Abstract Book All

SMAP Conference, September 19th-22nd 2011, Avignon 1/381

Popes' Palace photos credit :Yann Fareins / Noir d'Ivoire

2/381 SMAP Conference, September 19th-22nd 2011, Avignon

Table of contentsGeneral information.....................................................................5

SMAP 2011..................................................................................................6Avignon.......................................................................................................6Organizing committee.................................................................................8Scientific committee....................................................................................9Sponsorship...............................................................................................10Popes' palace plan.....................................................................................12Practical information.................................................................................14Oral sessions organisation........................................................................16Poster sessions organisation.....................................................................17Exhibitor List..............................................................................................18Exhibition organisation.............................................................................19Program.....................................................................................................21

Abstracts.....................................................................................27Invited conference.....................................................................................27Selected short oral communications.........................................................47Posters.......................................................................................................87

Participants list.........................................................................357Author Index.............................................................................369


General information


SMAP 2011We are delighted to welcome you to the new SMAP (Mass Spectrometry and Proteomic Analyses) scientific meeting, which will take place in Avignon, France, from September 19th to 22nd, 2011. This scientific congress is co-organized by SFSM (Société Française de Spectrométrie de Masse) and SFEAP (Société Française d'Electrophorèse et d'Analyse Protéomique). The SMAP2011 congress has for objective to promote scientific disciplines called to play crucial roles in the XXIth century biology and chemistry. The whole French-speaking scientific community will exchange in Avignon on federative themes, subjects in emergence and new technological developments domains related to mass spectrometry and proteomics.

AvignonAvignon is one of the most beautiful and famous cities in France and well-known around the world thanks to the famous song about the bridge of Avignon. Its beautiful and typically medieval city center on both banks of the Rhône river attracts millions of tourists each year. Named the City of the Popes or Altera Roma, Avignon retains the indelible mark of the Popes’ stay in the city, which was for a while the capital of the Medieval western world. Today, it is a prestigious cultural capital with its world-renowned Theatre Festival. Within a short time, the tourist can visit the most various sites: Pont du Gard, Nîmes, Arles, the Camargue, Luberon and Ventoux, Baux de Provence, St Rémy and the Alpilles are close to the town. The variety of attractions and sites to visit can enrich your trip to Provence. The era of the Popes somewhat eclipses other events in what is a long and tumultuous history. At the crossroads of the big trade and migratory routes between northern and southern Europe and between Italy and Spain, the city played a major role in European history. A Phoenician trading post during the High Antiquity, Avignon then became a flourishing Roman town. It suffered greatly from the barbarian invasions, followed by those of the Moors and the Francs in the High Middle Ages. With the expansion of trade, and benefiting from its strategic position and its bridge over the Rhône, it had the status of a free town, strong and arrogant enough to defy the King of France. The presence of the Popes made Avignon the capital of the Medieval

western world in the 14th century. A papal territory up until the French Revolution, the city actually benefited little from the first Industrial Revolution. It entered into relative anonymity in the 19th century only to come back as a cultural capital in the 20th century. Avignon is the cradle of the Félibrige, a revival of Provençal literature and its Theatre Festival, started in 1946 by Jean Vilar, gives it international prestige.

During the 14th century, the city of Avignon was part of the Pontifical States, and as such was sheltered from war and destruction. Since the High Middle Ages, Avignon has been a vital intellectual and commercial cross-road in Europe, a choice location for exchange, meetings and discussions. Today, its internationally-known cultural influence and attraction have made it one


of the most prestigious conference sites in the world. The International Congress Center was created in 1976 within the outstanding premises of the Palace of the Popes and hosts many events throughout the entire year. The Congress Center, designed for conventions, seminars, and meetings, now occupies two wings of the Popes’ Palace. The Jeanne Laurent Building, an outlying building just outside the Popes’ Palace Congress Center, is located in the former papal gardens and can host working meals or exhibits relating to congresses held in the Congress Center. The Jeanne Laurent building is made up of four vaulted rooms in exposed stone, with magnificent views over the Rhône river, offering a splendid panorama of the Rhône Valley.


Organizing committee

Jean Armengaud1

Alain Dedieu1

Christian Godon1

Véronique Malard1

Olivier Pible1

Jean-Charles Gaillard1

Philippe Guérin1

Céline Bland1

Béatrice Alonso1

Anne-Hélène Davin1

Nicole Sage1

Jérôme Garin2

Christophe Bruley2

Myriam Ferro2

Damien Barthe2

Véronique Dupierris2

Annie Adrait2

Alexandra Kraut2

Sabine Brugière2

Céline Fleury2

Marie Arlotto2

Mathieu Baudet2

Yves Vandenbrouck2

1 Laboratoire de biochimie des systèmes perturbés (LBSP),Institut de biologie environnementale et biotechnologie (IBEB)Direction des sciences du vivant (DSV)Commissariat à l’Energie Atomique et aux Energies Alternatives (CEA), BP17171, 30207 Bagnols-sur-ceze

2 Etude de la Dynamique des Protéomes (EDyP)Laboratoire Biologie à Grande Echelle (BGE)U1038 INSERM/CEA/UJFInstitut de Recherches en Technologies et Sciences pour le Vivant (iRTSV)Commissariat à l’Energie Atomique et aux Energies Alternatives (CEA),17 rue des Martyrs, 38054 Grenoble


Scientific committee• Marc Bonneu, Plateforme Proteome, Centre de Génomique Fonctionnelle Bordeaux, 146 rue

Léo Saignat, F-33076 Bordeaux Cedex

• Julia Chamot-Rooke, Laboratoire des Mécanismes Réactionnels, CNRS UMR 7651, Ecole Polytechnique, 91128 Palaiseau Cedex

• Philippe Dugourd, Laboratoire de Spectrométrie Ionique et Moléculaire, UMR5579 CNRS/Université Lyon 1, 43 bd du 11 Novembre 1918, F-69622 Villeurbanne Cedex

• Jérôme Garin, Laboratoire Biologie à Grande Echelle (BGE), U1038 INSERM/CEA/UJF, CEA), 17 rue des Martyrs, F-38054 Grenoble Cedex,

• Bruno le Bizec, LABERCA - U1329 INRA, Ecole Nationale Vétérinaire, Agroalimentaire et de l’Alimentation Nantes Atlantique (ONIRIS), Atlanpôle – Site de la Chantrerie - BP 50707, F-44307 NANTES Cedex 3

• Philippe Marin, Institut de Génomique Fonctionnelle, CNRS UMR 5203, INSERM U661, Universités Montpellier I & II, 141, rue de la Cardonille, F-34094 Montpellier Cedex 5

• Charles Pineau, INSERM U625, Proteomics Core Facility Biogenouest, Campus de Beaulieu, Université de Rennes I, F-35042 Rennes, France

• Michel Salzet, Laboratoire de Spectrométrie de Masse Biologique Fondamentale et Appliquée (FABMS), EA 4550, IFR 147, Cité Scientifique, Université Lille Nord de France, Lille 1, 59650 Villeneuve d'Ascq


Sponsorship


Popes' palace plan

1-Salles des Gardes : Welcome / Informations / Registration2-Cellier Benoit XII : Oral conferences (even number) & Manufacturer conferences3-Paneterie : Poster sessions n°1 & n°25-Conclave : Plenary conferences & Oral conferences (odd number)7-Chambre du trésorier : Manufacturer conferences9-Herses Champeaux : SFEAP & SFSM Young12-Grande audience : Exhibitors room & Coffee breaks13-Espace Jeanne Laurent : Lunch & Gala dinner


1-Salles des Gardes : Welcome / Informations / Registration

3-Paneterie : Poster sessions n°1 & n°2

7-Chambre du trésorier : Manufacturer conferences

2-Cellier Benoit XII : Oral conferences (even number) & Manufacturer conferences

5-Conclave : Plenary conferences &Oral conferences (odd number)

12-Grande audience : Exhibitors room & Coffee breaks


Practical informationOffice hour of desksPlease collect your satchel, program book, name badge from the registration desk. The registration desk will open at the «Salle des Gardes» : • Monday 19 September, 2 pm - 7 pm• Tuesday 20 September, 8 am - 6:30 pm• Wednesday 21 September, 8 am - 6:30 pm• Thursday 22 September, 8 am - 4 pm

Official languageThe official languages of the congress are English and French according to the laws of the French republic on the use of the French language. The oral communications and the posters can be in French, in that case, their summary and title are presented in French in the program and the book of summaries.

StaffVoluntaries will be at your disposal to welcome you, guide you in the center of the Popes' Palace Conference Center, during the sessions and the excursions. Do not hesitate to seek them, they are recognizable in their T-shirt with the logo of the SMAP2011 Avignon congress.

BadgesFor security and regulation reasons, please wear your name badge at all times. It is your admission to all sessions, breaks in the "Grande Audience" room, lunches in Jeanne Laurent Building.

Coffee breaksMorning and afternoon coffee breaks will be served only in the «Grande Audience» room. Participants are not allowed to carry out drinks or food in working rooms.

BanksPlease, note that there will be no exchange facilities at the International Conference Center. Lots of banks are present in Avignon center all around the Popes’Palace Conference Center.

Cellular phonesCellular phones must be switched off in the conference rooms.

Lost and FoundFor lost and found personal belongings, please contact the information desk in the «Salle des Gardes».

First AidIn case of emergency, please, contact the information desk in the «Salle des Gardes».

HotlineUnder this phone number you can reach the desk at all office hours : +33 490 27 51 50.

ContactsPlease feel welcome to provide the Local Organizing Committee with any feedbackor to ask for clarification of any information.• Registration queries, please contact Ms.

Céline Gallard by email [email protected] or phone +33 490 27 50 57

• Scientific queries, please contact Mr Jean Armengaud or Mr Jérôme Garin by email, respectively [email protected] and [email protected].

SmokingPlease remember that smoking is not allowed in the congress center.

WifiWireless connexion will be available in «Grande audience» and «Salle des gardes» rooms.

Changing roomA changing room will be open throughout the conference in the main entrance near the «Salle des gardes». It will be possible to store luggage in this changing room area.

ToiletsThey are situated near the «Salle des Gardes», between the «Paneterie» and The «Conclave» hall, in «Jeanne Laurent» Building and near the «Grande Audience».


Oral sessions organisationThey will occur in the room of Conclave and Cellier Benoit XII (respectively n°5 and n°2 on the plan page 12).

Instructions for oral communication• Short oral presentations will be strictly limited to 15 minutes. A 5-minute period

between presentations will accommodate questions, discussion, and introduction of the next speaker. This 5-minute period belongs to the audience and to the chairs of the session, not to the speakers. TIME LIMITS WILL BE STRICTLY ENFORCED BY SESSION CHAIRS.

• Microsoft PowerPoint and Adobe Acrobat Reader are the only acceptable audiovisual formats for electronic presentations. Accepted formats are: .ppt, .pps or .pdf. The venue will be equipped with a dedicated PC laptop operated under windows. Please, bring your presentation on a Flash drive.

• Uploading your presentation should be done preferentially once you register for the SMAP meeting upon your arrival in “Salles des Gardes”. You should upload your presentation either the day before for an oral presentation in the morning or in the morning if your presentation is scheduled in the afternoon.

• Please, be present in the conference room 15 min before the beginning of your session in order to have time to discuss with the session chair that will be in charge to introduce you.

• We recommend to all speakers to have all their slides in English as a courtesy for our foreign guests. Oral presentation of your talk in English will be appreciated.

Organisation des conférencesElles se dérouleront dans les salles du Conclave et Cellier Benoit XII (respectivement n°5 et n°2 sur le plan page 12).

Instructions pour les conférences sélectionnées• Durée des présentations : 15 min précisément et 5 min gérées par le modérateur

permettant des questions / discussions et l’introduction de l’orateur suivant. Compte tenu de la configuration du centre des congrès et de la circulation entre les salles en session parallèle, les horaires seront strictement respectés.

• Fichier : Les présentations doivent être faites sous Powerpoint ou Adobe Acrobat Reader. Fichiers acceptés : .ppt, .pps ou .pdf. Le PC de projection sera sous Windows. Apportez votre présentation sur clé USB.

• Remise des fichiers : ils devront être remis de préférence au moment de votre enregistrement à l’accueil du palais des Papes (Salle des Gardes). En dernier recours : la veille si votre conférence est le matin ; le matin si votre conférence est l’après-midi.

• Etre présent 15 min avant le début de votre session dans la salle où se déroulera celle-ci afin de rencontrer le modérateur en charge d’introduire votre présentation.

• Nous recommandons à tous les conférenciers de présenter l’ensemble de leurs diapositives en anglais par courtoisie auprès de nos invités anglophones. La présentation orale de vos travaux en anglais serait très appréciée.


Poster sessions organisationThere will be two poster sessions, both will be in the Paneterie room (n°3 on the plan, page 12).

• Session n°1 : Poster P1 to P134• Session n°2 : Poster P135 to P268

Display : poster should be mounted : • Session n°1 : From tuesday 20 september before 8:30am, till wednesday 21

september 12:00am. At the end of session n°1, posters will be removed to give way to those of session n°2,• Session n°2 : From wednesday 21 september before 1:30pm till thursday 22

september 3:30pm.

Organisation sessions postersIl y aura deux sessions poster, les deux se tiendront dans la salle Paneterie (n°3 sur le plan page 12).

• Session n°1 : Poster P1 à P134• Session n°2 : Poster P135 à P268

Affichage : votre poster devra être mis en place : • Session n°1 : Le mardi 20 septembre avant 8h30 jusqu'au mercredi 21 septembre

12h00. A la fin de la session n°1 les posters seront enlevés pour faire place à ceux de la session n°2.• Session n°2 : Le mercredi 21 septembre avant 13h30 jusqu'au jeudi 22 septembre

15h30.


Exhibitor List1 - AB SCIEXMr Jean- Baptiste VINCENDET

2 - ADVIONMr ees VLAK

3 - AGILENT TECHNOLOGIES Mr Frédéric METRAL

4 - ASA - ADVANCED SOLUTIONS ACCELERATORMr Valentin BOUQUETMr Frédéric VIART

5 - BIO RADMr Patrick BELLEMINMr Stéphane FESSEMAZ

6 - BIOSOLVE CHIMIEMr Julien GUERIN

7 - BRUKER BECKMANNMrs Chirstine HERR

8 - PROTEINSIMPLE (CELL BIOSCIENCES)Mr Thierry SALOMON

9 - CEM µ WAVESMr Nicolas RAYNAL

10 - CHROMACIM SASMr Pierre BERNARD SAVARY

11 - CLUZEAU INFO LABOMrs Catherine BALTHASAR

12 - COVALXMr Alexis NAZABAL

13 - DECODON GMBHMr Markus KOLBEDr Martin LINKE

14 - DIONEXMr Claude NETTER

15 - EURISO-TOPMr Jean- Louis SCHAFFARMr Gaétan SEEBURN

16 - F-DBSMrs Fabienne PALGE

17 - GENGAZ EURLMr Eric LEPOUTRE

18 - JEOL EUROPEMr Akihiko KUSAIMr Jean- Pierre MUNIER

19 - LABTECHMr Lionel Chauvin

20 - LECO FRANCEMr Sergio MELISMr Guillaume CHARLOT

21 - LGS LAB GAZ SYSTEMSMr Patrick VESCOVI

22 - MS VISION BVMr Gerard VAN DER LAANMr Nico WORTEL

23 - NONLINEAR DYNAMICSDr Andy BORTHWICKMrs Agnès CORBIN

24 - PERKINELMERMrs Karima BAUDINMr Christophe CLARYSSE

25 - PROMEGAMr Emmanuel CRENN

26 - PROTEABIO EUROPEMrs Christine AYOUBMr Alban LECOLLEN

27 - PROTEOME SOFTWAREMs Jana LEE

28 - SERVA ELECTROPHORESIS GMBHMr Philippe BOGARDDr Reiner WESTERMEIER

29 - SHIMADZUMr Mikael LEVIMr Stéphane MOREAU

30 - TECAN FRANCE SASMr David RODARIEMr Xavier SAUNIER

31 - THERMO ELECTRON SASMr Christophe DABADIEMr Louis DESCHANELMr Jocelyn DUPUYMr Thierry LEGOUPILMr Etienne MAOUTMrs Madeleine PEYTAVIN

32 - WATERSMrs Sophie BERTAUX


Exhibition organisationIn Grande Audience room(n°12 on plan page 12)


Program- Codes in square brackets are the abstracts' identifiers :• [Ix] are for « Invited » conferences• [Ox] are for selected Oral conferences

- Numbers in brackets next to room name refering to popes' palace plan, page 12.

9:00am-12:00am1:30pm-3:30pm

Petite Cuisine (16) Training dayImagerie MALDI-TOF : des drogues aux protéines

1:30pm-3:30pm Salle des gardes (1) Conferee check-in

1:30pm-3:30pm Herses-Champeaux (9) SFEAP & SFSM Young

4:00pm-4:30pm

Conclave (5)

SFSM & SFEAP presidents' welcome word

4:30pm-5:30pm Opening conference 1 Graham COOKSAmbient Ionization and Miniature Mass Spectrometers

[I7]

5:30pm-6:30pm Opening conference 2 Michel DESJARDINSProteomics analyzes reveal unexpected aspects of the

evolution of phagosomes over 1.2 billion years [I8]

6:30pm-9:00pm Grande Audience (12) Cocktail & Inauguration Exposition

7:00pm-9:00pm - Private guided tour of the Popes' Palace


Monday September 19th

8:30am-9:25am Conclave (5) Plenary conference 1 - Anne-Claude GAVIN - A systematic screen for protein–lipid interactions in Saccharomyces cerevisiae [I10]

9:35am-12:30am Session 1 - System's Biology

9:35am

Conclave (5)

Paola PICOTTI - Targeted proteomics from proteins to proteome maps : potential and bottlenecks [I16]

10:10am Régis Lavigne - Systems analysis of budding yeast fermentation and respiration [O25]

10:30amPaneterie (3)Grde Audience (12)

Break :Poster session n°1Coffee & Exposition

11:30am

Conclave (5)

Hans C. Hürlimann - Using proteomics to identify AICAR cellular targets [O27]

11:50am Gérémy Clair - System biology insights into the global remodeling of proteome and pathogenicity of Bacillus cereus induced by oxydoreduction potential [O32]

12:10am Bertrand Fabre - Characterization of cellular proteasome complexes diversity by proteomic approaches [O13]

9:35am-12:30am Session 2 - Imaging & Mobility

09:35am

Cellier Benoit XII (2)

Jennifer BRODBELT - Development and Applications of Photodissociation for Biological Applications [I4]

10:10am Grégory Hamm - Développement Méthodologique pour la Quantification en Imagerie par Spectrométrie de Masse (qMSI) [O26]



11:30am


Daniel Lafitte - Quelle voie pour la caractérisation d’ isoformes protéiques sur coupe de tissu par MALDI in source decay ? [O31]

11:50am Claudia Bich - Compatibilité entre histologie et imagerie par spectrométrie de masse ToF-SIMS : détection et cartographie de lipides au sein de tissus biologiques [O5]

12:10 Patrice Garcia - Détection de l’epo humaine recombinante dans les fluides biologiques equins par LC-MS/MS [O34]

12:40am-1:55pm Jeanne Laurent (13) Lunch

12:55am-2:25pm Cellier Benoit XII (2) Manufacturer conference : Agilent

1:40pm-2:25pm Chbr du Trésorier (7) Manufacturer conference : AB Sciex

2:00pm-2:25pm Grde Audience (12) Exposition


Tuesday September 20th

2:30pm-3:25pm Conclave (5) Plenary conference 2 - Martin JARROLD - Charge Detection Mass Spectrometry [I12]

3:35pm-6:30pm Session 3 - Instrumentation

3:35pm

Conclave (5)

Perdita BARRAN - Ion Mobility Mass Spectrometry for Intrinsically Disordered Proteins a SWOT analysis [I2]

4:10pm Quentin Enjalbert - Photo-SRM: laser photo-dissociation improves detection selectivity of selected reaction monitoring mode [O7]

4:30pmPaneterie (3)Grde Audience (12)


5:30pm

Conclave (5)

Mathieu Dupré - LDI-MS of proteolytic synthetic model peptides deposited on silicon-based nanowires: an alternative to MALDI PMF? [O17]

5:50pm David Touboul - ETD à pression atmosphérique [O6]

6:10pm Marion Girod - Optical profiling of an Agilent Jet Stream Technology electrospray by Laser-Induced-Fluorescence coupled to mass spectrometry measurements [O14]

3:35pm-6:30pm Session 4 – Proteome Dynamics

3:35pm


Christopher OVERALL - Traveling to the Ends of the Proteome World. Positional N-terminal and C-terminal proteomics deciphers protein terminal and proteolytic post-translational modifications in the HPP [I15]

4:10pm Catherine Moali - Use of quantitative proteomics to study function and specificity of an emerging protease family in cell-based assays [O22]



5:30pm


Anne Gonzalez de Peredo - Evaluation of label-free quantitative proteomic methods together with sample fractionation for the large-scale analysis of inflammatory endothelial cells [O18]

5:50pm Joseph Gault - Post Translational Modifications and Pathogenesis of Bacterial Meningitis Is a «one shot» Approach for Complete Mapping Realistic? [O37]

6:10pm Pascal Seyer - Identification and characterization of new protein partners of serotonin transporter [O29]

