model Conserved Coding Region
Pattern of synonymous codon substitutions Pair Hidden Markov Model
Other Types of Conserved Regions Approximated by “null hypothesis” that mutations occur position
independently, without pattern Pair Hidden Markov Model
Scores are log likelihoods used to calculate final log odds score for RNA model compared to other two models
(Figure: Rivas et al, Current Biol. 2001)
![Page 4: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/4.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
4
Procedure for Extracting sRNAs
Extract Intergenic RegionsFrom 30 Sequenced Genomes
Perform All Vs. All Nucleotide-Nucleotide BLAST
Run QRNA, Extract AlignmentsScoring as sRNAs vs. Coding and Null Hypothesis Regions
Select Significant Alignments,Concatenate and Format into QRNA Program Input
Verify Results ComputationallyAnd Experimentally
(Yet To Be Done)
Eliminate Alignment Regions Which Overlap >50% with E. coli Regulatory Regions
Extend Regions Within 25 ntOf Other Regions Causing
Them To Include Each Other
Merge sRNA Regions Which Align or Exactly Overlap Into Families
Eliminate Family Regions Not Found Using Both Query And
Database Organism As Source
![Page 5: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/5.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
5
Genome Data Set30 Microbial Genomes Used as Queries and Databases:
Gammaproteobacteria
Acinetobacter calcoaceticus Blochmannia floridanus Buchnera aphidicola Coxiella burnetii Erwinia carotovora Escherichia coli Haemophilus ducreyi Haemophilus influenzae Pasteurella multocida Photorhabdus luminescens Pseudomonas aeruginosa Pseudomonas putida Pseudomonas syringae Salmonella enterica Salmonella typhimurium Shewanella oneidensis Shigella flexneri Vibrio cholerae Vibrio parahaemolyticus Vibrio vulnificus Wigglesworthia brevipalpis Xanthomonas campestris Xanthomonas citri Xylella fastidiosa Yersinia pestis
Alphaproteobacteria
Agrobacterium tumefaciens Brucella melitensis Caulobacter crescentus Mesorhizobium loti
Deinococci
Deinococcus radiodurans
![Page 6: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/6.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
6
Result Statistics
Total number of intergenic regions: 94464
Average number of intergenic regions per organism: 3148.8
Total combined length of intergenic regions: 16663732 nt
Average length of intergenic region: 176.4 nt
![Page 7: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/7.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
7
sRNA Length vs. Score Plot
0
20
40
60
80
100
120
140
0 500 1000 1500 2000
Length (nt)
Sc
ore
(lo
g o
dd
s)
Total: 29488 sRNAs
![Page 8: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/8.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
8
875
10361094
976
383
744679
1189
15101372
773715
612
1412
316
1003
1848
503 455
729807
271
1000
2178
401
1402
1788
13311201
885
0
500
1000
1500
2000
2500
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
Organism
Num
ber
of s
RN
A E
ntri
esTotal: 29488 sRNAs
Number of sRNA Entries by Organism
1 - Pseudomonas putida2 - Shigella flexneri3 - Xanthomonas citri4 - Shewanella oneidensis5 - Wigglesworthia brevipalpis6 - Haemophilus ducreyi7 - Pseudomonas syringae8 - Erwinia carotovora9 - Escherichia coli10 - Vibrio parahaemolyticus11 - Mesorhizobium loti12 - Buchnera aphidicola13 - Brucella melitensis14 - Yersinia pestis15 - Xylella fastidiosa16 - Pseudomonas aeruginosa17 - Salmonella enterica18 - Caulobacter crescentus19 - Agrobacterium tumefaciens20 - Blochmannia floridanus21 - Pasteurella multocida22 - Deinococcus radiodurans23 - Vibrio cholerae24 - Photorhabdus luminescens25 - Coxiella burnetii26 - Vibrio vulnificus27 - Salmonella typhimurium28 - Acinetobacter calcoaceticus29 - Xanthomonas campestris30 - Haemophilus influenzae
![Page 9: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/9.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
9
Conservation of sRNAs
0
2797
594
240
7526 17 11 1 1 0 2 0 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1
0
500
1000
1500
2000
2500
3000
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
Number of Entries from Distinct Organisms
Nu
mb
er o
f sR
NA
Fam
ilie
s
Total: 3768 families