6:45pm-8:15pm Cellier Benoit XII (2) Manufacturer conference : Thermo

6:45pm-8:15pm Chbr du Trésorier (7) Manufacturer conference : Waters


Tuesday September 20th

8:30am-9:25am Conclave (5) Plenary conference 3 - Guy BOUCHOUX - From the mobile proton to wandering hydride ion: some mechanistic aspects of gas-phase ion chemistry [I3]

9:35am-12:30am Session 5 - FT-ICR, Complexes

09:35am

Conclave (5)

Christian ROLANDO - Two dimensional FT-ICR, the only way to obtain all the MS/MS correlations from a sample without selecting the parent ions. Instrumental developments and analytical applications [I17]

10:10am Carlos Afonso - Identification par très haute résolution FT-ICR de processus induits par la charge dans la décomposition de peptides cycliques en ECD [O33]



11:30am

Conclave (5)

Edith Nicol - Mechanisms leading to unusual ECD fragments: the ion spectroscopy perspective [O11]

11:50am Sébastien Schramm - Tabagisme actif/tabagisme passif, une étude différentielle de la fraction particulaire [O15]

12:10am Elisabetta Boeri Erba - Quantifying Protein-Protein Interactions Within Noncovalent Complexes Using Electrospray Ionization Mass Spectrometry [O3]

9:35am-12:30am Session 6 - Proteomics & Health

09:35am


Bruno DOMON - A Novel Strategy in Quantitative Proteomics: Its Implication for Biomedical Research [I9]

10:10am Christophe D. Masselon - Bladder Cancer Biomarker Candidates Discovery in a Multi-site Patients Cohort: a Label-free Quantitative Proteomics Study [O38]

10:30amPaneterieGrde Audience (12)


11:30am


Willy V. Bienvenut - Proteomic targeting of angiogenic cell lines by fumagillin mostly relies on the expression levels of METAP1 [O16]

11:50am Yannick Charretier -Microorganism characterization for the clinics using SRM [O19]

12:10am Jérôme Chenau - Détection sensible et spécifique des spores de Bacillus anthracis dans des matrices environnementales par immunocapture et spectrométrie de masse en mode MRM [O28]

Poster session n°1 taking down / Poster session n°2 hanging up


12:55am-2:25pm Cellier Benoit XII (2) Manufacturer conference : Bruker

12:55am-1:50pm Chbr du Trésorier (7) Manufacturer conference : Advion

1:55pm-2:25pm Chbr du Trésorier (7) Manufacturer conference : Promega

2:00pm-2:25pm Grde Audience (12) Exposition


Wednesday September 21st

2:30pm-3:25pm Conclave (5) Plenary conference 4 - Seth Grant - The organization of synapse proteomes [I11]

3:35pm-6:30pm Session 7 - Signaling

3:35pm

Conclave (5)

Sacha BAGINSKY - Functional Proteomics: A Cornerstone in Plant Systems Biology [I1]

4:10pm Sonia Hem - Targeted proteomics profiling of the plasma membrane transportome in Arabidopsis thaliana [O20]



5:30pm

Conclave (5)

Franck Vandermoere - A quantitative phosphoproteomic approach reveals differential phosphorylation of serotonin 2a receptor upon activation by hallucinogenic versus non-hallucinogenic agonists [O1]

5:50pm Jordane Biarc - The Induction of Serine/Threonine Protein Phosphorylations by Native and Mutant PDGFR/TrkA Chimeras in Stably Transfected PC12 Cells [O2]

6:10pm Sonia Cantel - Reflectron Positive ion Mode Matrix-Assisted Laser Desorption/Ionization Mass Spectrometric Analysis of Sulfo-peptides [O8]

3:35pm-6:30pm Session 8 - Fragmentation

3:35pm


Yury TSYBIN - Traveling to the Ends of the Proteome World. Positional N-terminal and C-terminal proteomics deciphers protein terminal and proteolytic post-translational modifications in the HPP [I18]

4:10pm Emmanuelle Sachon - Effets de l’acétylation des peptides de la peau de la rainette Pachymedusa dacnicolor pour un séquençage de Novo par MALDI-TOF/TOF [O21]



5:30pm


Corinne Buré - Structure Determination of Complex Plant Glycosphingolipids by Tandem Mass Spectrometry [O4]

5:50pm Stéphane Bouchonnet - Investigating the unusual behavior of Metolachlor under chemical ionization in hybrid ion trap mass spectrometry [O12]

6:10pm Thierry Fouquet - Analytical strategy combining NMR, chemical synthesis and mass spectrometry for molecular and structural characterization of plasma-polymerized siloxanes [O23]

6:30pm-7:55pm Cellier Benoit XII (2) SFSM Meeting

6:30pm-7:55pm Chbr du Trésorier (7) SFEAP Meeting

8:00pm-11:30pm Jeanne Laurent (13) Gala dinner


Wednesday September 21st

8:30am-9:25am Conclave (5) Plenary conference 5 - Olga VITEK - Statistical methods and tools for protein quantification in MS-based proteomics [I19]

9:35am-12:15am Session 9 - Bioinformatics

09:35am

Conclave (5)

Oliver KOHLBACHER - Automated high-throughput analysis of quantitative proteomics data [I14]

10:10am Christine Carapito - Une suite logicielle pour la protéomique interfacée sur une grille de calcul. Utilisation d'algorithmes libres pour l'identification MS/MS, le séquençage de novo et l'annotation fonctionnelle [O30]



11:30am

Conclave (5)

Markus Muller - Evaluating the accuracy of the positioning of phosphorylations by MS/MS spectra [O24]

11:50am Benoit Valot - Nouveaux algorithmes de regroupement pour gérer l'identification des protéines ou de modifications post-traductionnelles dans les analyses de protéomique à haut débit [O36]

9:35am-12:15am Session 10 - Metabolomics

09:35am


Pascal KINTZ - Mass spectrometry in forensic hair testing : example of drug-facilitated crimes [I13]

10:10am Emilien Jamin - Développement d’une méthode de métabolomique associant la RMN et l’UHPLC-HRMS [O9]



11:30am


Sylvain Chéreau - Prises d’empreintes urinaires par LC-HRMS : La métabolomique, une stratégie innovante pour le dépistage de l’utilisation d’anabolisants en élevage [O10]

11:50am Agnéta Kiss - L’apport de la spectrométrie de masse haute-résolution à l’obtention d’empreintes moléculaires d'échantillons d’urine. Applications potentielles au dopage [O35]


1:30pm-2:15pm

Conclave (5)

Plenary conference 6 - Virginie BRUN PSAQ standards for accurate quantification of proteins: from the concept to clinical application [I5]

2:15pm-2:30pm SFSM / SFEAP prizes

2:30pm-3:25pm Closing conference - Pierre CHAURAND MALDI Imaging Mass Spectrometry: Principle, State of the Art and Future Challenges [I6]

3:30pm Closing


Thursday September 22nd

Invited conference


[I1] Functional Proteomics: A Cornerstone in Plant Systems Biology

Sacha BAGINSKY Martin-Luther-Universität Halle-Wittenberg, Institut für Biochemie und Biotechnologie, Abteilung Pflanzenbiochemie, Weinbergweg 22 (Biozentrum), 06120 Halle (Saale), Deutschland

Contact : [email protected]

Different functional proteomics tools are now available that enable the quantitative characterization of proteome dynamics and the mapping of posttranslational modifications. We report here examples how we used these tools to characterize the functional proteome of Arabidopsis and rice cell organelles, with a focus on plant-specific plastids. We analyzed the Arabidopsis proteome at genome-scale and provide quantitative information about organellar proteomes in different plant organs by «normalized spectral counting» (Baerenfaller et al., Science 320, 938-41; Baerenfaller et al., Integrative Biology 3, 225-237). For a functional characterization of plastid protein import, we analyzed the proteomes of protein import mutants and established protein N-termini to distinguish precursor from mature plastid proteins in WT, ppi1 and ppi2. These analyses revealed the accumulation of precursor proteins in the cytosol of protein import mutants. In order to assess the short-term regulation of the chloroplast proteome in response to environmental signals, we analyzed the chloroplast phosphoproteome and characterized its dynamics during a circadian cycle (Reiland et al., Plant Physiol. 150, 889-903). Phosphorylation motif utilization suggests that the phosphorylation network topology in chloroplasts is characterized by many-to-many relationships. To establish the kinase/substrate nodes in this network we performed comparative quantitative phosphoproteome profiling experiments with wildtype and kinase mutant plant material, starting out with the STN8 kinase. Differential protein phosphorylation was assessed by relative quantification with «extracted ion chromatograms» and the data were further validated by functional characterization of selected substrates (Reiland et al., Proc. Natl. Acad. Sci. USA, in press). We present here our data, comment on reliability and reproducibility and propose strategies to increase both at a reasonable cost.


[I2] Ion Mobility Mass Spectrometry for Intrinsically Disordered Proteins a SWOT analysis

Perdita BARRAN The EastChem School of Chemistry, The University of Edinburgh, Edinburgh, UK


The p53 protein is a transcription factor which plays a central role to tumour suppression. Loss of p53 function is correlated with the development of cancer in which the

MDM2 protein binds to the N-terminal transcription activation domain shutting down function3. Mass spectrometry studies of WT p53 and mutants of the DNA binding domain following nano-electrospray from native conditions show a wide charge state range for charge states n= 8 - 18 for monomeric species of the general form [M+nH]n+. Mass spectrometry data from both instruments are qualitatively similar. The most abundant peaks are at n =9 and n=10 indicating the dominance of a compact structure. Multimeric species are observed for the WT and mutants, however the dimers shown in the WT are more intense. Generally, the collision cross-sections of the monomer are observed to increase with increasing charge in a stochastic fashion attributed to protein unfolding due principally to coulombic repulsion, which can be attributed to the ‘plasticity’ of these IDP’s . Multiple gas-phase conformers are resolved for a number of charge states, over a very wide charge state range. Subtle differences in unfolding transitions between the WT and mutated samples can be characterized. For instance the H115N mutant, altered at the boundary of loop I seems to be less structured – favoring the more extended conformations when compared with WT p53.,Conversely, the R249A/H115N mutant appears to be more compact. The thermally induced unfolding also shows interesting trends, and in particular reveals the resistance to unfolding of this important IDP. These results are interpreted in terms of the biological activity of these proteins and also in terms of the implications for the use of IM-MS to study this largely ignored, but critically important, class of proteins.


[I3] From the mobile proton to wandering hydride ion: some mechanistic aspects of gas-phase ion chemistry

Guy BOUCHOUX Ecole Polytechnique, Laboratoire des Mécanismes Réactionnels (DCMR), Département de Chimie, 91120 Palaiseau, France; CNRS, UMR 7651, Palaiseau Cedex, France


Structural characterization of molecular species by mass spectrometry supposes the knowledge of the type of ions generated and the mechanism by which they dissociate. In this context, a need for a rationalization of ESI(+)(-) mass spectra of small molecules has been recently expressed [1]. Similarly, at the other end of the mass scale, efforts are currently made to interpret the major fragmentation processes of protonated and deprotonated peptides and their reduced forms produced in electron capture (ECD) or electron transfer (ETD) experiments [2,3]. Most fragmentation processes of molecular and pseudo-molecular ions may be described by a combination of several key mechanistic steps: simple bond dissociation, hydrogen atom, hydride ion or proton migrations, formation of ion-neutral complex intermediates… Selected crucial aspects of these elementary reactions, occurring inside positively charged ions, will be recalled and illustrated by examples taken in the recent mass spectrometry literature. Emphasis will be given on the protonation process and its consequences in term of structure and energetic [4].1 – WMA. Niessen. Mass Spectrom Rev 2011, 30, 626-663.2 – AG Harrison. Mass Spectrom Rev 2009, 28, 640-654.3 – SA McLuckey, M Mentinova. J Am Soc Mass Spectrom 2011, 22, 3-12.4 – G Bouchoux. Mass Spectrom Rev 2007, 26, 775-835.


[I4] Development and Applications of Photodissociation for Biological Applications

Jennifer BRODBELT Department of Chemistry and Biochemistry, University of Texas at Austin, Austin, TX 78712


The tremendous growth in the application of mass spectrometry for detection, quantification and characterization of biological molecules has spurred the exploration of new ion activation/dissociation methods. Although collision induced dissociation (CID) remains the gold standard for structural characterization of ions, it has several shortcomings (e.g. insufficient energy deposition, limited applicability for pinpointing post-translational modifications in peptides, etc.) that have stimulated the search for other activation methods. Photodissociation offers an especially promising alternative to traditional CID in ion traps, in addition to its success with FTICR and time-of-flight instruments.There are several compelling advantages of using lasers to activate ions in a mass spectrometer. Photoactivation is a non-resonant process, meaning that both the selected precursor ions and primary fragment ions may be activated, leading to secondary dissociation and a richer array of fragment ions without requiring deliberate sequential stages of ion manipulation. The ability to

vary energy deposition without resorting to multi-stage experiments (MSn) is particularly important when analyzing macromolecules in which initial ion currents may be low and the total sample quantity is limited.The reduction of ion losses is a critical feature when analyzing small ion populations while maintaining adequate detection sensitivity. Photoactivation can be utilized to analyze both negative and positive ions, so it offers the potential for broader characterization of the proteome. UV photodissociation using a laser offers fast, high energy deposition that yields good sequence coverage for peptide analysis.


[I5] PSAQ standards for accurate quantification of proteins: from the concept to clinical application

Virginie BRUNLaboratoire d'Etude de la Dynamique des Protéomes, Unité de Biologie à Grande Echelle, CEA/INSERM/UJF 1038, 17, rue des Martyrs, 38054 cedex 9 Grenoble, France


Technological developments that will provide reliable and multiplex quantification of proteins in biofluids are critical for biomarker research and medical science. Mass-spectrometry analysis is currently attracting considerable interest due to its multiplexing capacities. Combined with stable isotope-labelled quantification standards [1], MS-based assays can provide quantitative data for hundreds of peptides generated by trypsin digestion of proteins. However, to envision MS as a relevant methodology for biomarker evaluation and biomarker measurement in clinical laboratories, some analytical variabilities still need to be resolved [2].

In 2007, we developed the PSAQTM method (Protein Standard Absolute Quantification) which uses full-length isotope-labelled protein standards to quantify target proteins [3]. In this

presentation, we’ll demonstrate the specific advantages of the PSAQTM method for accurate and reliable quantification of protein biomarkers. Recent technological advances related to the

production and use of PSAQTM standards will be presented. Several applications of the PSAQTM

method in the health domain will also be exposed.

References1. Brun V. et al., (2009) Isotope dilution strategies for absolute quantitative proteomics. J. Proteomics 72, 740-749.2. Hoofnagle A.N. et al., (2010)Quantitative Clinical Proteomics by Liquid Chromatography-Tandem Mass Spectrometry: Assessing the Platform. Clin. Chem. 56, 161-164.3. Brun V. et al (2007) Isotope-labeled protein standards: toward absolute quantitative proteomics. Mol. Cell. Proteomics 6, 2139-2149.


[I6] MALDI Imaging Mass Spectrometry: Principle, State of the Art and Future Challenges

Pierre CHAURAND Département de chimie, université de Montréal. Montréal, Québec, Canada


MALDI-based imaging mass spectrometry is a new technology that allows to map different biocompounds and xenobiotics directly from thin tissue sections. Numerous classes of biomolecules including metabolites, phospholipids, peptides and proteins can be detected and mapped in direct correlation with the underlying histology. Molecular profiles and images depend on the types of tissues or cells studied and certain signals can be directly correlated with the health status of the tissue specimen. Indeed, the technology is sufficiently sensitive to detect variations in the molecular composition induced by the presence of disease or by drug uptake. Numerous technical advances such as automated matrix deposition and the development of in situ chemistries now allow us to study the proteomic content of fresh frozen and formalin fixed paraffin embedded tissue specimens. After an introduction of the technology and a description of current progresses the different fields of research of imaging mass spectrometry will be presented. In particular its enormous potential in clinical settings in complement to traditional histopathology and its important role in the study of drug distribution and effects in various biological tissues will be described. Finally, a critical outlook will be made towards the developments to be made for the technology to become a mainstream analytical tool.


[I7] Ambient Ionization and Miniature Mass Spectrometers

Graham COOKSDepartment of Chemistry, Purdue University, West Lafayette IN 47907, US


The recent development of ambient ionization methods is transforming the applications of mass spectrometry (MS) allowing virtually any sample to be examined in air, rather than being introduced into the vacuum system. This talk focuses on two ambient ionization methods: (i) paper spray (PS) in which in which samples are ionized in air, directly from filter paper (and similar materials including whole plant or animal tissue) and (ii) desorption electrospray ionization (DESI) in which the sample is impacted by charged microdroplets which pick up analyte by dissolution and carry it to the MS. The physical basis of each of these experiments is described.DESI finds application in disease diagnosis by tissue imaging and examples of human bladder, liver and brain cancer diagnostics will be given. DESI imaging combines the chemical information collected for multiple analytes from the mass spectrometer with spatial information, which makes it useful for analyzing histological sections of biological tissue. Alterations in the distribution of polar lipids are associated with malignant transformations in tissue. Multivariate statistical analysis using principal component analysis (PCA) is used to analyze the imaging MS data, magnifying differences between the lipid profiles of tissue as a function of disease state. Data showing glioma diagnosis and prostate biomarker recognition will be emphasized.Whole blood analysis for therapeutic agents is achieved in a few seconds using paper spray. Remarkably, the method is quantitatively accurate and precise and covers the therapeutic range for many oncology drugs. The promise of this method for point-of-care diagnostics will be shown. LTP applications in food safety and bacterial identification also will be described. Ultimately ambient ionization methods are best used with handheld miniature mass spectrometers, a combination that has enormous potential to transform in situ chemical analysis. Progress in interfacing ambient ionization sources to miniature mass spectrometers is described.The support of this work by NSF, DOE and the Alfred Mann Foundation at Purdue is gratefully acknowledged as is ongoing collaboration with Prof. Zheng Ouyang.


[I8] Proteomics analyzes reveal unexpected aspects of the evolution of phagosomes over 1.2 billion years

Jonathan Boulais, Matthias Trost, Pierre Thibault, Michel DesjardinsDépartement de Pathologie et Biologie Cellulaire, Université de Montréal, Montréal, Québec, Canada


Phagosomes are intracellular organelles formed in a variety of cells following the engulfment of large particulate materials by phagocytosis. This organelle plays key roles in both innate and adaptive immunity by promoting the establishment of the molecular properties needed to kill microorganisms and present some of their antigens on MHC molecules.In the last 20 years, the striking advances in the field of proteomics and systems biology have largely contributed to our understanding of the molecular mechanisms regulating phagosome functions. This presentation will highlight how the application of large-scale approaches has contributed to reveal novel aspects of the functional properties of phagosomes and their emergence during evolution.


[I9] A Novel Strategy in Quantitative Proteomics: Its Implication for Biomedical Research

Bruno DOMONLuxembourg Clinical Proteomics Center, CRP-Santé, Strassen, Luxembourg


The generation of accurate and comprehensive data sets has become an essential element of systems biology and biomarker studies. While large scale discovery experiments one hand and targeted quantitative analyses on the other are nowadays widely used in proteomics, we are proposing an alternative approach, which is based on a novel quadrupole/orbitrap instrument. The high acquisition speed and the exquisite sensitivity of such a hybrid mass spectrometer allow performing reliable qualitative and quantitative experiments. The additional selectivity intrinsic to the high resolution orbitrap mass analyzer enables the development of novel quantification methods. Quantitative experiments can be performed either in full scan mode (using the high-resolution / accurate mass capability) or in MS/MS mode by analyzing specific fragment ions (i.e. SRM-like mode). The different modes of operation, their advantages and limitations will be presented in details. This technique has been applied to precisely quantify biomarker candidates in bodily fluids, and more specifically in urine samples. The quantitative analyses were performed in conjunction with stable isotope dilution, using second generation synthetic polypeptides, composed of one universal reporter fragment facilitating the systematic, precise quantification of multiple analytes in complex biological samples.


[I10] A systematic screen for protein–lipid interactions in Saccharomyces cerevisiae

Anne-Claude GAVINStructural and Computational Biology Unit, European Molecular Biology Laboratory, 69117 Heidelberg, Germany


Biological function emerges from the concerted action of numerous interacting biomolecules. Deciphering the molecular mechanisms behind cellular processes requires the systematic charting of the multitude of interactions between all cellular components. While protein–protein and protein– DNA networks have been the subject of many systematic surveys, others critically important cellular components, such as lipids, have to date rarely been studied in large-scale interaction screens.The importance of protein–lipid interactions is evident from the variety of protein domains that have evolved to bind particular lipids and from the large list of disorders, such as cancer and bipolar disorder, arising from altered protein–lipid interactions. The importance of lipids in biological processes and their under-representation in current biological networks suggest the need for systematic, unbiased biochemical screens. Here, we report a screen to catalog protein–lipid interactions in yeast using a lipid arrays.To illustrate the data set’s biological value, we studied further several novel interactions with sphingolipids, a class of conserved bioactive lipids with an elusive mode of action. Integration of live-cell imaging suggests new cellular targets for these molecules, including several with pleckstrin homology (PH) domains. The dataset presented here represents an excellent resource to enhance the understanding of lipids function in eukaryotic systems.


[I11] The organization of synapse proteomes

Seth GrantWellcome Trust Sanger Institute, Cambridge, Edinburgh University, Edinburgh


Proteomic mass spectrometry has been a groundbreaking technology for studying the composition of complex subcellular organelles. In the nervous system, proteomics has discovered more synaptic proteins than any other method and uncovered a remarkable complexity in the signaling machinery involved in the communication between nerve cells. These data sets have opened up new insights into the evolution of the brain, the organisation and architecture of complex circuits and in the diversity of behavior. The presentation will show how synapse proteomics has introduced molecular complexity into neuroscience and how from this complexity simple organizational features and novel mechanisms have emerged. Synapse proteomics has allowed a unique convergence with human genetics leading to the identification of subsets of proteins that control phenotypes that are involved with many brain diseases. The study of the human synapse proteome has revealed that postsynaptic proteome is disrupted by over 200 mutations involved with over 130 brain diseases.


[I12] Charge Detection Mass Spectrometry

Martin JARROLD Chemistry Department, Indiana University, Bloomington, Indiana 47401, USA


This presentation will provide an overview of recent work pushing the boundaries of sensitivity and accuracy with charge detection mass spectrometry. In conventional mass spectrometry the m/z distribution is obtained for an ensemble of ions, z is then deduced from the m/z distribution of the ensemble, and the ion mass is obtained from the corresponding m/z and z. This approach only works when the charge states are resolved in the m/z distribution, which is usually not the case for large and heterogeneous ions. In charge detection mass spectrometry, m/z and z are directly measured for each individual ion, so that the mass can be determined for each ion. This approach allows true mass spectra to be determined for very large and very heterogeneous ions. The two main challenges with charge detection mass spectrometry are the sensitivity and accuracy of the charge measurements. Efforts to attain an accuracy of a single elementary charge (1e) and a sensitivity of 10e will be described. Applications to ions with masses from kilodaltons to teradaltons will be demonstrated.


[I13] Mass spectrometry in forensic hair testing : example of drug-facilitated crimes

Pascal KINTZ X-Pertise Consulting, 84 route de Saverne, 67205 Oberhausbergen, France


The use of a drug to modify a person’s behaviour for criminal gain is not a recent phenomenon. However, the recent increase in reports of drug-facilitated crimes (sexual assault, robbery) has caused alarm in the general public. Drugs involved can be pharmaceuticals, such as benzodiazepines (flunitrazepam, lorazepam ...), hypnotics (zopiclone, zolpidem), sedatives (scopolamine, neuroleptics, some anti-H1) or anaesthetics (GHB, ketamine), drugs of abuse, such as cannabis, ecstasy or LSD, or more often ethanol.To perform successful toxicological examinations, the analyst must follow some important rules : 1. obtain as soon as possible the corresponding biological specimens (blood, urine and hair), 2. use sophisticated analytical techniques (LC/MS, HS/GC/MS, tandem mass spectrometry); and 3. take care on the interpretation of the findings.Even after the publication of these guidelines for the clinicians, in most cases specimens are collected at best 24 hours after the crime has occurred.Drugs used to facilitate sexual assaults can be difficult to detect (active products at low dosages, chemical instability), possess amnesic properties and can be rapidly cleared from the body (short half-life). Prohibiting immunoassays and using only hyphenated techniques, substances can be found in blood for 6 hours to 2 days and in urine for 12 hours to 5 days. In these situations, blood or even urine can be of poor interest. This is the reason why this laboratory developed an original approach based on hair testing.Hair was suggested as a valuable specimen in situations where, as a result of a delay in reporting the crime, natural processes have eliminated the drug from typical biological specimens. While there is a lot of papers focused on the identification of drugs in hair following chronic drug use, those dealing with a single dose are very scarce.This laboratory recommends to wait for 3-4 weeks after the offense and then collect 4 strands of about 100 hair. One strand will be used to test for drugs of abuse (mostly for cannabis, but also for ecstasy related compounds and cocaine that are sometimes observed), one for GHB and the other one for a screening of 30 various sedatives. The last strand can be used for a potential counter-analysis. After decontamination, hair is then segmented as follows : 0 to 2 cm (segment corresponding to the period of crime), 2 to 4 and 4 to 6 cm (which should be drug-free). For GHB, segments are of 3 mm (n=8).Conventional GC/MS can be used to test for drugs of abuse, but given the expected concentrations to measure in low weight segments (in order to avoid the shave the victim), GHB and sedatives are tested by GC-MS/MS and UPLC-MS/MS, respectively.The experience of the authors will be documented in cases involving GHB, zolpidem, bromazepam, alprazolam, scopolamine, alimemazine, diphenhydramine ...Hair analysis may be a useful adjunct to conventional drug testing in sexual assault. It should not be considered as an alternative to blood and urine analyses, but as a complement. This approach may find useful applications, but appears very expensive, given the number of analyses to achieve with sophisticated equipment.


[I14] Automated high-throughput analysis of quantitative proteomics data

Oliver KOHLBACHER Applied Bioinformatics, Center for Bioinformatics, Department of Computer Science, University of Tübingen, Sand 14, 72076 Tübingen, Germany


Over the last decade HPLC-MS has become the workhorse in proteomics and metabolomics. Increasing sensitivity and resolution of the instruments give us unprecedented coverage of the proteomes and metabolomes under investigation. The flip side of this development is the amount and complexity of data produced. Similar to what we observe in next-generation sequencing, bioinformatics analysis of a high-throughput experiment is rapidly becoming the bottleneck.In this talk, I will illustrate how wet-lab workflows have to be matched by appropriate data analysis workflows in order to enable more complex experiments. Based on our software package OpenMS/TOPP, I will illustrate how analysis workflows can be set up, adapted to specific experimental designs for different quantification strategies. The resulting analyses can then be run automatically. Automated workflows also enable more compute-intensive methods, as computer power scales much better than manual labor done by PhD students and postdocs. I will give a few examples, how these more complex analyses can result in a drastic increase in the coverage and accuracy of the experiment.


[I15] Traveling to the Ends of the Proteome World. Positional N-terminal and C-terminal proteomics deciphers protein terminal and proteolytic post-translational modifications in the HPP

Christopher OVERALL UBC Centre for Blood Research, University of British Columbia, 2350 Health Sciences Mall, Vancouver, B.C. V6T 1Z3 Canada


Protein termini are truncated by proteolysis, but the extent to which this molds the proteome in vivo is unknown. In addition to constitutive proteolysis during protein synthesis and maturation, the processing of a mature protein often irreversibly changes its activity. Specific degradomics techniques are needed to rapidly identify and quantify the N- and C-terminomes in order to reveal the extent of post-translational modifications of protein termini and therefore the functional state of key molecules, the extent of proteolysis in a system, and to identify new protease substrates. We have devised new approaches to enrich for the N and C termini of proteins for high throughput terminome analyses of human tissues and cells for the Human Proteome project, in particular for chromosome 21 that is Canada’s focus for the HPP. Broad coverage N-terminome analysis necessitates a negative selection procedure as the variety of original mature protein N-terminal blocked peptides each present individual chemical hurdles for their enrichment by positive selection strategies.

We developed a combined N-terminomics and C-terminomics and protease substrate discovery degradomics platforms for the simultaneous quantitative analysis of the N-terminome and proteolysis on a proteome-wide scale called Terminal Amino Isotopic Labelling of Substrates (TAILS, Kleifeld et al Nature Biotech 28, 281-288; Prudova et al 2010 Mol Cell Proteomics; auf dem Keller et al 2010 Mol Cell Proteomics) and C-TAILS (Schilling et al Nature Methods 2010). By using novel polymers to deplete the internal tryptic peptides, TAILS suffers little from sample loss and low yields, so requiring only 100 microgram of sample and one MS/MS analysis per sample. By a three-day procedure with flexible labelling options, TAILS can be adapted to a variety of experimental situations including cell culture and complex biological sample analysis. Incorporating iTRAQ labelling iTRAQ-TAILS also provides wide coverage of all forms of naturally blocked N-terminal peptides and allows for their quantification through labelling of lysine side-chains in up to 8 samples. In addition to providing valuable proteome annotation this has several unique advantages. TAILS permits exploitation of the acetylated and other blocked mature protein N-terminal peptides as a statistical classifier that is then used to set isotope ratio cut offs that reveal protease activity.

We introduce a novel parameter evaluating ion intensity dependent quantification confidences of single peptide quantifications. Being a quantitative procedure, TAILS can analyse the substrate degradome of a broad specificity protease or one with no known specificity without manual data parsing, in the same experiment, and also do this in vivo. We have applied TAILS to a variety of proteases and compared protease knock out mice in models of arthritis, skin inflammation and models of breast cancer metastasis and pancreatic carcinoma in the RIP-Tag model. Typical analyses identify over 3000 N-terminal peptides from which we found that the removal of the N-terminal methionine is dependent upon the amino acid at position 2 with distinct preferences found for valine, glycine, alanine and serine. In one experiment, acetylation occurred on 731 original mature protein N-terminal peptides but at the initiator methionine in only 153 of these instances. In 578 cases, acetylation was at position 2 in the protein after removal of 1Met, with alanine, serine and methionine being the preferred acetylated residues. Internal acetylation sites exhibit a distinct acetylation pattern that differs from the N-terminal acetylation. Finally N-terminal positional proteomics enables MS sample simplification with proteins identified in bronchoalvelar fluid and serum having abundances spanning a range greater than six orders of magnitude. This underscores the potential of TAILS to tackle the dynamic range analysis problem in complex proteomes and as a high throughput approach annotate the N and C termini in the HPP.

Link : http://www.clip.ubc.ca


[I16] Targeted proteomics from proteins to proteome maps : potential and bottlenecks

Paola PICOTTI Institute of Biochemistry, Department of Biology, ETH Zuerich, Zuerich. Switzerland


Selected Reaction Monitoring (SRM) is a targeted mass spectrometry technique which emerged in the field of proteomics as a complement to the untargeted shotgun methods. The main advantages of SRM become apparent when predetermined sets of proteins need to be measured across multiple samples in a consistent and accurate manner. The technology is however still in its infancy for protein analysis and several challenges need to be addressed to demonstrate the power of the technique in biological research and increase its widespread application in non-specialized laboratories.To evaluate the applicability of SRM to studying biological networks, we applied it to the analysis of a metabolic network constituted by proteins covering a broad range of abundances and including a large number of families of isoenzymes, sharing high sequence overlap. Proteins in the network were quantified by SRM in yeast cells grown under a series of conditions inducing radically different metabolic setups and in a growth time-course of cells transiting through a series of metabolic phases. The quantitative dataset generated highlighted how yeast metabolism adapts to changing conditions of supply and demand of nutrients and suggested differential functionality for several isoenzymes. The application showed the potential of the technique to elucidate the dynamics of cellular networks through large number of perturbing conditions.In order to expand the capabilities of the technique, we used an approach based on libraries of unpurified synthetic peptides to develop at high-throughput SRM assays for entire proteomes. We used the method to develop SRM assays for the ~6,000 proteins that constitute the proteome of S. cerevisiae and then expanded it to the generation of SRM assays for >90% of the human proteome. The synthetic peptide libraries were also used to generate gold-standard ion trap spectral libraries to be used for spectral matching of shotgun proteomic datasets in discovery-driven experiments. The described SRM assays and spectral libraries are currently being made publicly available via the SRMAtlas user interface, which supports their dissemination across different laboratoreis. The potential of such proteome maps, for targeted and discovery proteomics, as well as their limitations will be discussed.


[I17] Two dimensional FT-ICR, the only way to obtain all the MS/MS correlations from a sample without selecting the parent ions. Instrumental developments and analytical applications

Christian ROLANDO Université Lille 1 Sciences et Technologies, USR CNRS 3290 Miniaturisation pour l'Analyse, la Synthèse & la Protéomique (MSAP), 59655 Villeneuve d'Ascq Cedex, France


The pulse sequence for 2D FT-ICR MS was first developed in 1988 [1] by MS and NMR teams respectively lead by Tino Gäumann and Geoffrey Bodenhausen [1] based on a key experiment demonstrating cyclotron excitation reversibility [2] and conveys detailed information for compounds in complex samples in one easily readable 2D mass spectrum without ion isolation. We revisited 2D FT-ICR MS [3] which, unlike 2D NMR, has no analytical applications yet. Gas-free fragmentation modes allow us to retain high resolution and sensitivity, and the advances in electronics and computer technology since 1988 enable broadband acquisition. The method, however, needs to be optimized in terms of scintillation noise, experiment time and necessary amounts of sample. In this study, we apply techniques adapted from NMR spectroscopy to optimize 2D FT-ICR MS.Because in both dimensions the spectrum is obtained after Fourier transforming a signal that has been sampled at regular time intervals (in the vertical dimension, a delay, and in the horizontal dimension, a measurement date), the resolution of 2D mass spectra behaves in both dimensions like the resolution in one-dimensional FTMS: it increases with the number of data points and is inversely proportional to m/z ratio. In preliminary experiments, time transients were limited to 32k data points since the 32-bit-written software cannot handle files larger than 256 Mb. Using 2048 scans leads to hour-long experiments with a resolution of ~1000 in the MS and fragment ion MS/MS dimension but only a few hundred in the correlation parent ion dimension [3]. For example, we were able to distinguish the fragments of the 79Br and 81Br isotopes and the 12C and 13C isotopes of singly charged ions of bromopride, a small brominated drug (molecular weight 344.25 g.mol-1). The new 64-bit version of the NPK package developed by Marc-André Delsuc [4] and NMRTEC allows us to work on files larger than 16 Gb. An experiment on intact cytochrome C (molecular weight 12 kDalton) using 8192 scans of 512k points time transients shows line base separation for each multicharged ion bearing around 10 charges (ca 10 000 resolution) and quadrupole like (1 m/z unit) separation in the correlation dimension (ca 1000 resolution). Furthermore these experiments show that the resolution in both dimensions remains inversely proportional to m/z ratio, as expected.All of our experiments were performed using nanoESI at concentrations of 1 pmol/µL, leading to sample consumption of less than 20 pmol per hour per experiment, but at the expense of signal intensity fluctuation which translates into scintillation noise in the 2D data. We adapted the NMR version of the Cadzow de-noising algorithm [5] for 2D FT-ICR mass spectra. This algorithm is based on the decomposition of the signal in singular values from which the signal at longer time may be predicted. The Cadzow noise reduction dramatically reduced fluctuations and brought out additional fragmentation peaks that were masked by the noise [6].Results obtained using IRMPD and ECD fragmentation without any in-cell or quadrupole separation for simple compounds like individual peptides, the multicharged ion distribution of small proteins and more complex mixtures like tryptic protein digests will be presented. Finally future development of 2D FT-ICR will be briefly discussed at the sight of multidimensional NMR methodologies developed during the last twenty years.

[1] P. Pfändler et al., J. Am. Chem. Soc. 110 (1988) 5625-5628[2] A.G. Marshall et al., Chem. Phys. Letts. 105 (1984) 233-236[3] M.A. van Agthoven et al., Int. J. Mass Spectrom., doi:10.1016/j.ijms.2010.10.034[4] D. Tramesel et al., J. Magn. Res. 188 (2007) 56-67[5] C. Brissac et al., J. Biomol. NMR 6 (1995) 361-365 [6] M.A. van Agthoven et al., Rapid Commun. Mass Spectrom., 25 (2011) 1609–1616.


[I18] High resolution mass spectrometry at high speed: advances in methods, techniques and applications

Yury TSYBIN Biomolecular Mass Spectrometry Laboratory, Ecole Polytechnique Fédérale de Lausanne, CH-1015, Lausanne, Switzerland


High magnetic field Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS) provides the unbeatable analytical performance in terms of high resolution measurements. However, the high resolution measurements require a long experimental time, e.g., 1-20 seconds per single mass spectrum acquisition, and thus are incompatible with the current and near-future requirements for the high throughput and fast data acquisition, enforced by the short peptide and protein elution time from the chromatographic column. Here, we will discuss some of the possible solutions to this problem from both, hardware and signal processing development. The FT-ICR MS hardware development follows the implementation of ultra-high, e.g., 21 T, magnetic field environments together with higher acquisition speed and harmonized ICR ion traps. The recent progress in Orbitrap FTMS development has significantly reduced the gap between Orbitrap and ICR FTMS in terms of obtained resolving power required for the mainstream MS applications, 60-200k. Finally, the state-of-the-art time-of-flight (TOF) mass analyzers have demonstrated a substantial progress in the recent years and now offer 30-60k resolving powers achieved at comparable times to the high field ICR and Orbitrap FTMS and faster. On the other hand, incredible progress in the computational power and high frequency electronics opens the doors to the advanced signal processing development, which received a particular attention in the recent years. A number of groups, including ours, are in the process of tailoring the super-resolution signal processing methods, e.g., filter diagonalization method (FDM), to the needs of the ICR and Orbitrap MS. The goal is to replace the FT-based signal processing with the methods that would require 10-100 times shorter transient time-domain signals to yield a similar level of the resolving power.


[I19] Statistical methods and tools for protein quantification in MS-based proteomics

Olga VITEK Department of Statistics & Department of Computer Science, Purdue University, West Lafayette, IN 47907


The goal of many proteomic experiments is to quantify and compare the abundances of proteins in complex biological mixtures. This can be accomplished in a variety of mass spectrometry-based workflows, such as label-free or label-based LC-MS workflows, or label-free or label-based SRM workflows. Although the experimental details of these workflows vary greatly, they all output a list of identified and quantified spectral features. There is currently no consensus on how to appropriately handle the repeated quantitative measurements on a protein in a sample, and how to derive protein-level conclusions across all labels, features, samples and conditions.We propose a general statistical modeling framework for protein quantification based on linear mixed-effects models. It is applicable to most experimental designs, LC-MS and SRM experiments, and label-based and label-free SRM workflows. We illustrate the utility of the framework in a series of investigations with fairly complex designs: a 3-way factorial label-free LC-MS, and a label-based SRM time course investigation of central carbon metabolism of S.cerevisiae. We further illustrate the sensitivity and specificity of the framework using controlled spike-in experiments, and using a series of simulated datasets. Finally, we discuss the freely available software that we developed to implement the modeling framework.


Selected short oral communications


[O1] A quantitative phosphoproteomic approach reveals differential phosphorylation of serotonin 2a receptor upon activation by hallucinogenic versus non-hallucinogenic agonists

Franck Vandermoere1, Samah Karaki1, Clotilde Mannoury la Cour2, Carine Becamel1, Joel Bockaert1, Mark J Millan2, Philippe Marin1

1 Institut de Génomique Fonctionnelle, CNRS UMR5203, 141 rue de la Cardonille, 34094 Montpellier, France2 IDR Servier, 125 chemin de Ronde, 78290 Croissy/Seine, Paris, France

Contact: Franck Vandermoere ([email protected])Keywords: Signaling, interactomics and post-translational modifications

The serotonin 5-HT2A receptor is a primary target of psychedelic hallucinogens such as lysergic acid diethylamide (LSD), which reproduce some of the core symptoms of schizophrenia. An incompletely resolved paradox is that only some 5-HT2A receptor agonists exhibit hallucinogenic activity, whereas structurally related agonists with comparable affinity and activity do not. Using quantitative phosphoproteomics combining SILAC, phosphopeptide enrichment by hydrophilic interaction chromatography /immobilized metal affinity chromatography and FT mass spectrometry, we compared the phosphoproteome in cells transiently expressing the 5-HT2A receptor under three conditions: no-stimulation; exposure to the hallucinogen DOI and exposure to the non-hallucinogenic agonist lisuride. Among the 5,996 identified phosphopeptides, 454 sites were differentially phosphorylated upon exposure to DOI vs. lisuride. These include a serine phosphorylated upon exposure to DOI but not to lisuride and located in the i3 loop, a region important for 5HT2A desensitization. Mass spectrometry analysis of immunopurified receptor further confirmed such a differential phosphorylation. Correspondingly, exposure to hallucinogens induced a less pronounced receptor desensitization than exposure to non-hallucinogenic agonists. In conclusion, this phosphoproteomic analysis reveals that 5-HT2A receptor stimulation by hallucinogenic vs. non hallucinogenic agonists induces contrasting phosphorylation patterns that may be related to their distinct behavioural responses. It also provides the first demonstration of differential phosphorylation of a G protein-coupled receptor upon stimulation by «biased» agonists.

Link: http://www.igf.cnrs.fr/spip.php?article89


[O2] The Induction of Serine/Threonine Protein Phosphorylations by Native and Mutant PDGFR/TrkA Chimeras in Stably Transfected PC12 Cells

Jordane Biarc1, Robert Chalkley1, Al Bulingame1, Ralph Bradshaw1

1 Mass spectrometry facility-UCSF, 600th street, 94158-2517 San Francisco, USA

Contact: Jordane Biarc ([email protected])Keywords: Signaling, interactomics and post-translational modifications

The tyrosine kinase receptor (RTK) TrkA, which is activated by NGF (nerve growth factor) binding, plays a major role in differentiation and survival of both peripheral and central nervous system neurons. When PC12 cells, a model paradigm for these functions, are stimulated with NGF, they extend neurites and acquire characteristics similar to sympathetic neurons. After stimulation, TrkA undergoes tyrosine autophosphorylation creating docking sites that link several effectors and adaptors to the activation of downstream signaling pathways, which are characterized by a second, longer lasting, wave of protein phosphorylation targeted to serine/threonine residues. The Y490 and Y785 of the receptor play particularly important roles in these events and stimulate the activation of three main pathways: ERK1/2 via Ras, phosphatidyl inositol - 3- kinase (PI3K) and PLCγ. However, a much broader array of phosphorylations is known to occur in both resting and stimulated cells. The aim of this study is to determine the profile of serine/threonine phosphorylation targets after stimulation of the TrkA receptor for 20’ and to characterize the precise involvement of Y490 and Y785 in these processes.