![Page 10: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/10.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
10
0
2797
594
240
75 26 17 11 1 1 0 2 0 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 10
247121107 46 10 10 7 0 1 0 1 0 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1
0
500
1000
1500
2000
2500
3000
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
Number of Entries from Distinct Organisms
Nu
mb
er o
f sR
NA
Fam
ilie
s
Conservation of sRNAs
Total: 3768 families
E. Coli Total: 554 families
Along with statistics for all entries, statistics for entries containing at least one entry from E. coli were added for comparison
![Page 11: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/11.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
11
Common OrganismCombinations in Families Top 5 most frequent combinations of 4 and 7 organisms:
Combination: Occurances:
Ecoli, Senterica, Sflexneri, Styphimurium 117
Ecarotovora, Ecoli, Senterica, Styphimurium 26
Ecoli, Senterica, Styphimurium, Ypestis 20
Ecarotovora, Ecoli, Sflexneri, Styphimurium 18
Ecoli, Sflexneri, Styphimurium, Ypestis 17
Ecarotovora, Ecoli, Pluminescens, Senterica, Sflexneri, Styphimurium, Ypestis 4
Acalcoaceticus, Ccrescentus, Mloti, Paeruginosa, Pputida, Psyringae, Xcampestris 2
Acalcoaceticus, Atumefaciens, Ccrescentus, Mloti, Pputida, Psyringae, Xcampestris 2
Acalcoaceticus, Atumefaciens, Ccrescentus, Mloti, Paeruginosa, Psyringae, Xcampestris 2
Acalcoaceticus, Atumefaciens, Ccrescentus, Mloti, Paeruginosa, Pputida, Xcampestris 2
![Page 12: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/12.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
12
Result Verification
71 total sRNAs related to E. coli already found to be annotated in Rfam database were used as benchmark
Of those: 15 – found by computational method that were also listed in Rfam and not
tRNAs 6 – not found due to shortcomings of method 29 – tRNAs already annotated as gene loci in E. coli genome sequence used 10 – E. coli plasmid loci not found in full E. coli genome sequence used 2 – 4.5S RNAs already annotated as gene loci in E. coli genome sequence used 2 – E. coli reverse transcriptase loci not found in full E. coli genome sequence used 1 – E. coli insertion sequence not found in full E. coli genome sequence used 1 – E. coli small RNA annotated separately, not found in full E. coli genome sequence used 1 – Antisense RNA already annotated as gene locus in E. coli genome sequence used 1 – Cloning vector with E. coli promoter not found in full E. coli genome sequence used 1 – E. coli transposable element not found in full E. coli genome sequence used 1 – Reporter vector not found in full E. coli genome sequence used 1 – E. coli retron not found in full E. coli genome sequence used
![Page 13: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/13.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
13
Candidates for ExperimentalVerification of Findings
For the following 2 slides:
Family designation expressed as [Organism name] [locus absolute start location] [locus absolute end location] and is synonymous with the first (header) entry of that family
Entries refer to number of different organism (2 chromosomes counted separately) sRNA entries in the family
Length (nt) and score only refer to the header entry of the family
Scores calculated by QRNA program with log odds post for RNA likelihood as opposed to null hypothesis
![Page 14: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/14.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
14
Candidates for ExperimentalVerification of Findings Top 10 highest statistically scoring E. coli sRNA loci
found by computational method:
Family designation: Ecoli 3941194 3941327 Length: 133 Score: 34.114 Family designation: Ecoli 2744345 2744445 Length: 100 Score: 29.631 Family designation: Ecoli 780875 781068 Length: 193 Score:
29.194 Family designation: Ecoli 2687537 2687689 Length: 152 Score: 27.734 Family designation: Ecoli 2519348 2519548 Length: 200 Score: 23.876 Family designation: Ecoli 4169337 4169400 Length: 63 Score: 21.625 Family designation: Ecoli 4038218 4038281 Length: 63 Score: 21.596 Family designation: Ecoli 2751994 2752022 Length: 28 Score: 20.893 Family designation: Ecoli 3420989 3421058 Length: 69 Score:
20.821 Family designation: Ecoli 3808832 3808858 Length: 26 Score:
16.995
![Page 15: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/15.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
15
Candidates for ExperimentalVerification of Findings
Top 10 largest sRNA families found by computational method:
Family designation: Styphimurium 3358766 3358804 Entries: 18 Length: 38 Score: 4.590 Family designation: Ecarotovora 3161909 3161946 Entries: 15 Length: 37 Score: 12.604 Family designation: Ecarotovora 1144121 1144141 Entries: 12 Length: 20 Score: 5.265 Family designation: Styphimurium 3342804 3342899 Entries: 12 Length: 95 Score: 4.328 Family designation: Ecarotovora 2597534 2597593 Entries: 10 Length: 59 Score: 3.343 Family designation: Paeruginosa 2508264 2508282 Entries: 9 Length: 18 Score: 7.068 Family designation: Styphimurium 975191 975219 Entries: 8 Length: 28 Score: 16.296 Family designation: Styphimuriu 3746886 3746903 Entries: 8 Length: 17 Score: 1.146 Family designation: Ecarotovora 3477891 3477922 Entries: 8 Length: 31 Score: 2.697 Family designation: Ecarotovora 4490537 4490683* Entries: 7 Length: 146 Score:
16.753
*This last entry was used a sample for detailed study and is discussed subsequently.
![Page 16: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/16.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
16
Detailed Study of Located Sample sRNA
Organism Location (in genome) Length(nt) Score Neighboring Genes
Ecarotovora 4490537-4490683 146 16.753 rpsM - rpmJPluminescens 5487752-5487866 114 10.791 rpsM - secYYpestis 232330-232476 146 15.757 rpmJ - rpsMStyphimurium 3585744-3585879 135 41.980 rpsM - rpmJSenterica 4243623-4243770 147 40.046 rpmJ - rpsMEcoli 3440108-3440255 147 43.556 rpsM - rpmJSflexneri 3426855-3427002 147 41.980 rpsM - rpmJ
Hit to Alpha_RBS RNA (Rfam: RF00140) (115 nt)
Rfam Sequence: GUCCUUGAUAUUCUGUUUGAGUAUCCUGAAAACGGGCUUUUCAAGAUCAGAAUAUCAAAUUAAUUAAAAUAUAGGAGUGCAUAGUGGCCCGUAUUGCAGGCAUUAACAUUCCUGAU
![Page 17: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/17.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
17
Most Likely (Lowest Free Energy) Predicted Fold of 80 nt Segment of Sequence
Mfold by Zuker et al, 2004 Used
Detailed Study of Located Sample sRNA
![Page 18: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/18.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
18
Another Approach to Finding sRNAs in E. Coli: Paper Summary
![Page 19: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/19.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
19
Method Used in Paper to Find Putative sRNAs
A database of all E. coli intergenic DNA sequences was created based on gene annotations in early release of the EcoGene database, and used as input to profile search program (pftools2.2, Swiss Bioinformatics Institute) set to find sigma-70 promoter
Terminator motif was searched for in database using following search criteria: (1) An 11-nt A-rich region; (2) variable-length hairpin; (3) variable-length spacer; (4) 5-nt T-rich region nearest the hairpin; and (5) 7-nt distal extra T-rich region
Predicted promoter and terminator pairs were combined to generate putative sRNAs if (1) pair was on same strand; and (2) pair was greater than 45 but less than 350 nt apart
To verify, open reading frames and possible ribosome binding sites were searched for downstream of each promoter
![Page 20: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/20.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
20
Synopsis of Method Used in Paper
Using the E. Coli MG1655 genome, DNA regions that contained a sigma-70 promoter within a short distance of a rho-independent terminator were searched for
227 putative sRNAs between 80 and 400 nt in length were predicted in E. coli by paper, 32 of which were already known to be sRNAs
Transcripts of some of the candidate loci were verified using Northern hybridization
Approach may possibly be used in annotating sRNA loci in other bacterial genomes
![Page 21: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/21.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
21
Verification of Paper Results with Results Using Our Method