To avoid the stimulation of the second receptor of NGF (p75) and endogenous TrkA receptors, we used chimeric receptors composed of the ectodomain of the platelet-derived growth factor (PDGF) receptor and the transmembrane and endodomain of the TrkA receptor (denoted PTR), stably transfected into PC12 cells. The cells, grown in a medium containing heavy/light lysine/arginine (SILAC), were stimulated for 20 minutes with PDGF and lysed. The tryptic digest of proteins was enriched for phosphopeptides by a TiO2 column, further fractionated by strong cation exchange chromatography and analyzed by LC-MS/MS. The analysis of the phosphoproteome in cells expressing PTR showed quantitative changes in some previously known entities in signaling pathways, proving the specificity of the method, as well as many new modified entities. Interestingly, a comparison with a data set from HeLa (human) cells stimulated for the same time period by EGF (Olsen et al, 2006), showed a similar profile of protein kinase activation as judged by substrate specificity motifs. Analyses of cells expressing a PTR Y490F mutant and a PTR Y490/785F double mutant, stimulated under the same conditions, revealed three major classes of modifications: those dependent on Y490, those dependent on Y785 and those not dependent on either. This last group could be activated through the phosphorylation of one or more of the five other endodomain tyrosines of TrkA known to be phosphorylated but not previously identified as a docking/effector binding site(s). These activations are presumably not required for neurite proliferation but are likely involved in other functions stimulated by NGF.This work was supported by NIH NCRR grant P41 RR001614.


[O3] Quantifying Protein-Protein Interactions Within Noncovalent Complexes Using Electrospray Ionization Mass Spectrometry

Elisabetta Boeri Erba1, Konstantin Barylyuk1, Yang Yang1, Renato Zenobi1

1 Department of Chemistry and Applied Biosciences, ETH Zurich, Wolfgang-Pauli-Str. 10, 8093 Zurich, Switzerland

Contact: Elisabetta Boeri Erba ([email protected])Keywords: Proteins, peptides and small molecules quantification

Several electrospray-mass spectrometry (ESI-MS)-based methods are available for determining the equilibrium association constant (Ka) between a protein and a small ligand, but current MS-based strategies are inadequate for measuring Ka of protein-protein interactions with accuracy. We expanded the application of ESI-MS-based titration to determine the strength of noncovalent interactions between proteins, forming a complex. Taking into account relative response factors (probability of being ionised, transmitted and detected), we determined Ka values of an equilibrium between dimers and tetramers at three different pH values (6.8, 3.4 and 8.4). We investigated the association of the lectin concanavalin A, whose dimer-tetramer equilibrium is affected by in-solution concentration and by pH. To calculate the constants of association (Kd) in solution, we also utilised isothermal titration calorimetry (ITC) for a comparison with MS-based titration method. At pH= 6.8 and pH= 8.4 the Ka values measured by MS and by ITC were in agreement. At pH= 3.4 we were able to measure the Ka only by MS, but not by ITC due to limited sensitivity of calorimetry.Our investigation illustrates the great potential MS for calculating the binding strength of protein-protein interactions within noncovalent complexes. The main advantages of MS over ITC are its sensitivity (i.e. the required amount of sample is >100 times less than the one necessary for ITC) and the possibility to obtain precise information on composition of protein complexes, their stoichiometry, their subunit interactions and their assembly pathway. Moreover, our study shows the strong influence of response factors on determining accurate protein-protein association constants.


[O4] Structure Determination of Complex Plant Glycosphingolipids by Tandem Mass Spectrometry

Corinne Buré1, Jean-Luc Cacas2, Fen Wang2, Karen Gaudin3, Frédéric Domergue2, Sébastien Mongrand2, Jean-Marie Schmitter 1

1 CBMN UMR5248 - CGF, 146, rue Léo Saignat, 33076 Bordeaux2 LBM UMR5200, 146, rue Léo Saignat, 33076 Bordeaux3 EA 4575 Université Bordeaux Segalen, 146, rue Léo Saignat, 33076 Bordeaux

Contact: Corinne Buré ([email protected])Keywords: Systems biology

Glycosyl-Inositol-Phospho-Ceramides (GIPC) are the main sphingolipids of plant tissues, but the function of this complex family of compounds remains largely unknown. Therefore, the structural characterization of GIPC represents a critical step toward the understanding of their physiological function. In this work, GIPCs have been purified from plants cells (A. thaliana and N. tabacum cv. Bright Yellow 2, i.e. BY2), yielding multiple molecular species that have been analyzed by tandem mass spectrometry, using a combination of MALDI- and ESI-MS/MS. This method should open new avenues to decipher structure–function relationships between glycosphingolipids and membrane organisation. GIPC extracts were analyzed by MALDI–MS/MS in negative ion mode, using 2,6-dihydroxy-acetophenone (DHA) as a matrix (MALDI Q-ToF Premier, Waters). ESI-MS/MS analyses were performed with a 5500 QTRAP (AB Sciex) instrument. Analyses performed by MALDI mass spectrometry provide a quick overview of the variety of GIPC structures found in a given type of plant cell. A comparison between several organisms is straightforward, using MS/MS to confirm the identifications. The ceramide part of identified GIPCs merely contains tri-hydroxylated long chain bases (t18:0 and t18:1) to which alpha-hydroxylated very long chain fatty acids are amidified, whereas the polar head part displays more diverse structures. MALDI mass spectra of A.thaliana and BY-2 cell samples revealed the occurrence of several clusters of GIPCs that can be grouped in six series (A to F) which differ by their mass range. For A.thaliana and BY-2 cells, each series was composed by several GIPC species differing by 2, 14 and 16 Da, corresponding to different degrees of unsaturation, carbon number or hydroxylation of the fatty acid chain. Fatty acid chains spent from 20:0 to 27:0, and from h20 to h26 for hydroxylated species. Mass differences between series were accounted by the number of saccharide units, and were either 162 Da (hexose) or 132 Da (pentose). Thus, MALDI-MS revealed that these plant GIPC structures had an increasing number of saccharide units, from two (series A) to seven (series F). The major compounds belong to series A for both A.thaliana and BY-2 cells. This result is in agreement with the previous report of hexose(R1)-hexuronic acid-inositol-phosphoceramide as major species in A. thaliana and N. tabacum leaves [1], where R1 is a hydroxyl group and an amine or an acetylamine, respectively. Further ESI-MS/MS experiments were conducted to confirm the structure identifications. Fragmentations observed in MALDI-MS/MS (singly charged ions) and ESI-MS/MS (doubly charged ions) were complementary for in-depth structure characterization of individual GIPCs among A-F series. Finally, up to 51 and 121 molecular species could be detected in A. thaliana and tobacco BY-2 cells, respectively.[1] J.E. Markham et al. J. Biol. Chem. 2006, 281, 22684.


[O5] Compatibilité entre histologie et imagerie par spectrométrie de masse ToF-SIMS : détection et cartographie de lipides au sein de tissus biologiques

Claudia BICH1, Sara VIANELLO2, Vincent GUERINEAU1, David TOUBOUL1, Sabine DE LA PORTE2, Alain BRUNELLE1

1 Centre de Recherche de Gif, Institut de Chimie des Substances Naturelles, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette Cedex, France2 Centre de Recherche de Gif, Institut de Neurobiologie Alfred Fessard, Laboratoire de Neurobiologie du Développement, Avenue de la Terrasse, 91198 Gif-sur-Yvette Cedex, France

Contact: Claudia BICH ([email protected])Keywords: Imaging mass spectrometry

L’histologie permet de différencier simplement et rapidement sur un tissu biologique différentes structures (noyau, membrane) grâce à l’utilisation de colorants spécifiques. Par exemple, le Rouge Nil permet de colorer les lipides neutres. Néanmoins aucune information moléculaire détaillée n’est obtenue par cette technique. L’imagerie par spectrométrie de masse (ISM), de par la possibilité d’obtenir simultanément un grand nombre d’images, semble être une technique complémentaire à l’histologie. Jusqu’à maintenant, il était nécessaire d’utiliser des coupes adjacentes pour l’histologie et l’ISM afin d’établir des parallèles dans les résultats et d’en tirer des conclusions pertinentes. Pourtant, il est parfois difficile d’obtenir des coupes adjacentes adaptées pour les analyses. La possibilité de réaliser l’histologie et l’imagerie par SM sur la même coupe de tissu biologique a été l’objet de cette étude. L’imagerie par spectrométrie de masse d’ions secondaires couplée à un analyseur à temps de vol (ToF-SIMS), qui ne nécessite aucun prétraitement de l’échantillon et qui n’est pas destructive, s’est révélée très adaptée pour cette étude. Des techniques de coloration de routine, telles que l’Hématoxyline-Eosine (HE) ou le Rouge Nil (NR) ont été appliquées sur des coupes de tissus biologiques avant ou après localisation de lipides par ToF-SIMS. Les coupes de 16 µm d’épaisseur ont été réalisées à l’aide d’un cryostat CM3050-S à -20°C, déposées sur des lames en verre puis séchées brièvement sous vide. Certaines de ces lames ont été analysées par ToF-SIMS puis colorées et analysées de nouveau par ToF-SIMS, d’autres ont été directement colorées puis analysées. Les images ioniques 500 µm x 500 µm (2 µm de résolution spatiale) ont été acquises avec un spectromètre de masse ToF-SIMS IV en modes d’ionisation positif et négatif. • Dans le cas des coupes colorées puis analysées par ToF-SIMS, une délocalisation de certains ions tels que le cholestérol (m/z 369 ion fragment caractéristique en mode d’ionisation positif et m/z 385 en mode d’ionisation négatif) a été observée après coloration par HE et NR. Sur les coupes de cerveau de rat, les images ont montré que le cholestérol était toujours majoritaire au sein du corps calleux mais semble être anti-co-localisé après coloration. Au contraire, les images de ces mêmes ions après les lavages au tampon phosphate (une des étapes) ne montrent aucune délocalisation, et restent similaires aux images contrôles. • De plus, les résultats préliminaires ont montré que l’analyse par ToF-SIMS n’empêche pas la coloration des coupes par la suite. • Enfin, il a été possible de refaire une analyse de la surface par ToF-SIMS sur ces mêmes coupes pour évaluer la délocalisation et le rendement d’émission ionique secondaire. En conclusion, il est possible d’obtenir les informations histologiques de coupes préalablement étudiées par spectrométrie de masse ToF-SIMS.


[O6] ETD à pression atmosphérique

David Touboul1, Alexandre Giuliani2, Julie Allegrand1, Olivier Laprévote4, Alain Brunelle1

1 Centre de Recherche de Gif, Institut de Chimie des Substances Naturelles, Avenue de la Terrasse, 91198 Gif-sur-Yvette2 Ligne DISCO, Synchrotron Soleil, L'Orme des Merisiers, 91192 Gif-sur-Yvette3 Cepia, Institut National de Recherche Agronomique, BP 71627 , 44316 Nantes4 Chimie Toxicologie Analytique et Cellulaire, EA4463, Université Paris Descartes, 75006 Paris

Contact: David Touboul ([email protected])Keywords: Instrumentation, Organic and inorganic mass spectrometry, Signaling, interactomics and post-translational modifications

Il est fondamental pour des études protéomiques de posséder des outils efficaces de fragmentation des peptides, afin d’accéder à leur séquence et à leurs éventuelles modifications post-traductionnelles (MPT). De nombreuses techniques cohabitent actuellement. La dissociation induite par collision couplée à une source electrospray permet d’obtenir de bons rendements de fragmentation mais n’autorise pas le positionnement de certaines MPTs. À l’inverse, le transfert électronique dissociatif (ETD) permet l’analyse de MPTs labiles mais les rendements de fragmentations sont très faibles. Le but de ce travail est de développer de nouveaux outils pour la fragmentation efficace de peptides modifiés ou non. Le principe général du transfert électronique dissociatif à pression atmosphérique est basé sur l’utilisation de la photoionisation à pression atmosphérique (APPI). Le peptide en solution est tout d’abord transféré en phase gazeuse grâce à une source de type thermospray puis irradié par un faisceau intense de photons UV issu du synchrotron SOLEIL. Le rayonnement UV peut ioniser le solvant si l’énergie des photons est suffisante. L’avantage de ce couplage unique au monde est la possibilité de varier l’énergie des photons entre 5 et 20 eV, alors que les photons émis classiquement par une lampe à krypton ont des énergies fixes à 10,0 et 10,6 eV. Deux types d’expériences ont été menés : l’une consiste à faire varier la composition des solvants photoionisables, l’autre à additionner une molécule facilement photoionisable, appelée dopant.La première série d’expérience a permis de démontrer grâce à des balayage en énergie que pour des photons d’énergie supérieure au potentiel d’ionisation de l’éthanol, de l’isopropanol ou du butanol, un transfert d’électrons entre les molécules de solvant vers les ions multichargés de la substance P est observé conduisant à la formation en source d’ions fragments de type c, b et y, et à la disparition totale des ions multichargés. Cette réaction peut être comparée à celle obtenue par ETD mais avec un rendement bien plus important. Dans le cas du méthanol, cette réaction est par contre peu efficace et seul un transfert de proton entre le solvant et la substance P est observé.La seconde série d’expériences a permis de démontrer que des fragments intenses de type c, b et y sont aussi obtenus lorsque les photons possèdent une énergie supérieure au seuil d’ionisation du dopant. L’analyse d’un peptide myristoylé a permis de confirmer ces phénomènes et la MPT a bien été localisée en N-ter grâce à une série presque complète d’ions de type c. Finalement l’analyse d’un peptide phosphorylé a conduit à la formation préférentielle d’une série complète d’ions de type b-H3PO4. . La suite de ce travail consistera à développer un système de nébulisation peu chauffé afin de minimiser les fragmentations thermiques successives tout en contrôlant les processus ETD à pression atmosphérique.


[O7] Photo-SRM: laser photo-dissociation improves detection selectivity of selected reaction monitoring mode

Quentin ENJALBERT1, Romain SIMON2, Arnaud SALVADOR2, Rodolphe ANTOINE1, Sebastien REDON3, Florence DARBOUR5, Stephane CHAMBERT3, Yann BRETONNIERE5, Philippe DUGOURD1, Jérôme LEMOINE2

1 LASIM, Université Lyon 1, CNRS, Domaine Scientifique de la Doua Université Claude Bernard Lyon 1 Bâtiment Alfred Kastler, 69622 Villeurbanne2 LSA, Université Lyon 1, CNRS, Domaine Scientifique de la Doua Université Claude Bernard Lyon 1 Bâtiment CPE, 69622 Villeurbanne3 INSA-Lyon, Laboratoire de Chimie Organique et Bioorganique, d INSA-Lyon, Laboratoire de Chimie Organique et Bioorganique, bât. J. Verne, 20 Avenue A. Einstein, 69622 Villeurbanne4 CBMS, Institut de Chimie et de Biochimie Moléculaires et Supramoléculaires, UMR5246 ; CNRS ; Université Lyon 1 ; INSA ; CPE-Lyon, Bât. Curien, 43 Bd, 69622 Villeurbanne5 Laboratoire de Chimie de l’ENS Lyon, , 46 allée d’Italie, 69364 Lyon

Contact: Quentin ENJALBERT ([email protected])Keywords: Proteins, peptides and small molecules quantification , Instrumentation

Selected Reaction Monitoring (SRM) carried out on triple quadrupole mass spectrometers coupled to liquid chromatography has been a reference method to develop quantitative analysis of small molecules in biological or environmental matrices for years and is currently emerging as a promising tool in clinical proteomics. However, sensitive assays in complex matrices are often hampered by the presence of co-eluted compounds that share redundant transitions with the target species. In the present work we document for the first time the potential interest of substituting classical gas-collision activation mode by laser photo-dissociation to track chromophore-derivatized target peptide absorbing at 532 nm diluted in a whole plasma trypsin hydrolysate. We anticipate that this technique coined photo-SRM, combined with chromophores endowed with reactivity towards generic chemical groups, might significantly improve the limit of quantification of classical SRM-based assays.The present presentation focused on the development of a new technique dedicated to quantification, called photo-SRM, where non-discriminating collision-activated dissociation mode has been replaced by a more specific photo-dissociation process governed by the absorbing properties of a targeted compound. The first example photo-SRM experiments has been developed in-house on a conventional triple quadrupole mass spectrometer. Proof of principle of SRM-based monitoring by laser-induced dissociation instead of classical collision activated mode was carried out with the chromophore-derivatized-Oxytocin as a model molecule diluted in whole plasma trypsin hydrolysate. This preliminary investigation clearly demonstrates that both the selectivity and detection level may markedly be improved during SRM monitoring by replacing the classical mode of activation by gas collision by a photon excitation providing a judicious overlap between the absorbing properties of the target molecule and the excitation wavelength of the laser beam. The lack of cross contamination within the transition channel between the target molecule and co-eluted endogenous interferences results here in a 50-fold improvement of the limit of quantification. The question rises now about how photo-SRM might be further optimized and extended to molecules that do not exhibit natural or specific light absorption.Novel aspect:First demonstration of Photo-SRM tool for analytical quantification.


[O8] Reflectron Positive ion Mode Matrix-Assisted Laser Desorption/Ionization Mass Spectrometric Analysis of Sulfo-peptides

Sonia CANTEL1, Luc Brunel1, Keiichiro Ohara1, Christine Enjalbal1, Jean Martinez1, Jean-Jacques Vasseur1, Michael Smietana1

1 Institut des Biomolécules Max Mousseron (IBMM) UMR 5247 CNRS-Université Montpellier 1 et Université Montpellier 2, Université Montpellier 2, Place Eugène Bataillon, 34095 Montpellier

Contact: Sonia CANTEL ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Protein identification and characterization, has become one of the central activities in proteomics. The biological activity of many proteins is regulated by the extent and positions of posttranslational modifications (PTMs). More than 200 different PTMs have been described but only a minor fraction of those has been studied in detail. Indeed, most of these PTMs are lacking appropriate analytical methods that allow the sensitive, residue-resolved detection and localization of the modifications. It appears that sulfation of tyrosine is a PTM occuring almost exclusively on secreted and trans-membrane spanning proteins. Evidence suggests up to 1% of all tyrosine residues of the total protein content in an organism can be sulfated. Mass spectrometry has been developed as a key technology for protein modification analysis and many studies on sulfopeptides are MALDI-based. It has been reported that the sulfo-moiety from sulfopeptides is readily and quantitatively lost in positive ion mode. Alternatively, MALDI ion negative mode has proven to be useful for analysis of sulfopeptides as the lability of deprotonated anionic sulfomoieties is lower than protonated neutral ones.Here we describe a peptide/small molecule non covalent interaction system allowing detection of mono- and polysulfated peptides in reflectron/linear positive mode by matrix-assisted desorption/ionization time-of-flight mass spectrometry (MALDI-TOFMS). We will highlight strengths and limitations of this strategy and phospho-peptides detection approach will be discussed.


[O9] Développement d’une méthode de métabolomique associant la RMN et l’UHPLC-HRMS

Emilien JAMIN1, Cécile CANLET1, Maria-Héléna MEIRELES1, Marc DUBOIS1, Marie TREMBLAY-FRANCO1, Nicolas CABATON1, Fabien JOURDAN1, Daniel ZALKO1, Laurent DEBRAUWER1

1 INRA, UMR1331 TOXALIM, plateforme MetaToul, 180 Chemin de Tournefeuille, F31027 Toulouse

Contact: Emilien JAMIN ([email protected])Keywords: Systems biology, Separative analysis methods, Organic and inorganic mass spectrometry

La RMN et la spectrométrie de masse sont deux outils complémentaires en métabolomique. Alors que la RMN est désormais largement reconnue dans le domaine de la métabolomique de par sa robustesse, la spectrométrie de masse est quant à elle en pleine expansion, en particulier depuis l’arrivée des colonnes chromatographiques de granulométrie faible et l’arrivée de la spectrométrie de masse à très haute résolution de type Orbitrap. Dans ce travail, nous nous sommes intéressés à développer une méthode associant en parallèle la RMN et le couplage UHPLC-HRMS, qui a été appliquée à une étude des effets du bisphénol A à faibles doses au niveau cellulaire (cellules HepaRG). Nous nous sommes particulièrement intéressés à l’optimisation des paramètres de retraitement des données de spectrométrie de masse par le pack XCMS.Des cellules HepaRG en culture ont été exposées ou non à des faibles doses de bisphénol A (DMSO versus BPA 10e-6, 10e-9 et 10e-12mol/L). Les extraits cellulaires ont ensuite été analysés tout d’abord par RMN du proton (600MHz, Bruker) puis par couplage UHPLC-FTMS, constitué d’un système RSLC3000 (Dionex), d’un gradient de phase mobiles composées de H2O/méthanol/acide acétique 95/5/0,1 et méthanol/acide acétique 100/0,1 éluées à 0,3 mL/min, et d’une colonne chromatographique Hypersil Gold (100x2,1 mm, 1,9 µm) (Thermo Scientific) à 30°C. La détection a été réalisée avec un spectromètre de masse LTQ-Orbitrap XL (Thermo Scientific) en mode FTMS avec une source d’ionisation Electrospray fonctionnant en mode positif ou négatif.Tout comme les autres logiciels de traitement de données LC-MS de métabolomique, le pack XCMS utilise deux grandes fonctions : la détection/intégration de pics chromatographiques au sein des signaux bruits, et le regroupement/alignement des variables (couple m/z et tR) entre les échantillons. Ces deux fonctions sont basées sur différents algorithmes présents dans le pack XCMS, mais qui nécessitent le réglage de paramètres à la fois nombreux et peu explicites. Une interface développée au laboratoire (MetMS) rend le paramétrage de XCMS plus aisé depuis l’importation des fichiers, jusqu’à la création de la liste des pics détectés, par l’utilisation de fenêtres de commande. De plus, cette interface permet de visualiser les spectres de masse et les chromatogrammes à chaque étape du traitement XCMS. Ainsi, nous avons optimisé chaque paramètre XCMS à nos conditions d’analyses, par l’étude de la définition de ces paramètres et leur influence sur la détection de pics.Les données ainsi générées par RMN et UHPLC-HRMS ont été traitées par des méthodes statistiques multivariées. La régression PLS-DA a permis une bonne séparation des différents groupes. L’ensemble du processus mis en place depuis le traitement des échantillons jusqu’au traitement des données produites sera présenté en s’appuyant sur l’application traitée.


[O10] Prises d’empreintes urinaires par LC-HRMS : La métabolomique, une stratégie innovante pour le dépistage de l’utilisation d’anabolisants en élevage.

Sylvain Chéreau1, Frédérique Courant1, Fabrice Monteau1, Jean-Philippe Antignac1, Gaud Dervilly-Pinel1, Bruno Le Bizec1

1 LABERCA, ONIRIS, Route de Gachet site de la chantrerie, 44307 Nantes, France

Contact: Sylvain Chéreau ([email protected])Keywords: High mass and high resolution mass Spectrometry, Separative analysis methods, Bioinformatics et biostatistics dedicated to proteomics

Les caractères « globaux » et « non ciblés » d’une étude métabolomique en font une approche de choix dans de nombreux domaines. Appliquée à la sécurité chimique des aliments, la métabolomique laisse entrevoir de nombreuses perspectives comme, par exemple, l’ambition de découvrir de nouveaux biomarqueurs révélateurs d’une contamination de la (des) denrée(s). Dans ce contexte, et en raison de l’universalité de la détection et des niveaux de sensibilité atteints, la spectrométrie de masse s’est naturellement imposée comme l’une des technologies de choix pour la prise d’empreintes métabolomiques.Dans le cadre de ses recherches appliquées à la détection des pratiques frauduleuses en élevage, le LABERCA a développé depuis plus de 5 ans une stratégie complète de prise d’empreinte métabolomique (LC(C18)-ESI-Orbitrap(HRMS) // XCMS // SIMCA P+) afin de révéler de potentiels candidats biomarqueurs d’un traitement anabolisant. Appliquée à différentes familles de composés (Hormone de croissance, stéroïdes, β-agonistes), l’approche à dores et déjà fait ses preuves [1-8] puisque de robustes modèles statistiques permettant de discriminer des groupes d’animaux (i.e : contrôles & traités) ont été établis et l’identification structurale, étape critique et délicate, a pu être réalisée pour certains candidats biomarqueurs. L’objectif est à présent de développer un outil de dépistage basé sur le suivi ciblé des biomarqueurs identifiés, par le développement de méthodes quantitatives par spectrométrie de masse (UPLC-MS/MS). Il s’agit en particulier de travailler à l’optimisation de la détection de ces composés, par l’évaluation de techniques chromatographies alternatives (HILIC) ou encore à l’aide d’une quantification plus fine (dilution isotopique). Enfin un modèle combinant les concentrations de chacun des candidats biomarqueurs permettra de valider l’approche et la pertinence de leur suivi pour mettre en évidence une suspicion de pratique anabolisante en élevage.[1] Courant F., Pinel G. et al., Analyst, 2009, 134:1637-1646.[2] Kieken F., Pinel G. et al., Anal Bioanal Chem, 2009, 394:2119-2128.[3] Anizan S., Bichon E. et al., J Chrom A, 2010, 1217:6652-6660.[4] Pinel G., Mooney M. et al., TrAC, 2010, 29:1269-1280.[5] Kieken F., Pinel G. et al., Metabolomics, 2011, 7:84-93.[6] Antignac J.P., Courant F. et al., TrAC, 2011, 30:292-301.[7] Pinel G., Weigel S. et al., Anal. Chim. Acta, 2011, in press.[8] Anizan S., Di Nardo D. et al., Anal. Chim. Acta, 2011, in press.

Link: http://www.laberca.org


[O11] Mechanisms leading to unusual ECD fragments: the ion spectroscopy perspective.

Edith NICOL1, Julia CHAMOT-ROOKE1, Guillaume VAN DER REST1

1 Laboratoire des Mecanismes Reactionnels, Ecole Polytechnique, CNRS, Route de Saclay, 91128 Palaiseau, France

Contact: Edith NICOL ([email protected])Keywords: Organic and inorganic mass spectrometry

As introduced by Roman Zubarev et al. in 1998, ECD has been described as leading mostly to c and z fragment types [1]. The observation of other fragment types (a, b, y, w) has also been described in the literature, but often as either secondary fragmentation of the major c/z ions, or as secondary or minor processes. Recent experimental work in our group on a pentapeptide series (AGXLK - X=A, D, E, S, W) of ions, as well as analysis of a database of 11 000 ECD spectra from doubly charged tryptic peptides [2] revealed that these pathways can represent the major ones for small (less than 9 residues) size peptides. Therefore, far from being an epiphenomenon, observed only for some very specific peptides, these fragmentation pathways can truly be observed in the ECD fragmentation of peptides present in bottom-up proteomics studies.The database analysis not only revealed the extent of these atypical fragmentation behaviors, but also led to question assumptions on the fragmentation pathways leading to these ions. For instance, the w fragmentation pathway has usually [3] been ascribed to a secondary fragmentation of z ions, through a side-chain loss. Our database analysis shows that the w ions do not arise from the major z ions, therefore leading to the question of the mechanism accounting for their formation. No alternative mechanism is present in the literature to this date. A similar question arose for b ions formed by ECD, for which at least three pathways are proposed in the literature.The structure of these fragments could provide hints on the mechanistic pathways followed to reach these products. In light of the questions raised above, infra-red action spectra of some w and b ECD fragments were recorded at the CLIO facility in Orsay. Briefly, ions of interest are produced from ECD fragmentation of selected precursors in the cell of an FT-ICR mass spectrometer and irradiated by a tunable infra-red free-electron laser beam. IRMPD fragmentation efficiency is recorded as a function of wavelength. Theoretical reference spectra for series of possible structures were produced through DFT geometry optimizations and frequency calculations and compared with the experimental spectra. For b ions, the IR action spectra of the corresponding CID fragments were also recorded and used for comparison.This work led us to obtain the first IR spectra of w type ions, which seem to have the expected linear ketene structure. For b ions, some ions display a different experimental spectrum for the ECD fragments compared to the CID fragments, which would point out to a different formation mechanism.

[1] Zubarev, R. A.; Kelleher, N. L.; McLafferty, F. W., J Am Chem Soc 1998, 120, 3265.[2] Van der Rest, G.; Hui, R.; Frison, G.; Chamot-Rooke, J., J. Am. Soc. Mass Spectrom. 2011, in press.[3]Savitski, M. M.; Nielsen, M. L.; Zubarev, R. A., Anal. Chem. 2007, 79, 2296.


[O12] Investigating the unusual behavior of Metolachlor under chemical ionization in hybrid ion trap mass spectrometry

Stéphane Bouchonnet1, Pierre-Henry Goulden1, Christophe Genty1, Sophie Bourcier1, Michel Sablier1

1 Laboratoire des Mécanismes Réactionnels, Ecole Polytechnique, 91128 Palaiseau

Contact: Stéphane Bouchonnet ([email protected])Keywords: Organic and inorganic mass spectrometry, Instrumentation, Proteins, peptides and small molecules quantification

Acetochlor, Alachlor and Metolachlor are widely used herbicides frequently detected in river waters. Known as potential endocrine disruptors, their toxicity for human has been clearly established. The characterization of their ozonation and photolysis by-products has been the subjects of recent investigation since some of them could also been responsible for endocrine disruption. The structural elucidation of by-products is usually performed using LC-MS/MS and GC-MSn analysis for polar and little or not polar compounds, respectively. In GC-MS, the use of chemical ionization (CI) is expected to provide abundant MH+ ions allowing direct access to the molecular weight of the analyte while electron ionization (EI) provide abundant fragment ions but only trace amounts of M+. ions for the herbicides of interest. We have been recently puzzled by the strange behavior of Metolachlor which, unlike the other mentioned pesticides, provides a very abundant monochlorinated ion at m/z 295/297 under ammonia positive chemical ionization using an hybrid ion trap mass spectrometer in GC-MS coupling. This ion observed only at trace amounts when using methanol as reagent gas. It disappears when attempting to isolate it to perform MSn experiments. Curiously, this ion at m/z = M+12 is not observed for the herbicides Acetochlor and Alachlor which present very similar chemical structures. The chemical structures of the m/z 295 and m/z 297 ions and the explanation of the observed phenomenon were elucidated on the basis of experiments including isotopic labeling and modifications of the operating conditions of the ion trap mass spectrometer. This work allows to give new recommendations for an optimized use of hybrid source ion trap mass spectrometers.


[O13] Characterization of cellular proteasome complexes diversity by proteomic approaches

Bertrand Fabre1, Bernard Monsarrat1, Marie-Pierre Bousquet-Dubouch1, Odile Burlet-Schiltz1

1 Institut de Pharmacologie et Biologie Structurale, IPBS, CNRS, 205 route de Narbonne, 31077 Toulouse, France2 Université de Toulouse, 118 route de Narbonne, 31077 Toulouse

Contact: Bertrand Fabre ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Proteins, peptides and small molecules quantification

Proteasome is a multimeric protease complex, which degrades more than 80% of proteins in the cell. Due to its substrate wide range, proteasome is involved in the regulation of many important cellular processes (cell division, transcription, cell differentiation…). Proteasomes complexes consist of a 20S catalytic core particle comprising 14 to 17 different proteins assembled in four stacked ring-shape heptamers. This core complex can be associated to one or two regulatory particles of identical or different protein composition and can also recruit other so-called Proteasome Interacting Proteins (PIPs). Proteasome activity is tightly regulated by the nature of these associated proteins. Proteasome complexes are present in the cytoplasm (free, associated with cytoskeletal elements or bound to the endoplasmic reticulum) and in the nucleus but little is known about the distribution of the different associated regulators in each cell compartment. To answer this question, we have developed an affinity purification-quantitative mass spectrometry strategy using a 20S proteasome core particle subunit as bait. This allows the enrichment of all combinations of 20S-regulator endogenous proteasome complexes in the cell.To stabilize the labile association between the 20S core particle with its regulators and PIPs, we have performed in vivo cross-linking of protein-protein interactions using formaldehyde [1]. Formaldehyde was introduced very early in the proteomic workflow, so that real biological events could be frozen. Optimization of formaldehyde concentration was performed to maximize the specific activity of purified proteasomes, the yield of purification and the recovery of regulators and PIPs. The fractionation protocol was also optimized to deal with the cross-linked cells and to obtain proteasome complexes specific of the cytoplasm, the microsome and the nucleus compartments. A label-free quantitative proteomic workflow [2] was then performed to compare proteasome complexes diversity in each cellular compartment and in different leukemia cell lines exhibiting differences in proteasome activity. Determining the composition in regulators of the proteasome, according to the cellular localization, will allow a better understanding of their functions.

1 Bousquet-Dubouch MP, Baudelet E, Guerin F, et al. Affinity purification strategy to capture human endogenous proteasome complexes diversity and to identify proteasome-interacting proteins. Mol Cell Proteomics 8, 1150-1164 (2009).2 Mouton-Barbosa E, Roux-Dalvai F, Bouyssie D, et al. In-depth exploration of cerebrospinal fluid by combining peptide ligand library treatment and label-free protein quantification. Mol Cell Proteomics 9, 1006-1021 (2010).


[O14] Optical profiling of an Agilent Jet Stream Technology electrospray by Laser-Induced-Fluorescence coupled to mass spectrometry measurements

Marion Girod1, Xavier Dagany1, Rodolphe Antoine1, Philippe Dugourd1

1 Laboratoire de Spectrométrie Ionique et Moléculaire; C.N.R.S. et Université Lyon I, Bat. A. Kastler, 43 bd du 11 Novembre 1918, 69622 Villeurbanne Cedex - FRANCE

Contact: Marion Girod ([email protected])Keywords: Organic and inorganic mass spectrometry, Instrumentation

La spectrométrie de masse après ionisation electrospray (ESI) est devenue une des techniques analytiques les plus utilisées et consiste à former des ions intacts en phase gazeuse par électronébulisation d’un analyte en solution. Cependant, les mécanismes mis en jeu lors de cette ionisation sont relativement peu connus, en particulier ceux du processus de désolvatation au sein de la plume entre l'émetteur electrospray et le capillaire d’entrée du spectromètre de masse. Des mesures spectroscopiques peuvent aider à étudier les propriétés chimiques et physiques des gouttelettes de la plume electrospray ainsi que les propriétés des ions au sein de ces gouttelettes.Un montage expérimental permettant de réaliser des mesures de fluorescence au sein de la plume electrospray a été développé, tandis que des spectres de masse d’analytes sont enregistrés simultanément. Des images 2D de la plume electrospray ont été obtenues en mesurant la concentration (c.-à-d. le signal de fluorescence) d'une solution de colorant rhodamine 6G (Rh6G) avec une résolution spatiale d’environ 200µm. Afin de sonder les propriétés physiques et chimiques des gouttelettes au sein de la plume ESI, des colorants chromiques ont été utilisés. L'intensité de fluorescence ou la longueur d'onde de différents colorants chromiques est corrélée avec les propriétés chimiques et physiques, en utilisant les courbes d'étalonnage établies. Les spectres d'émission du Nile Red (NR) dans un mélange d'acétonitrile/eau ont été enregistrés afin de déterminer la composition de solvant dans la plume pour différents paramètres de spray. Les résultats indiquent clairement que la composition du solvant dans les gouttelettes n'est pas homogène dans la plume ESI, en raison de l'évaporation des solvants. La fluorescence induite par laser a également été employée pour profiler des changements de pH lors de l’évaporation des gouttelettes dans la plume ESI en mesurant des spectres d'émission du colorant pHchromic C.SNARF-1. Ce couplage de mesures de spectrométrie de masse et de spectroscopie optique permet d'étudier la relation entre l'état de charge observé d'anions de peptide et les changements de pH au sein du spray en fonction des paramètres de source tels que le débit et la température du gaz de gainage qui jouent sur le rendement d’évaporation de gouttelettes.


[O15] Tabagisme actif/tabagisme passif, une étude différentielle de la fraction particulaire

Sébastien Schramm1, Vincent Carré1, Jean-Luc Scheffler2, Frédéric Aubriet1

1 Laboratoire de spectrométrie de masse et de chimie laser, 1 boulevard Arago, 57078 Metz, France2 Laboratoire Ascal, Parc d'activité Forbach Ouest, 57600 Forbach

Contact: Sébastien Schramm ([email protected])Keywords: High mass and high resolution mass Spectrometry, Organic and inorganic mass spectrometry

La fumée de cigarette est un contaminant majeur de l’air intérieur (indoor). De nombreux constituants de ces fumées, essentiellement gazeux, ont été identifiés. Certains présentent des propriétés toxiques, carcinogènes et/ou mutagènes. Outre ces espèces gazeuses, les fumées de cigarette contiennent une fraction particulaire importante. Les agences sanitaires et de santé sont actuellement préoccupées par l’examen de ces particules. Celles-ci possèdent non seulement des temps de séjour élevés dans l’organisme mais aussi une composition complexe et variée et sont le siège de l’adsorption d’un grand nombre de molécules issues de la combustion de la cigarette. A la différence de la pollution outdoor pour laquelle des normes existent en termes de contaminants particulaires (PM10 voire PM2.5), en atmosphère confinée aucune législation n’est encore proposée. Dans l’objectif d’accéder à la composition détaillée des particules de fumées de cigarettes, nous nous sommes intéressés plus particulièrement à la caractérisation et la comparaison des fumées inhalées par le fumeur (MSS), celles émanant de la cigarette entre deux bouffées (SSS), et les fumées expirées par le fumeur (EXS), ces deux dernières fractions étant celles auxquelles est exposé l’individu dans le cadre du tabagisme passif.Après avoir validé en relation avec le laboratoire ASCAL les méthodes de prélèvements par le suivi de traceurs spécifiques, les différents types de particules sont analysées par désorption/ionisation laser couplée à la spectrométrie de masse FTICR. La haute résolution et la précision sur la mesure du rapport m/z permettent l’attribution de façon non ambigüe d’une formule brute aux 1000 à 2000 signaux observés dans la gamme m/z 150–500. L’emploi de représentations spécifiques (carte de Kendrick et diagramme de Van Krevelen) assiste la comparaison des différents types de fumées.Les résultats montrent que la nature et la composition des MSS sont significativement différentes de celles des SSS pour lesquelles des composés à la fois moins oxygénés et moins saturés sont observés [1]. L’examen des EXS révèle quant à lui peu de différences de composition entre les deux individus soumis à l’étude mais une différence importante lorsqu’elles sont comparées aux MSS. De manière plus spécifique, il est constaté un enrichissement en composés aromatiques tels que les HAP et une diminution de la quantité des composés les plus polaires. Des échanges entre molécules adsorbées à la surface des particules et milieu physiologique seraient à même d’expliquer ce comportement.[1] Schramm, S.; Carré, V.; Scheffler, J.-L.; Aubriet, F. Anal. Chem. 2011, 83, 133–142.


[O16] Proteomic targeting of angiogenic cell lines by fumagillin mostly relies on the expression levels of METAP1

Frédéric Frottin1, Imene Dridi1, Christelle Espagne1, Willy V. Bienvenut2, Thierry Meinnel1, Carmela Giglione1

1 CNRS, ISV, UPR2355, Bâtiment 23A, 1 avenue de la Terrasse, 91198 Gif-sur-Yvette2 CNRS, ISV, FRC3115, Bâtiment 23A, 1 avenue de la Terrasse, 91198 Gif-sur-Yvette

Contact: Willy V. Bienvenut ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

Fumagillin and its derivatives are therapeutically-useful compounds for their capacity to reduce cancer progression by blocking angiogenesis, a process which is required to feed the tumor and allow it to develop [1]. Fumagillin exerts indeed strong specificity for angiogenic cell lines such as HUVEC [2] and its most recent derivatives now display little neurotoxic side effects [3]. So far however, the primary molecular basis for this specificity are yet unknown. The specific molecular target of fumagillin is METAP2, one of the two METAP with METAP1 in the cytosol of animal cells [4]. METAPs are in charge of N-terminal Methionine Excision, an essential pathway of cotranslational protein maturation [5]. We have measured the cellular levels of both cytosolic METAP mRNAs in a number of cell lines and shown that cell sensitivity to fumagillin is correlated to METAP mRNA level, and particularly to that of METAP1. Indeed, when the METAP1 mRNA level is very low, as is the case of HUVEC and the glioblastoma cells U-87, the cells are very sensitive to fumagillin with IC50 values in the nanomolar ranges. If the METAP1 mRNA level is higher than that of HUVEC or U-87, the cells become insensitive to the drug (IC50 >100 µM). Thus, we propose that the METAP1 expression can be routinely checked in several tumors and its level used as a prognosis marker to predict response to fumagillin and treatment including possible side effects. We are currently analyzing the direct impact of fumagillin treatment on protein N-termini of the whole proteome in HUVEC cells. After protein extraction, we specifically select N-terminal peptides and assess the global impact of inhibiting METAP on N-Methionine Excision. The data will be presented and discussed.

References1. Folkman & Ingber (1992) Semin. Cancer Biol. 3, 89-96.2. Ingber et al. (1990) Nature 348, 555-7.3. Satchi-Fainaro et al. (2004) Nat. Med. 10, 255-61.4. Sin et al. (1997) Proc. Natl. Acad. Sci. U.S.A. 94, 6099-103.5. Giglione et al. (2004) Cell. Mol. Life Sci. 61, 1455-74.

Keywords: Angiogenesis, N-terminal modifications, cancer.


[O17] Ldi-ms of proteolytic synthetic model peptides deposited on silicon-based nanowires: an alternative to maldi pmf?