Along with other results, the paper gives a detailed listing of the 277 sRNAs predicted, including the designation, strand orientation (forward or reverse), left and right boundaries (nt from genome start position), and length (nt) of each sRNA
Left and right boundary positions in genome given by paper were compared with left and right boundary positions of putative sRNAs found by our method
If an sRNA candidate from the paper was within 100 nt of any sRNA predicted by our method, that sRNA was scored as ‘found’
![Page 22: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/22.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
22
Results of Verification
227 candidate sRNAs were predicted in E. coli by the paper
Among them, 150 (66.1 %) were localized by our method, according to previously utilized criteria
The test was re-run with a 50 nt threshold, yielding 140 hits (61.7 %), a 10 nt threshold, yielding 128 hits (56.4 %), and a 1000 nt threshold, yielding 187 hits (82.4 %)
![Page 23: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/23.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
23
Preliminary Procedure for Extracting Small Peptides
Extract Intergenic RegionsFrom 30 Sequenced Genomes
Perform All Vs. All Nucleotide-Nucleotide BLAST
Run QRNA, Extract AlignmentsScoring as Coding vs. sRNA and Null Hypothesis Regions
Select Significant Alignments,Concatenate and Format into QRNA Program Input
Observe Results and RefineExtraction Method
Extend Regions Within 25 ntOf Other Reions Causing
Them To Include Each Other
Merge sRNA Regions Which Align or Exactly Overlap Into Families
Blast Resulting Family EntriesAgainst SwissProt Database
Score Regions Based onQuality of Fit Inside a Nearby
Open Reading Frame
![Page 24: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/24.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
24
Preliminary Results of Small Peptide Search
Organism Location (in genome) Length(nt) E-ValueErwinia Carotovora 843815-843948 133 0.69
Aligns To gb|AAF36091.1| flagelliform silk protein [Nephila madagascariensis]
Sequenceaattccgtcgcatgttctctggtgagtacgacagcgcggattgctatctggatattcaggcgggatctggcggtacggaagcgcaggactgggccagcatgctggtacgtatgtacctgcgttgggcggaagc
Query: 133 LPPNAGTYVPACWPSPALPYRQIPPEYPDSNP 38
Subject: 1373 LPPLXTSXXPPPPPPPSXPLXSLPPSXPPSLP 1278
Tblastx Alignment
Query Sequence Information
![Page 25: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/25.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
25
Preliminary Results of Small Peptide Search
Organism Location (in genome) Length(nt) E-ValuePseudomonas syringae 6171796-6172006 210 0.23
Aligns Toemb|CAD88221.2| C. elegans GRL-25 protein (corresponding sequence ZK 643.8)
Sequencetgagttccggcagctcgtcatccagcttctgacgcaaccgcccggtcagaaacgcaaagccctcgagcaaccgctccacatccggatcccgtccggcctgccccagaaacggcgccaacgccggactacgctcggcgaagcgacgaccaagctggcgcagtgcagtgagttcgctctggtagtaatggttaaaggacacgggttacctgc
Query: 62 PRATAPHPDPVRPAPETAPTP 124Subject: 90 PPAPAPRPPPVAPAPRPLPPP 28
Tblastx Alignment
Query Sequence Information
![Page 26: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/26.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
26
Conclusions
Possible sRNAs are found from 20~39% of the intergenic regions in each organism
Among them, ~31% of the sRNAs satisfy the log-odds score threshold of 5.0 or higher
137 “families” are conserved in equal to or more than 5 organisms
Being well conserved, sRNAs may be responsible for fundamental functions of living organisms
![Page 27: Comparative Study of Small RNA and Small Peptides in Complete Genome Sequences](https://reader036.fdocuments.net/reader036/viewer/2022062309/5681438a550346895db0090d/html5/thumbnails/27.jpg)
3.31.2005 BIOL497 Undergraduate Presentation, Stanislav Luban, Member of Kihara Lab, Purdue Univ.
27
Future Direction
Search for sRNAs will be expanded to a larger quantity of more diverse genomes
Secondary structure prediction will be later employed in greater detail to verify well conserved sRNA regions among multiple evolutionarily distant organisms
Experimental verification of the findings of this particular study under way (particularly for Shewanella oneidensis)
Comparative genomics will be used to discover the function associated with each sRNA and possibly lead to learning its part in pathway