Mathieu Dupré1, Yannick Coffinier2, Rabah Boukherroub2, Sonia Cantel1, Jean Martinez1, Christine Enjalbal1

1 Institut des Biomolécules Max Mousseron (IBMM UMR 5247), Université Montpellier 2, 34095 Montpellier2 Institut d’Electronique, de Micro-electronique et de Nanotechnologie (IEMN UMR CNRS 8520), Université de Lille Nord de France, 59652 Villeneuve d’Ascq

Contact: Mathieu Dupré ([email protected])Keywords: Organic and inorganic mass spectrometry

‘Matrix-free’ Laser Desorption/Ionization (LDI) mass spectrometry using specific inert surfaces to promote ion formation has been widely investigated the last decade.1 In addition to porous silicon through the original DIOS technique,2 different solid materials were tested as potent LDI-promoting agents, such as metals, carbon-based structures, porous particles, nanomaterials and more recently, ordered three-dimensional silicon architectures. Disposable ready-to-use Nano-Assisted Laser Desorption/Ionization (NALDITM) target was also developed for matrix-free LDI analysis of small molecules and peptides.3, 4 Following our recent development of a straightforward low cost LDI method based on the use of porous chromatography materials for the analysis of peptides5, we explored other inert silicon/silica-based materials. Taking into account that nanostructured silicon based materials were providing good detection sensitivity and that surface derivatization has a great influence on the ionization yield, 6 we choose to evaluate the efficiency of LDI-MS carried out on functionalized Silicon Nanowires for the analysis of a large variety of model peptides designed in our laboratory.In this study, we focus on C18-Silicon Nanowires as matrix in LDI-MS for the analysis of small peptides mimicking proteolytic sequences (500-1700 Da). The detection of 30 peptides has been investigated on Nanowires prepared according to 3 different processes. We also realize a set of repeatability experiments on these peptides to assess the interspot and intraspot variations, representing about 800 MS analyses. Moreover, we characterize these peptides in MS/MS experiments and compare the fragmentation data with those obtained with sample conditioned in HCCA organic matrix. Finally, we carry out the analysis of various peptide mixtures in order to probe the potent spectral discrimination in LDI-MS and compare the results with the same experiment conducted with organic matrices in MALDI analyses. Through this set of experiments, we were able to assess the LDI performances in terms of sensitivity, repeatability and robustness of C18-Silicon Nanowires as ionizing surfaces within the framework of peptide analysis such as peptide mass fingerprinting in proteomics. [1] Peteron DS. Mass Spectrom. Rev. 2007, 26: 19-34. [2] Wei J, Buriak J, Siuzdak G. Nature 1999; 399: 243-246. [3] Guénin E, Lecouvey M, Hardouin J. Rapid Commun. Mass Spectrom. 2009; 23, 1395-1400. [4] Shenar N, Cantel S, Martinez J, Enjalbal C. Rapid Commun. Mass Spectrom. 2009; 23, 2371-2379. [5] Shenar N, Martinez J, Enjalbal C. J.Am.Soc.Mass Spectrom. 2008; 19: 632-644.[6] Piret, G. l.; Drobecq, H.; Coffinier, Y.; Melnyk, O.; Boukherroub, R. Langmuir 2009, 26 : 1354-1361.


[O18] Evaluation of label-free quantitative proteomic methods together with sample fractionation for the large-scale analysis of inflammatory endothelial cells

Anne Gonzalez de Peredo1, Violette Gautier1, Emmanuelle Mouton-Barbosa1, David Bouyssié1, Nicolas Delcourt1, Mathilde Beau1, Jean-Philippe Girard1, Odile Burlet-Schiltz1, Bernard Monsarrat1

1 Institut de Pharmacologie et de Biologie Structurale, CNRS, 205 route de Narbonne, 31077 Toulouse, France

Contact: Anne Gonzalez de Peredo ([email protected])Keywords: Proteins, peptides and small molecules quantification , Bioinformatics et biostatistics dedicated to proteomics, Systems biology

Many bioinformatic tools developed in recent years for the quantification of MS data in label-free experiments use pattern-based methods and generation of LC-MS maps. Here, we applied the MFPaQ software, which uses an identity-based extraction approach, starting from peptide identification results to go back in the MS scans in order to retrieve peptide intensity values. In such label-free quantitative studies performed on complex protein samples, a compromise has to be found between reproducibility and high proteomic analytical coverage. The latter is often achieved through sample fractionation by 1D SDS-PAGE, which may induce experimental bias during the label-free comparison of samples processed and analyzed independently. We thus evaluated the efficiency of our label-free workflow with or without protein fractionation by 1D SDS-PAGE. To this aim, a whole-cell lysate of primary human endothelial cells was analyzed by nanoLC-MS/MS, either in one analytical run, or after fractionation into 12 gel bands. Samples were run on an Orbitrap-Velos instrument with high sequencing speed in order to improve MS/MS sampling and analytical coverage. Technical gel replicates or LC-MS replicates were performed to evaluate variability and systematic errors due to upstream sample processing steps (electrophoretic migration, trypsin digestion, peptide extraction) or to final analytical steps (LC-MS measurement and bioinformatic extraction of peptide XICs by the software). Data normalization and integration procedures were used in MFPaQ to correct LC-MS variability and errors related to non-reproducible electrophoretic migration of proteins in the case of sample fractionation. Our results show that for one-shot analysis, label-free quantification can be achieved with MFPaQ on about 700 proteins with good accuracy (median CV of 5%, 99% proteins with CVs<48%). Sample fractionation largely improved the depth of proteomic coverage (about 3600 proteins quantified), and this was associated with a moderate decrease of quantitative measurement reproducibility (median CV of 7%, 99% proteins with CVs<62%). The method was applied for the large-scale quantitative analysis of primary human endothelial cells stimulated by proinflammatory cytokines such as TNFα, INFβ and IL1β. It allowed us to identify and quantify about 5000 unique proteins, providing an in-depth analysis of the endothelial cell proteome and a detailed characterization of the proteomic variations associated with the inflammatory response.

Link: http://proteomique.ipbs.fr/


[O19] Microorganism characterization for the clinics using SRM

Yannick Charretier1, Christine Franceschi2, Xavier Lacoux3, Gilles Zambardi2, Victoria Girard2, Sonia Chatellier2, Arnaud Salvador4, Gaspard Gervasi1, Jérôme Lemoine4, Jean-Philippe Charrier1

1 Recherche Technologique, bioMerieux SA, chemin de l'orme, 69280 Marcy L'Etoile2 R&D Microbiologie, bioMerieux SA, 3 Route De Port Michaud, 38390 La Balme Les Grottes3 R&D ImmunoEssais, bioMerieux SA, chemin de l'orme, 69280 Marcy L'Etoile4 ANABIO, UMR 5180, CNRS / Universite de Lyon, Lyon-1 (UCBL-1), 43 boulevard du 11 Novembre 1918, 69622 Villeurbanne cedex

Contact: Yannick Charretier ([email protected])Keywords: Proteins, peptides and small molecules quantification , Clinical proteomics

Background: Recently, proteomics delivered its’ first clinical application in routine with identification of microorganisms using MALDI-TOF. However this technology, based on protein fingerprints, provides only a probability of identification and is not well suited for antibiotic susceptibility testing (AST) or virulence detection. To overcome MALDI-TOF limitations, we propose to use a triple-quadrupole mass spectrometer working in Specific Reaction Monitoring (SRM) mode, coupled with a conventional bore chromatography.

Methods : Multiplexed SRM methods enabling an absolute identification of the microorganism as well as the determination of mechanisms of resistance, virulence and strain typing have been developed in our lab. After tryptic digestion either a colony or crude sample, is injected through a short chromatographic gradient (24 min) into a triple quadrupole mass spectrometer working in SRM mode.

Results: As an example, methicillin-resistant Staphylococcus aureus (MRSA) strains could be fully characterized in 24 minutes using the multiplexed detection of 36 peptides from 14 proteins, including Penicillin-Binding Protein 2a (PBP-2a) and Panton-Valentine Leucocidin (PVL) toxin. Candida albicans yeast pathogenicity could be characterized, as well, by quantification of Ergosterol metabolite for resistance prediction and Lipase-8 protein for virulence estimation.

Conclusions: Multiplexed and quantitative capabilities of SRM offer a unique possibility to develop targeted methods for characterization of microorganisms either after culture or directly on crude sample. The power of this state-of-the-art approach is the development speed, which one can adapt methods to capture the rapid microorganism evolution in biological mechanisms. This technology is expected to bring new proteomics applications into the clinic in the near future.


[O20] Targeted proteomics profiling of the plasma membrane transportome in Arabidopsis thaliana

Jean-Marc MONNEUSE1, Madeleine SUGANO1, Thierry BECUE1, Véronique SANTONI2, Sonia HEM1, Michel ROSSIGNOL1

1 Laboratoire de Protéomique Fonctionnelle, INRA UR 1199, 2 place Viala, 34060 Montpellier cedex 1, France2 Biochimie et Physiologie Moléculaire des Plantes, INRA UMR 5004, 2 place Viala, 34060 Montpellier cedex 1, France

Contact: Sonia HEM ([email protected])Keywords: Proteins, peptides and small molecules quantification , Systems biology

Plants are exposed to various and changing environmental conditions. With respect to the availability of nutrients, a well-established and nearly general response is the adaptation of the expression level of those transporters ensuring the uptake of the corresponding nutrient. A large part of them is located at the plasma membrane and a general feature is that they belong to multigene families with high homology between members. However, the high level of homology may hamper precise identification of isoforms and prevent their quantification. For the same reason, immunological approaches are often not effective presently for a number of isoforms. Beside shotgun strategies, however, dedicated approaches focusing on specific peptides and fragments are also emerging, but little used for sets of membranes proteins and never to date for plant membrane proteins from multigene families.In this work, we set up a targeted Multiple Reaction Monitoring (MRM) proteomics approach, based on the use of proteotypic peptides and isotopically labeled analogs, for the simultaneous identification and quantification of transporter isoforms in Arabidopsis plasma membrane. Focus was given to four families of transporters, the proton pumps of the AHA (Autoinhibited H+ATPases) family, the water channels of the PIP (Plasma membrane Intrinsic Proteins) sub-family of aquaporins, the ammonium transporters of the AMT1 sub-family and members of the NRT1 and NRT2 groups of nitrate transporters. In the strategy used, proteotypic peptides were selected firstly according to: their unicity in the whole Arabidopsis genome, their predicted potential ion-current response, their chromatographic behavior and their amino acid composition to avoid post-translational modification. Then, corresponding heavy forms of the 28 selected peptides were used for technical optimization (declustering potential, DP; collision energy, CE) using a stepwise procedure and LC-MS [1] and for quantification of the corresponding light version in biological samples.This workflow was shown to allow the analysis of isoforms in the fourth families, including as well major membrane proteins as transporters of lower abundance. Similarly, it was used to investigate the effect of a salt stress on the expression of these latter 20 transporters in roots and identify the responding isoforms.Such a resource (the peptides, their transitions and associated optimized detection conditions, as well as the synthetic peptides them-self) presents the advantage to be reusable and progressively expandable, thus opening the possibility of quantitative and isoform-specific investigation of the transportome in the model plant Arabidopsis. [1] Lange, V., Picotti, P., Domon, B., Aebersold, R., Selected reaction monitoring for quantitative proteomics : a tutorial. Mol. Syst. Biol. 2008, 4, 222.

Link: http://www1.montpellier.inra.fr/proteome/index.htm


[O21] Effets de l’acétylation des peptides de la peau de la rainette Pachymedusa dacnicolor pour un séquençage de Novo par MALDI-TOF/TOF

Claire lacombe1, Constance Auvynet3, Germain Tong1, Gérard Bolbach1, Emmanuelle Sachon1

1 Universite» P. et M. Curie Paris 6, UMR 7203 CNRS-UPMC-ENS, 4 place Jussieu, 75005 Paris, France2 Plateforme de spectrométrie de masse et protéomique, IFR83, 7-9 quai saint bernard, 75005 Paris, France3 Pitié salpêtrière, 91, Bd de l'hôpital, 75013 Paris, France

Contact: Emmanuelle Sachon ([email protected])Keywords: Clinical proteomics

Les grenouilles d’Amérique latine synthétisent et sécrètent au niveau de leur peau, des peptides biologiquement actifs. Dans cette étude, nous nous intéressons aux peptides issus de la peau de la rainette, Pachymedusa dacnicolor, afin d’isoler et caractériser de nouveaux peptides d’intérêt thérapeutique. Pour ce faire, nous travaillons sur des exsudats de peau. Les peptides contenus dans ces exsudats sont séparés par tamis moléculaire suivi d’HPLC. Les fractions obtenues sont testées pour leur activité biologique puis 4 fractions actives ont été analysées par spectrométrie de masse. Dans ces fractions, 6 peptides ont été identifiés et fragmentés par MALDI-TOF/TOF (séquençage de Novo). Trois d’entre eux avaient déjà été publiés (DMS-DA5, DMS-DA6 et DMS-DA8). Les trois autres peptides coexistent dans la quatrième fraction et possèdent une structure primaire N-terminale identique (résidus 1 à 29). Cette séquence commune, qui avait été déduite à partir de l'ADN de grenouille en 1998 est la suivante : ALWKTLLKKVGKVAGKAVLNAVTNMANQN-COOH. Les deux autres peptides de cette fraction possèdent ces 29 résidus +E et +EQ en C-terminal. Le peptide DMS-DA6 a été synthétisé sous forme amidée ou non en C-terminal. L’activité antimicrobienne des deux peptides a été testée sur deux souches de bactéries (Gram+ et -) et leur structure secondaire déterminée par dichroïsme circulaire.Tous ces peptides de peau de grenouille contiennent généralement une grande quantité de résidus K, il a donc été nécessaire de recourir à une réaction d’acétylation afin de lever l’ambigüité Q/K qui existe du fait de la limitation dans la précision de mesure de masse de l’instrumentation MALDI-TOF (≥20 ppm pour les peptides). L’acét! ylation des 4 fractions HPLC nous a permis de lever les ambiguïtés K/Q et nous a montré que cette réaction peut avoir lieu sur les fonctions amine primaires (N-terminal et résidus K) mais aussi, dans une moindre mesure, sur la fonction amine secondaire des résidus H. L’acétylation complète des peptides conduit à la disparition des sites protonables (si aucun résidu R dans la séquence). Ceci entraine la disparition de la molécule monoprotonée [M+H]+ au profit des espèces [M+Na]+ et [M+K]+. Dans le cas de la présence d’un résidu P dans la séquence de ces peptides, on observe une fragmentation source, préférentielle en N-terminal du résidu P. Ces peptides acétylés constituent de bons modèles pour aborder le phénomène d’ionisation en MALDI.

Link: http://www.chimie.ens.fr/LBM/


[O22] Use of quantitative proteomics to study function and specificity of an emerging protease family in cell-based assays

Frédéric Delolme1, Robin Capomaccio2, Isabelle Zanella-Cléon1, Michel Becchi1, David Hulmes2, Christopher Overall3, Catherine Moali2

1 Institut de Biologie et Chimie des Protéines, FR 3302, 7, Passage du Vercors, 69367 Lyon2 Institut de Biologie et Chimie des Protéines, FRE 3310, 7, Passage du Vercors, 69367 Lyon3 Centre for Blood Research, University of British Columbia, 2350 Health Sciences Mall, V6T 1Z3 Vancouver, BC

Contact: Catherine Moali ([email protected])Keywords: Proteins, peptides and small molecules quantification

The substrate repertoire of human tolloid-like proteinases (also known as BMP-1, mTLD, mTLL-1 and mTLL-2) has considerably expanded in the past 10 years to include several extracellular matrix components, growth factors and angiogenic factors. These extracellular metalloproteases are now thought to synchronize the biosynthesis of the extracellular matrix with the activation of several growth factors and appear as key players during embryogenesis and tissue repair. However, our current understanding of the physio-pathological roles of BMP-1/tolloid-like proteases is limited by the lack of high-throughput approaches to identify novel substrates and/or determine the relevant subset of substrates that are cleaved in specific biological contexts. Quantitative proteomics applied to cell-based assays and tissues is at the moment one of the most powerful techniques to address these questions.Protease-generated fragments, released from the cell-surface or the extracellular matrix, are expected to be found in higher amounts in the supernatants of cells expressing active protease compared to cells expressing inactive protease and this difference can be monitored using iTRAQ™ labelling of tryptic peptides and quantification with LC-MS/MS. This technique has allowed the identification of several candidate substrates of BMP-1 which have then been studied by western blotting and classical biochemical techniques. However, secreted substrates that do not change cellular compartment after cleavage are missed by this technique and we are now switching to the more exhaustive TAILS technique (Terminal Amine Isotopic Labelling of Substrates) which relies on pre-labelling of whole proteins prior to fragmentation followed by a step of negative selection to enrich the sample in N-terminal peptides (1). Finally, iTRAQ™ labelling of whole proteins is also used in vitro to identify cleavage sites in complex extracellular substrates bearing glycosaminoglycan chains, as an off-gel alternative to Edman sequencing.

(1) Kleifeld, O.; Doucet, A.; auf dem, K. U.; Prudova, A.; Schilling, O.; Kainthan, R. K.; Starr, A. E.; Foster, L. J.; Kizhakkedathu, J. N.; Overall, C. M. Isotopic labeling of terminal amines in complex samples identifies protein N-termini and protease cleavage products. Nat. Biotechnol. 2010, 28 (3), 281-288.

Link: www.ibcp.fr


[O23] Analytical strategy combining NMR, chemical synthesis and mass spectrometry for molecular and structural characterization of plasma-polymerized siloxanes.

Thierry Fouquet1, Jérôme Bour1, David Ruch1, Laurence Charles2

1 Advanced Materials and Structures - CRP Henri Tudor, 66, rue de Luxembourg, L-4002 Esch-sur-Alzette (Luxembourg)2 SACS - Aix-Marseille Universités, Campus de Saint-Jérôme - case 512, F-13397 Marseille (France)

Contact: Thierry Fouquet ([email protected])Keywords: Organic and inorganic mass spectrometry

Contrary to conventional polymerization techniques, plasma-polymerization at atmospheric pressure leads to thin, poorly soluble and highly cross-linked films, with huge potential for industrial applications. Their microstructure, affected by plasma process parameters and the nature of the precursors, is thus quite difficult to assess. To overcome these difficulties, a complete analytical strategy is proposed – combining NMR spectroscopy, organic synthesis and mass spectrometry – leading to a detailed molecular and structural characterization of some plasma-polymers.The targeted samples are plasma-polymerized films deposited by means of Atmospheric Pressure plasma generated by Dielectric Barrier Discharge. Two siloxane precursors were plasma-polymerized, either cyclic (octamethylcyclotetrasiloxane, D4) or linear (hexamethyldisiloxane, HMDSO), to synthesize ppD4 and ppHMDSO deposits, respectively.

NMR spectroscopy offered a global vision of the deposits as well as an insight in structural features of their insoluble parts by the detection of well-known M, D, T or Q silicon functions for instance. Based on the tandem mass spectrometric behavior of linear methyl-terminated PDMS, molecular and structural information was obtained for the electrosprayed ppD4 soluble part. Distributions of peaks spaced by 282 Da were detected and seen as [OSi(CH3)2]2(OSiCH3)2 cycles bound via either an oxygen atom (A, major species), a –O–CH2– group (B) or a linear –O–Si(CH3)2– backbone (C). The expected dimer of the distribution (A) as well as some potential oligomers of the (C) series were then synthesized by conventional chemistry and submitted to CID, so as to compare the MS/MS patterns of plasma and synthesized species and validate the structural elucidation.The ESI-MS spectrum of ppHMDSO revealed at least eight oligomeric distributions, further noted Cn, with n=0-7 indicating the degree of cross-linkage. MS/MS spectra of the oligomers from a given Cn distribution showed n major product ion series. C0 oligomers exhibit MS/MS spectra quite similar to those obtained from linear CH3-PDMS with only one product ion series. In contrast, interpretation of CID data of more cross-linked oligomer adducts required alternative models, amongst commercial T-branched PDMS was shown to be promising for the C1 and C2 series. In addition, several new home-made cyclolinear PDMS would constitute promising models for the highest cross-linked distributions.As a perspective, an aminolysis reaction allowed a entire dissolution of a homemade highly cross-linked silicon rubber, leading to hydroxy-terminated and cyclic siloxanes. Applied to plasma-polymers, it would be an elegant breakthrough for the complete structural characterization of plasma-polymers, allowing the «insoluble» part to be also mass-analyzed by ESI-MS(/MS).


[O24] Evaluating the accuracy of the positioning of phosphorylations by MS/MS spectra

Markus Muller1, Erik Ahrne2, Frederic Nikitin1, Frederique Lisacek1

1 Proteome Informatics Group, Swiss Institute of Bioinformatics, 1, rue Michel Sevet, 1211 Geneve, Suisse2 Proteomics Core Facility Biozentrum, University of Basel, Klingelbergstrasse 50/70, 4056 Bale, Suisse

Contact: Markus Muller ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Bioinformatics et biostatistics dedicated to proteomics, Systems biology

Many large scale phosphorylation studies ([1][2][3]) have been performed yielding thousands of identified phospho-petides and their positions of phosphorylated amino acids. These studies provide new insights into the paramount importance of phosphorylation as a regulator of biochemical processes. While the statistical false discovery rate (FDR) of the peptide identifications can be controlled by using decoy databases, the error in the assignment of the phosphorylation positions is rarely reported and usually only the position with the highest score is reported.

Recently, we introduced QuickMod, a tool to identify modified variants of MS/MS library spectra [4]. We showed that the spectra of unmodified peptides bear considerable similarity to their modified counterparts. Even though the peak intensities can be strongly altered, the fragmentation sites are quite conserved between modified and unmodified peptides. QuickMod implements a spectrum alignment and modification positioning algorithm which uses the information from the unmodified library spectra. It calculates and reports a score for all possible positions of the modifications on the peptide as well as a statistical significance for all these positions.

Using publicly available data from large scale phosphorylation studies we extract those phospho-peptides, which have a matching unmodified library spectrum of the same charge and fragmentation technique. We investigate the agreement of the phospho-site positions reported in these data and the results from our spectrum library search for those phospho-peptides. An initial study using a dataset of 1000 doubly and triply charged phosphor-peptide spectra showed that phospho-site assignments are often ambiguous when several serine and threonine residues are present in close proximity. Here, we investigate the accuracy of phospho-sites in more detail and on a larger dataset. We present some simple rules indicating which modification assignments can be trusted and which ones have to be taken with care.

[1] B. Bodenmiller et al., «PhosphoPep[mdash]a phosphoproteome resource for systems biology research in Drosophila Kc167 cells,» Mol Syst Biol, vol. 3, Oct. 2007.[2] S. A. Beausoleil, J. Villen, S. A. Gerber, J. Rush, and S. P. Gygi, «A probability-based approach for high-throughput protein phosphorylation analysis and site localization,» Nat Biotech, vol. 24, no. 10, pp. 1285-1292, Oct. 2006.[3] J. V. Olsen et al., «Global, In Vivo, and Site-Specific Phosphorylation Dynamics in Signaling Networks,» Cell, vol. 127, no. 3, pp. 635-648, Nov. 2006.[4] E. Ahrne», F. Nikitn, F. Lisacek, and M. Muller, «QuickMod: A Tool for Open Modifcaton Spectrum Library Searches,» Journal of Proteome Research, http://dx.doi.org/10.1021/pr200152g


[O25] Systems analysis of budding yeast fermentation and respiration

Emmanuelle Becker 1, Aurélie Lardenois 2, Yuchen Liu 2, Bertrand Evrard 2, Régis Lavigne 2, Charles Pineau 2, Michael Primig 2

1 University of Rennes 1, Campus de Beaulieu, 35042 Rennes, cedex, France2 IRSET, Campus de Beaulieu, 35042 Rennes, cedex, France3 Proteomics Core Facility Biogenouest, Campus de Beaulieu, 35042 Rennes, cedex, France

Contact: Régis Lavigne ([email protected])Keywords: Systems biology

Saccharomyces cerevisiae is a model organism for biological processes such as mitotic growth and meiotic development. Recent advances in genome biology have yielded data on yeast genomes, as well as the transcriptome, proteome and interactome. In the present work, we used a molecular systems biology approach by combining different high-throughput datasets, with the aim to gain new insight into growth and meiotic development processes.

Duplicate total protein extracts from logarithmically growing diploid cells cultured in rich medium with glucose (YPD, fermentation) or acetate (YPA, respiration) were run onto a high resolution SDS-polyacrylamide gel, each lane was cut into 30 bands which were digested with Trypsin. Samples were then processed by shotgun LC-MS/MS analysis on a LTQ-Orbitrap XL instrument for protein identification. The resulting information was integrated with the output of our own whole-genome expression profiling experiments using tiling microarrays as well as DNA sequencing data and protein network data available via certified public repositories.

We have determined the dynamic proteome of diploid yeast cells in two different metabolic states (fermentation of glucose and respiration of acetate). Our label-free method based on a simple protein extraction, and separation step identified essentially all (93%) of the known proteins present in vegetatively growing diploid SK1 budding yeast cells. The vast majority of the proteins were found in both replicates of each medium, underlining our method’s robustness. Small numbers of proteins were identified only in YPD or YPA, and several hundred were not detected in any of our experiments. The latter group contained proteins encoded by genes not expressed under the conditions we tested or by loci found to be deleted or mutated in SK1.

Our data on the yeast SK1 proteome together with information on DNA and RNA yielded systems-level insight into vegetative growth under two different metabolic conditions and revealed its surprisingly distinct proteome as compared to the reference strain. This work paves the way for large-scale dynamic proteome profiling of complex processes such as meiotic development.


[O26] Développement Méthodologique pour la Quantification en Imagerie par Spectrométrie de Masse (qMSI)

Grégory Hamm1, David Bonnel1, Raphael Legouffe1, Fabien Pamelard1, Jean-Marie Delbos2, François Bouzom2, Catherine Piveteau3, Nicolas Willand3, Benoit Déprez3, Jonathan Stauber1

1 ImaBiotech, Campus Cité Scientifique, 59655 Villeneuve d’Ascq, France2 Technologie Servier, 25 Rue Eugene Vignat , 45000 Orléans, France3 INSERM U761, Biostructures & Drug Discovery, Université Lille Nord de France, 59000 Lille, France

Contact: Grégory Hamm ([email protected])Keywords: Imaging mass spectrometry, Proteins, peptides and small molecules quantification

L’obtention de données quantitatives à partir d’une expérience d’imagerie par spectrométrie de masse (MSI) reste à ce jour un challenge pour notre communauté scientifique. Cette quantification requière la mise au point d’une méthodologie particulière afin d’obtenir une meilleur reproductibilité et homogénéité des mesures (signal) au même titre qu’une courbe de calibration présentant un minimum de variabilité et une très bonne linéarité. Plusieurs méthodes ont été décrites dans la littérature mais aucune d’elles n’a d’applications universelles. Nous proposons ici deux approches à la fois différentes et complémentaires en vue de la quantification par imagerie MALDI-MS. Nous tenterons par ce fait de répondre aux principales difficultés à prendre en compte dans la démarche de quantification par MSI, à savoir, premièrement, la haute dépendance du signal détecté à la déposition/propriétés de la matrice MALDI ainsi qu’à sa capacité d’extraction ; deuxièmement, le rendement d’ionisation spécifique des molécules cibles ; et finalement, l’effet de suppression ionique du au tissue. Notre méthodologie a été appliquée dans le cadre de l’étude de la distribution de deux médicaments, le propranolol (Sigma-Aldrich) et le BDM31343, sur un modèle animal (souris) par imagerie MALDI-TOFMS (Autoflex Speed, Bruker). Les protocoles expérimentaux et les paramètres instrumentaux ont été adaptés à chacune des cibles. Les deux approches choisies pour cette étude consistent, pour la première, en l’utilisation d’un broyat d’un organe d’intérêt auquel est ajouté une gamme de concentration connue d’une molécule cible puis reconstitué par congélation et enfin analysé en même temps qu’un échantillon traité comportant le composé étudié. Cette première approche est particulièrement adaptée à l’étude de la distribution d’un composé cible dans un organe particulier, elle nécessite une plus moins longue préparation et un temps de retraitement des données minimum. La seconde approche, quant à elle, prend en compte l’effet de suppression ionique inhérent au tissu analysé par imagerie MALDI-MS en utilisant un facteur de normalisation, nommé TEC (Coefficient d’Extinction Tissulaire). Ce coefficient est calculé en comparant le signal d’une molécule cible sur et en dehors du tissu (support). Il permet de normaliser les données obtenues lors de l’analyse d’un échantillon traité par un médicament donné, la molécule cible précédemment citée. Cette approche a pour principaux atouts, un temps de préparation limité et d’être adapté à l’étude de plusieurs organes simultanément. Comme inconvénient, un traitement de donnés important est nécessaire. Afin de valider nos deux approches, les résultats issus de notre méthodologie ont été comparés à des études effectuées sur les mêmes échantillons par d’autres techniques analytiques (l’autoradiographie et la LC-MS/MS).


[O27] Using proteomics to identify AICAR cellular targets

Hans C. Hürlimann1, Imad Bouzaidi Cheikhi1, Stéphane Claverol2, Marc Bonneu2, Bertrand Daignan-Fornier1, Benoît Pinson1

1 Institut de Biochimie et Génétique Cellulaires CNRS/ Université Victor Segalen Bordeaux 2 , 1, rue Camille Saint Saëns, 33077 Bordeaux2 Pôle Protéomique, Centre de Génomique Fonctionnelle Bordeaux, Université Victor Segalen Bordeaux 2, 146 rue Léo Saignat, 33076 Bordeaux

Contact: Hans C. Hürlimann ([email protected])Keywords: Systems biology

AICAR monophosphate (5-Aminoimidazole-4-carboxamide ribonucleoside-5’ monophosphate) is a metabolic intermediate of the de novo purine synthesis pathway, presenting highly promising metabolic and antiproliferative properties. One of its known activities is the induction of the AMP dependent kinase (AMPK), explaining many, but not all of its effects. The molecular mechanisms underlying the AMPK independent effects are poorly understood up to now. From yeast (S. cerevisiae) it is known that AICAR effects are multifactorial. This was demonstrated with genetic and metabolic analysis. To better tackle the complexity of the AICAR induced phenomena, we now applied another approach. To systematically screen for cellular targets of AICAR, a proteomic approach was undertaken in yeast, using affinity chromatography and subsequent identification of the binding proteins by mass spectrometry. Like this 62 proteins (~1% of the proteome) were found in at least four of five experiments and defined as AICAR binding proteins. To test the specificity of the affinity chromatography, the same experiment was done for succinyl-AICAR (SAICAR). It occurs just one step before AICAR synthesis and is therefore chemically very close, differing only by an additional succinyl group. These experiments resulted in a list of 70 SAICAR binding proteins and strikingly only five are identical to the previously identified AICAR binding proteins. Interestingly the two different groups of binding proteins also belong to distinct functional groups of proteins. Our conclusion was that specificity of the proteomic approach used is acceptable and that a different action of the two molecules analyzed is expected. Detail studies of candidate proteins were thereafter undertaken in yeast, to further validate the approach.We were furthermore interested in the identification of evolutionary conserved binding proteins, with the assumption in mind that this will allow us to reveal processes regulated by AICAR, conserved between species. We therefore proceeded with the identification of AICAR binding proteins in species from bacteria to man and have now a large overview over the most probable targets of this small molecule. As a second approach to identify proteins affected by AICAR, a drug affinity responsive target sensitivity (DARTS) study is on the way now, applying mass spectrometric identification and label free quantification.


[O28] Détection sensible et spécifique des spores de Bacillus anthracis dans des matrices environnementales par immunocapture et spectrométrie de masse en mode MRM.

Jérôme Chenau1, François Fenaille1, Eric Ezan1, Patricia Lamourette1, Natalie Morel1, Pierre Goossens2, François Becher1

1 CEA, iBiTec-S, Service de Pharmacologie et d’Immunoanalyse, CEA de Saclay, 91191 Gif-sur-Yvette2 Institut Pasteur, Toxines et Pathogénie Bactérienne, URA 2172 CNRS, 25-28 rue du docteur Roux, 75724 Paris Cedex 15

Contact: Jérôme Chenau ([email protected])Keywords: Proteins, peptides and small molecules quantification , High mass and high resolution mass Spectrometry

L’anthrax, maladie infectieuse aigüe, est lié à la bactérie Bacillus anthracis (Ba). Cette bactérie génère une structure résistante appelée « spore » qui constitue la forme de dissémination de la maladie. Le CDC (Centers for Disease Control) assigne Ba comme agent de classe A, le niveau de risque le plus élevé. L’utilisation des spores de Ba comme arme biologique a été soulignée lors de l’envoi de lettres contaminées aux Etats-Unis en 2001, qui causa 22 cas dont 5 décès.Il est donc indispensable de détecter la présence de spores de Ba dans des échantillons environnementaux potentiellement contaminés. Une méthode efficace doit être à la fois sensible, spécifique, reproductible et rapide. La protéomique et la MS sont des approches pertinentes pour répondre à cette problématique.La MS a ici été utilisée pour deux applications : la détection sensible des spores de Ba en mode ciblé de type MRM et la découverte de nouveaux biomarqueurs spécifiques. Nous avons tout d’abord développé un procédé analytique original de type immuno-LC/MS/MS adapté à la détection des spores de Ba. Il combine la spécificité et la sensibilité de deux techniques complémentaires : immunocapture et MS en mode ciblé. L’immunocapture est réalisée directement sur les spores intactes. Elle permet de les extraire spécifiquement de matrices environnementales complexes et entraine un gain en sensibilité. La seconde étape consiste à détecter en mode MRM la protéine SASP-B (Small Acid-soluble Spore protein B). Cette protéine est exprimée exclusivement dans les spores et en quantité abondante. Un isoforme particulier a été préalablement décrit pour les spores de Ba et permet ainsi de les discriminer des autres bactéries du groupe cereus phylogénétiquement très proches. La limite de détection (LOD) de notre approche est de 10^3 CFU/mL dans le lait et 7.10^3 spores détectées dans 10 mg de terre. Ces LOD sont au niveau de la dose infectieuse minimum (ID50 : 10^3-5.10^4) et proches de celles obtenues par PCR.Cependant le suivi d’un seul biomarqueur peut présenter un biais en terme de spécificité. Nous avons ainsi cherché en parallèle à identifier de nouveaux marqueurs discriminant Ba des autres bactéries du groupe cereus, ceci afin de diversifier les protéines ciblées et ainsi augmenter encore la spécificité de détection. Dans ce but, des extraits de spores issus de 38 souches (10 Ba versus 28 B. cereus et B. thuringiensis) ont été analysés par MS haute résolution sur un LTQ-Orbitrap. Sept protéines présentant des mutations spécifiques de Ba ont été mises en évidence pour la première fois. Le suivi de ces marqueurs, en plus de la SASP-B, par MRM multiplex permet de détecter très spécifiquement les spores de Ba.En conclusion, ces travaux présentent une utilisation originale de la MS pour la détection sensible et spécifique des spores de Ba. Ce procédé pourra être étendu à la détection d’autres bactéries de la menace.


[O29] Identification and characterization of new protein partners of serotonin transporter

Pascal Seyer1, Mathieu Seimandi1, Franck Vandermoere1, Joël Bockaert1, Philippe Marin1

1 Institut de Génomique Fonctionnelle - CNRS UMR5203 - INSERM U661 – Universités Montpellier 1 & 2, 141 rue de la Cardonille, 34094 Montpellier, France

Contact: Pascal Seyer ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

The plasma membrane serotonin transporter (SERT) plays a critical role in the regulation of serotonergic transmission by enabling serotonin reuptake into the cells. This transporter is of major pharmacological and clinical interest, particularly as it represents one of the primary targets of several widely prescribed antidepressants. It is now well established that SERT does not function as an isolated protein. SERT functional activity is regulated by a combination of multiple mechanisms including both post-translational modifications and association with intracellular proteins. During the last decade, several SERT-interacting proteins have been identified, principally by means of yeast two-hybrid screens. We have recently used a proteomic approach that enabled us to characterize a reciprocal modulation of SERT and neuronal NO Synthase (nNOS) activity mediated by their physical interaction. To get further insight into SERT-associated protein complex, we used high-resolution mass spectrometry to identify novel proteins interacting with SERT C-terminus, or whole SERT protein expressed in two different cell culture models. This shotgun analysis of SERT interactome led us to identify several new partners of SERT. These include Calcineurin, a calcium-dependent serine/threonine phosphatase, ASCT2 (Alanine Serine Cysteine Transporter 2), a neutral amino acid transporter, VELI-3, a PDZ domain-containing protein which regulates plasma membrane distribution of several receptors and transporters, and a set of proteins related to the SNARE complex, possibly involved in SERT export to the plasma membrane. Moreover, we showed that both physical interaction of SERT with Calcineurin and Calcineurin phosphatase activity increase SERT plasma membrane expression and 5HT uptake via SERT. In addition, co-expression of VELI-3 with SERT likewise increases 5HT uptake, whereas co-expression of ASCT2 decreases SERT activity, possibly via modification of its glycosylation status. Collectively, these proteomic studies identify novel regulation mechanisms of SERT activity that might influence serotonergic transmission.


[O30] Une suite logicielle pour la protéomique interfacée sur une grille de calcul. Utilisation d'algorithmes libres pour l'identification MS/MS, le séquençage de novo et l'annotation fonctionnelle.

Christine Carapito1, Alexandre Burel1, Patrick Guterl1, Jérôme Pansanel2, Fabrice Bertile1, Alain Van Dorsselaer1

1 Laboratoire de Spectrométrie de Masse BioOrganique, DSA, IPHC, UMR 7178, CNRS, Université de Strasbourg, 25, Rue Becquerel, 67087 Strasbourg, France2 Département Recherches Subatomiques, DRS, IPHC, UMR 7178, CNRS, Université de Strasbourg, 23, Rue du Loess, 67037 Strasbourg, France

Contact: Christine Carapito ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics

ContexteLes progrès instrumentaux en spectrométrie de masse (MS) de ces 20 dernières années ont conduit au développement d’instruments générant des données MS/MS de plus en plus volumineuses (du fait d’une grande rapidité d’acquisition des spectres de fragmentation).Par ailleurs, la soumission des résultats d’identification de protéines à partir de ces données MS/MS est de plus en plus réglementée par les journaux du domaine qui recommandent l’utilisation d’algorithmes transparents (open-source) et multiples si possible.Dans ce contexte, afin de répondre au besoin croissant de puissance de calcul nécessaire à l’interprétation des données MS/MS, une suite logicielle bâtie sur des logiciels libres a été adaptée et améliorée sur une grille de calcul.

Méthodes et RésultatsLa suite logicielle développée à l’IPHC permet : - de créer, d’extraire, de concaténer, de formater des banques de séquences protéiques, notamment à partir des banques de séquences publiques accessibles telles que NCBInr, UniProtKB, UniProtKB/SwissProt, …- de lancer des requêtes OMSSA (Open Mass Spectrometry Search Algorithm) pour l’identification de protéines à partir de données MS/MS sur la grille de calcul locale de l’IPHC (1024 cœurs de calculs, site TIER-2 de la grille LHC (Large Hadron Collider)) et mondiale.- d’interpréter à haut débit des données MS/MS acquises sur des organismes non séquencés par séquençage de novo suivi de recherches d’homologies de séquences.- d’extraire de manière automatisée les annotations fonctionnelles disponibles sur les protéines identifiées.L’ensemble de ces outils est disponible sur le site https://msda.u-strasbg.fr.

ConclusionL’adaptation de la suite logicielle sur une grille de calcul permet de répondre aux importants besoins de puissance de calcul non accessibles à ce jour dans les laboratoires de protéomique. En effet, selon le type de requête (nombre de spectres MS/MS, taille de la banque de séquences, recherche de modifications post-traductionnelles, séquençage de novo, …), un gain d’un facteur 100, voire 1000 est obtenu en routine grâce à la parallélisation des outils et à leur lancement sur une grille de calcul.

Link: https://msda.u-strasbg.fr


[O31] Quelle voie pour la caractérisation d’ isoformes protéiques sur coupe de tissu par MALDI in source decay ?

David Calligaris1, Claude Villard1, Therese Schembri1, Daniel Lafitte1

1 Proteomique et Innovation Technologique Timone, 27 Bd Jean Moulin, 13385 Marseille2 CRO2 INSERM U911, 27 bd jean Moulin, 13385 Marseille

Contact: Daniel Lafitte ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Imaging mass spectrometry

L'expression des isotypes d’une protéine est sous le contrôle de plusieurs gènes, et les isoformes issus d’un même gène sont produits par épissage alternatif et/ou par modification post-traductionnelle. Ces processus participent à la complexité du protéome. Ces protéines homologues sont souvent fonctionnellement différentes et sont impliquées dans la régulation de différents processus physiologiques. En spectrométrie de masse, la caractérisation des protéines est habituellement effectuée en utilisant des approches de type bottom-up par CID (« collision induced dissociation ») ou par PSD (« Post source decay »). Néanmoins, les protocoles associés exigent une digestion préalable des protéines, ceci allongeant le temps de traitement des échantillons. Pour caractériser les isotypes d’une protéine, l'approche top-down par MALDI in-source decay (ISD) est une technique de choix [Brown et al. Anal. Chem. 1995]. Lors de ce processus, une augmentation de la fluence laser conduit à la fragmentation des protéines [Takayama J. Am. Soc. Mass Spectrom. 2001, Suckau et al. Anal Chem, 2003]. La fragmentation ISD emprunte deux voies, la voie radicalaire produisant majoritairement des ions c et z et la voie thermique produisant des ions b et y.Les travaux menés au sein de notre laboratoire ont indiqué une fragmentation ISD de l’extrémité C-terminale de tubuline de cellules HeLa. La tubuline, cible majeure en chimiothérapie anticancéreuse, est présente au sein d’un organisme sous différents isotypes. A partir d’un seul spectre, il a été possible de déterminer la composition isotypique d’une solution purifiée [Calligaris et al. Anal Chem. 2010].

Pour la caractérisation de biomarqueurs et le développement de nouvelles thérapies, il s’avère nécessaire de caractériser ces isotypes protéiques au sein des tissus. L’ISD sur coupe de tissu a été récemment démontré par le groupe d’E. De Pauw [Debois et al. Anal Chem. 2010]. Diverses protéines de cristallin de porc ont ainsi été mis en évidence et collocalisé par imagerie MALDI couplé à l’identification par ISD. Les protéines identifiées sont majoritairement fragmentées par un processus radicalaire.Notre étude a permis l’identification sur coupe de cerveau de souris d’isotypes de tubuline. Cette caractérisation par MALDI in source decay est complémentaire des résultats obtenus par Debois et al. puisque nous démontrons que certaines protéines empruntent plutôt la voie thermique que la voie radicalaire pour la fragmentation en source et que cela facilite leur identification dans un mélange complexe.

Notre groupe à souhaité apporter un réel complément à l’analyse histopatologique en effet la caractérisation in situ des isotypes de tubuline peut aboutir à un meilleur pronostique des tumeurs solides et permettre une avancée vers la personnalisation des traitements chimiothérapiques.Link: http://map.univmed.fr/


[O32] System biology insights into the global remodeling of proteome and pathogenicity of Bacillus cereus induced by oxydoreduction potential

Gérémy Clair1, Catherine Duport3, Jean Armengaud1

1 Laboratoire de biochimie des systèmes perturbés, CEA,DSV,IBEB, pb-17171, 30207 Bagnols-sur-ceze2 université d'avignon et des pays du vaucluse, , 84000 avignon3 UMR A408 SQPOV, domaine saint paul, 84914 avignon

Contact: Gérémy Clair ([email protected])Keywords: Systems biology

Bacillus cereus is a pathogenic agent causing human foodborne disease. Diarrheal syndrome may be the consequence of the production in the host’s small intestine of various extracellular factors, including enterotoxins. In human intestine, pathogens have to deal with a lack of carbohydrates, varying oxygen concentrations and oxydoreduction potential (ORP). While bacterial response to changes in oxygen level has been widely studied, adaptation to various POR has never been documented. We cultured B. cereus in a medium mimicking intestinal conditions under low and high-ORP anoxic conditions (pO2 = 0%) and in full oxic condition (pO2 = 100%). We compared (1) the early secreted and (2) the intracellular protein contents by means of a high-throughput label-free proteomic strategy. A total of 27 biological samples were in-depth analyzed following a system biology approach: record of high-throughput quantitative proteomic data, metabolism modeling, creation of mutant strains, high-throughput proteomics, and so on. After protein extraction and trypsinisation, nano-LC-MS/MS detection of the peptides resulted in a large body of MS/MS spectra acquired (above 1.5 millions). A total of 15,022 unique peptides were assigned to 1,373 proteins. We observed that most proteins identified in secretome are related to pathogenesis. Two-thirds have never been detected before. Changes in secreted protein levels depending on oxygen availability and ORP induce a modification of cytotoxicity towards Caco-2 human epithelial cells (Clair et al, 2010). Detailed study of intracellular proteome associated to metabolic data highlights that a global proteome remodeling occurs in low-ORP anaerobiosis compared to high-ORP anaerobiosis. Candidate proteins possibly involved in this remodeling were identified by analyzing proteomic data. Their major roles were then elucidated by (i) constructing strains lacking these proteins and (ii) analyzing the intracellular-proteome and secretome of the mutant strains (Clair et al, 2011).

References : Clair, Roussi, Armengaud, Duport (2010) Mol Cell Proteomics 9:1486-98. Clair, Armengaud, Duport (2011) submitted for publication

Link: http://www.mcponline.org/content/9/7/1486.long


[O33] Identification par très haute résolution FT-ICR de processus induits par la charge dans la décomposition de peptides cycliques en ECD

Carlos Afonso1, Hanane Belghit1, Marie Pérot-Taillandier1, Jean-Claude Tabet1

1 Institut Parisien de Chimie Moléculaire, UMR 7201 CNRS-UPMC, 4 place Jussieu, 75005 Paris, France2 Molécules de Communication et Adaptation des Microorganismes, UMR 7245 CNRS-MNHN, 57 rue Cuvier, 75005 Paris, France

Contact: Carlos Afonso ([email protected])Keywords: High mass and high resolution mass Spectrometry

Le séquençage des peptides linéaires par spectrométrie de masse se fait conventionnellement en mode CID. Cette technique permet la dissociation des ions par apport d’énergie vibrationnelle impliquant des fragmentations induites par la charge. Dans le cas de l’ECD, la dissociation est causée par capture d’un électron lent menant à d’autres types de dissociations. Cette technique implique des mécanismes qui ne sont pas parfaitement connus notamment pour les peptides cycliques qui nécessitent deux fragmentations consécutives, ce qui rend l’attribution très complexe. Dans la littérature, le modèle de la cascade radicalaire est généralement considéré pour expliquer la formation de fragments à partir de peptides cycliques[1].Au cours d’un travail préliminaire effectué sur des peptides lasso, il est apparu que la formation d’ions b’•

j en ECD est due a priori à des processus consécutifs induits par la charge [2]. Une première rupture liée à la capture d’un électron ouvre le cycle (clivage c/z) et une deuxième rupture induite par la charge conduit à la formation des ions de la série b’•

j.Au cours de ce travail la dissociation par capture d’électron (ECD) de peptides cycliques tels que la cyclosporine A, a été comparée aux dissociations induites par collisions (CID). Cette étude effectuée sur un ESI-FT-ICR (Fourier Transform Ion Cyclotron Resonance) a permis, grâce à la haute résolution en masse de cet appareil, d’analyser finement la composition des différents fragments produits par ECD. Nous avons montré que dans le cas de la cyclosporine, en ECD, il existe en plus des fragmentations induites par le radical (cascade radicalaire), une voie de fragmentation compétitive induite par la charge.

[1] Leymarie, N.; Costello, C. E.; O'Connor, P. B. Electron capture dissociation initiates a free radical reaction cascade. Journal of the American Chemical Society 2003, 125, 8949-8958.[2] Zirah, S.; Afonso, C.; Linne, U.; Knappe, T. A.; Marahiel, M. A.; Rebuffat, S.; Tabet, J.-C. Topoisomer Differentiation of Molecular Knots by FTICR MS: Lessons from Class II Lasso Peptides. J. Am. Soc. Mass Spectrom. 2011, 22, 467-479.


[O34] Detection de l’epo humaine recombinante dans les fluides biologiques equins par lc-ms/ms.

Patrice Garcia1, Ludovic Bailly-Chouriberry1, Maria Lönnberg2, Florence Cormant1, Marie-Agnès Popot1, Yves Bonnaire1

1 Laboratoire des Courses Hippiques (LCH), 15 rue de Paradis, 91370 Verrières le Buisson, France2 Dept. of Physical and Analytical Chemistry, Uppsala University, PO Box 599, SE-751 24 Uppsala, Suède

Contact: Patrice Garcia ([email protected])Keywords: Ionic mobility

L’érythropoïétine humaine recombinante (rHuEPO) est une glycoprotéine de 30-34 kDa interdite d’utilisation par le Code des Courses. Cependant depuis quelques années, des cas de dopage avérés ont été observés chez le cheval aux USA et en Europe, mais aussi dernièrement chez le dromadaire. De nombreuses méthodes pour différencier l’EPO équine endogène de l’EPO humaine recombinante ont été développées aussi bien en LC-MS/MS qu’en western-blot (double-blotting, WADA). Toutefois, le temps de détection est relativement court (48h) et le screening réalisé par ELISA reste perfectible.Afin d’améliorer ce temps de détection des rHuEPOs dans le plasma et l’urine équine, une colonne monolithe greffée avec des anticorps monoclonaux anti-EPO a été évaluée pour la préparation des échantillons. Cette nouvelle technologie, combinée avec l’affinité de l’EPO pour la lectine (MAIIA : Menbrane-Assisted Isoform ImmunoAssay) et analysée par un scanner haute résolution, a été utilisée pour le dépistage de l’EPO dans des échantillons plasmatiques et urinaires provenant de chevaux ayant reçu des traitements soit d’EPREX®, soit d’ARANESP®.En parallèle, une méthode de purification basée exclusivement sur l’utilisation de la colonne monolithe anti-EPO et couplée à la spectrométrie de masse a été développée dans le but de confirmer la présence des rHuEPOs dans les différents milieux étudiés, via la détection de certains peptides caractéristiques. L’introduction de la mobilité ionique au travers du système FAIMS (high-Field Asymmetric Waveform Ion Mobility Spectrometry, ThermoFisherScientific) au couplage LC-MS/MS a permis d’augmenter la sélectivité des peptides et ainsi la sensibilité de notre méthode de détection.Cette nouvelle combinaison analytique permet ainsi de confirmer la présence de rHuEPOs en un seul jour avec une limite de détection de l’ordre de 100 pg/mL. La méthodologie et les résultats obtenus seront présentés pour illustrer l’apport de ce nouveau développement pour le contrôle antidopage des chevaux.


[O35] L’apport de la spectrométrie de masse haute-résolution à l’obtention d’empreintes moléculaires d'échantillons d’urine. Applications potentielles au dopage.

Agnéta Kiss1, Aurélie Fildier1, Marianna Lucio3, Corine Buisson2, Marie-Magdeleine Flament-Waton1, Philippe Schmitt-Kopplin 3, Cécile Cren-Olivé1

1 ISA UMR 5280, Service Central d'Analyse (SCA), Chemin du Canal, Echangeur de Solaize, 69390 Solaize2 Agence Française de Lutte contre le Dopage (AFLD), Département des analyses, 143, avenue Roger Salengro, 92290 Châtenay-Malabry3 Helmholtz Zentrum München, German Research Center for Environmental Health , Ingolstaedter Landstrasse 1 , 85764 Neuherberg

Contact: Agnéta Kiss ([email protected])Keywords: High mass and high resolution mass Spectrometry

L'amplitude et l'évolution du dopage demande le développement de techniques de détection (screening) plus rapides et plus fiables. Une des principales difficultés des laboratoires de contrôle est l'émergence continue des substances et des méthodes dopantes. Les nouveaux composés présentent les mêmes propriétés dopantes, mais leur structure est légèrement modifiée et, par conséquent, ils ne peuvent pas être détectés par les moyens classiques. Afin de relever ce défi, nous avons choisi une approche métabonomique. Contrairement aux méthodes utilisées à l'heure actuelle, cette approche n'est pas axée sur la détection des substances illicites, mais sur leurs effets sur le métabolisme de l'athlète. Plus précisément, cette étude vise à mettre en évidence des différences d’ordre métabolique entre différents groupes d’individus tels que : des athlètes non-dopés, des athlètes dopés, des volontaires, etc. La stratégie choisie comprend cinq étapes, à savoir : le choix des échantillons, l’obtention des empreintes moléculaires, le traitement statistique des données, la sélection de biomarqueurs potentiels et l’identification de ces derniers. L’urine est une matrice extrêmement complexe contenant un nombre impressionnant de métabolites avec des propriétés chimiques et des concentrations très variables. De ce fait, après une étude de faisabilité réalisée sur une plateforme LC-Q-TOF, l’étude a été orientée vers la spectrométrie de masse de très haute résolution FT-ICR. Cette étude a été réalisée sur une cohorte de 50 échantillons d’urine dont 30 échantillons ont été testés positifs (glucocorticoïdes et béta-2-Agonistes) par l’AFLD; et 20 forment le groupe des contrôles (athlètes non dopés et volontaires). Les échantillons ont été analysés dans une même séquence sur un spectromètre de masse FT-ICR en mode positif et négatif. Les empreintes moléculaires ainsi obtenues ont été ensuite traitées par analyse multivariée (APC et OPLS-DA) dans le but de classifier les échantillons et mettre en évidence des profils discriminants. La précision de mesure (< 1 ppm) ainsi que la sensibilité de la technique utilisée ont conduit à l’obtention d’empreintes moléculaires riches en information et très qualitatives. Ainsi, plusieurs composés ayant des profils potentiellement discriminants ont été sélectionnés. Ensuite, en utilisant un générateur de formules brutes et la plateforme MassTrix qui regroupe plusieurs bases de données une vision globale de la classification des échantillons a été obtenue. La comparaison des signatures urinaires a montré que la métabonomique pourrait être un outil complémentaire pour obtenir des informations et des profils riches à partir de l’urine. De plus, l’étape de préparation d’échantillon minimale (dilution) et le temps d’analyse très court font d’elle une technique adaptée à l’analyse des grandes cohortes d’échantillons, notamment dans des études cliniques.


[O36] Nouveaux algorithmes de regroupement pour gérer l'identification des protéines ou de modifications post-traductionnelles dans les analyses de protéomique à haut débit

Benoit Valot1, Olivier Langella1, Ludovic Bonhomme1, Michel Zivy1

1 PAPPSO, UMR de Génétique Végétale, Ferme du Moulon, 91190 Gif sur Yvette

Contact: Benoit Valot ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics

L'identification des protéines par les moteurs de recherche est une étape nécessaire aux analyses de protéomique "bottom-up" à haut débit. Elle est basée sur l'identification des peptides et sur leur assemblage le long des séquences protéiques. En général les moteurs de recherche se limitent au classement des protéines identifiées par ordre de score ou de probabilité. Lorsque plusieurs protéines contiennent des peptides identiques, un post-traitement est nécessaire pour lever les ambiguïtés. Classiquement il est basé sur l'élimination par regroupement des protéines identifiées uniquement par des peptides communs à d'autres protéines. Mais cela ne suffit pas pour gérer les cas d'intersections entre groupes de peptides communs. Nous présentons ici un algorithme original basé sur un deuxième niveau de regroupement, qui réunit les protéines contenant au moins un peptide en commun. Il permet de détecter des protéines redondantes non éliminées par le premier regroupement, de connaître précisément le nombre de peptides communs et spécifiques à chaque protéine et d'estimer le nombre d'isoformes identifiées dans l'échantillon. Par ailleurs nous avons vérifié qu'à de rares exceptions près, ce niveau de classement regroupe les protéines par fonction. Nous présenterons un cas extrême d'utilisation avec une analyse de métaprotéomique bactérienne.

Les recherches systématiques de modifications post-traductionnelles conduisent souvent à une incertitude de position quand plusieurs résidus susceptibles d'être modifiés sont proches dans la séquence. En général, les moteurs de recherche proposent les positions les plus probables en analysant séparément chaque spectre, ce qui conduit parfois à des résultats contradictoires pour un même site suivant le spectre analysé.Nous présentons ici un algorithme innovant qui regroupe l'ensemble des spectres MS/MS identifiant une modification sur des résidus voisins, de manière à tenir compte de l'ensemble des spectres simultanément pour lever l'incertitude de position. Ceci permet de dénombrer correctement les sites modifiés et les protéines qui les contiennent. Nous présenterons un exemple d'utilisation sur une analyse du phosphoprotéome du maïs.

Ces deux algorithmes ont été implémentés dans le logiciel X!Tandem Pipeline utilisant le moteur de recherche X!tandem. Il est disponible gratuitement à http://pappso.inra.fr/bioinfo/xtandempipeline/ et distribué sous licence GPL.

Link: http://pappso.inra.fr/


[O37] Post Translational Modifications and Pathogenesis of Bacterial Meningitis Is a «one shot» Approach for Complete Mapping Realistic?

Joseph Gault1, Christian Malosse1, Jean-Michel Camadro2, Guillaume Duménil3, Julia Chamot-Rooke1

1 CNRS UMR 7651 DCMR, École Polytechnique, 91128 Palaiseau, France2 CNRS UMR 7592, Institut Jacques Monod, Université Paris-Diderot, 75013 Paris, France3 INSERM U970, Paris Cardiovascular Research Center, 75015 Paris, France

Contact: Joseph Gault ([email protected])Keywords: Systems biology

Post translational modifications (PTM’s) are increasingly being revealed as key intermediates in pathogenesis pathways1-3. Understanding their role on the molecular level not only greatly increases our comprehension of disease mechanisms but provides an essential basis onto which human intervention strategies can eventually be built. Detection and localisation of PTM is not an easy task and mass spectrometry, which is a fast and sensitive analytical tool, is often implicated somewhere in the process.In recent work we identified an important PTM on the type IV pili of Neisseria meningitidis. Pili are extracellular, filamentous organelles implicated in a variety of life processes including bacterial aggregation and host cell attachment. The pilus itself is a macro polymer built up of the repeating 17.5kDa protein unit pilE, which is arranged helically to create long and flexible fibres. The glycerophosphate modification, present on serine 93 of this protein, is induced in vivo after several hours of host cell contact. We hypothesise that subsequent alteration of the pilus surface, once modified by the phosphoester, ultimately leads to the dissemination of the bacterium; a step that forcibly precedes invasive infection4. In this work a combination of top-down and bottom-up methods were used for structural characterisation of pilE and to localise the modifications of interest. However, an effective top-down approach for localisation of all PTM’s had at that time not been developed.Here we present top-down results using both Orbitrap and FT-ICR mass spectrometers and a variety of fragmentation methods, ECD, ETD, CAD, HCAD, IRPMD and combinations thereof, for the localisation of the 5 modifications present on this protein. Unusually we also present comprehensive profiling of several of these fragmentation techniques performed on the pilE protein itself.Aspects of the techniques, fragmentation mechanisms and applicability to other systems will be discussed along with the major implications of a «one shot» approach to understanding bacterial dissemination.1S. Subramaniam et al., Science, 324, 1327-1330 (2009)

2A. Oueslati et al., Progress in Brain Research, 183, 115-145 (2010)

3J.K. Kimet al., Molecular & Cellular Proteomics, 2, 7, 453-62 (2003)

4J.Chamot-Rooke et al., Science, 331, 778-782 (2011)


[O38] Bladder Cancer Biomarker Candidates Discovery in a Multi-site Patients Cohort: a Label-free Quantitative Proteomics Study.

Magali Court1, Mourad Mellal1, Madalen Le Gorrec1, Yves Allory2, Núria Malats3, Christophe Bruley1, Elodie Duriez4, Bruno Domon4, Jérôme Garin1, Christophe D. Masselon1

1 Laboratoire d'Étude la Dynamique des Protéome, BGE, iRTSV, 17 rue des Martyrs, 38054 Grenoble Cedex - France2 APHP – Hôpital Henri Mondor, , Créteil - France3 CNIO, , Madrid - Spain4 CRP Santé , , Luxembourg - Luxembourg

Contact: Christophe D. Masselon ([email protected])Keywords: Clinical proteomics, Proteins, peptides and small molecules quantification

Protein biomarkers discovery of renal or urinary tract diseases in human urine has recently garnered tremendous interest. This fluid represents an ideal diagnostic analyte for bladder cancer, since the tumor is literally bathed in urine. The EU-FP7 funded DECanBio project aims at implementing a generic strategy for protein biomarker discovery and validation. Using «state of the art» MS instrumentation for quantitative proteins analysis, the primary objective is to provide a restricted number of urinary biomarkers; ultimately enabling the detection of bladder tumour recurrences. As a first step toward this goal, a label-free quantitative proteomics approach was used to compare urine protein profiles among a multi-site cohort consisting of 99 patients including various grades of bladder cancer, and age and sex matched controls.A label-free quantitative proteomics approach based on the Accurate Mass and Time (AMT) tag strategy has been pursued. This strategy allows the analysis of the many samples (tens to hundreds) required at the candidate discovery phase in a reasonable time-frame (a few weeks) while providing a broad proteome coverage and a suitable dynamic range of peptides quantification. A multi-site cohort (France and Spain) was collected according to guidelines developed within the context of the DECanBio project. Proteins were extracted using organic solvent precipitation and digested in-solution as described earlier (Court et al. Proteomics, in press). Samples were analyzed in triplicate and in random order on a Ultimate 3000 nano-HPLC system (Dionex) coupled to an LTQ-Orbitrap XL(Thermo) mass spectrometer.An AMT tag database was generated from >1200 LC-MS/MS analyses of bladder cancer incident, recurrent and control cases. This database constitutes an in-depth repository of all peptides previously detected in urine by our group and their corresponding proteins. It contains over 18,000 non-redundant peptide entries, representing more than 2,000 urinary proteins. In semi-quantitative LC-MS analyses, over 1,200 proteins were monitored and quantified over the discovery cohort. The peptides detected spanned a relative abundance range of more than 4 orders of magnitude. To extract lists of differentially abundant proteins between the cohort’s sub-populations, two different statistical analysis methods were applied: a modified version of the so-called Spectral Index (SpI) approach and a mixed effects ANOVA. The comparison of healthy versus cancer samples by the two methods resulted in a restricted list of proteins common to both approaches. These proteins are being reviewed using bioinformatics approaches to determine the final list of candidates, which will be evaluated on a different cohort during the subsequent phase of the DECanBio project using absolute quantification by LC-SRM.


Posters


[P1] Effects of metallic nanoparticles on murine macrophages

Sarah Triboulet1, Catherine Aude-Garcia1, Véronique Collin-Faure1, Dévy Diallo1, Hélène Diemer2, Alain Van Dorsselaer2, Thierry Rabilloud1

1 CEA/DSV/iRTSV, Laboratoire de Chimie et Biologie des Métaux, UMR CEA -Université Joseph Fourier-CNRS 5249, 17 rue des Martyrs , 38000 Grenoble, France2 IPHC, Institut Pluridisciplinaire Hubert Curien, UMR CNRS- Université de Strasbourg 7178, 23 rue du Loess, 67000 Strasbourg, France

Contact: Sarah Triboulet ([email protected])Keywords: Systems biology

Metallic nanoparticles are more and more widely used for consumer products, such as cosmetics, as well as industrial processes. However, so far, few data are available on their potential impact on health and environment. To improve our knowledge and better assess the risks of toxicity, it is necessary to study cellular responses to these particles. As one of the most active scavenger cell type, macrophages appear as a pertinent model to evaluate nanoparticles toxicity. The aim of this study was to analyse the effects of several metallic nanoparticles (Cu, CuO, and ZnO) on the proteome of J774A.1 and RAW264.7 murine macrophage cell lines. The effects were compared to that of the corresponding ions when available (Cu2+, Zn2+). Proteomic analyses were conducted by two-dimensional gel electrophoresis (2-DE) followed by mass spectrometry. Targeted assays and functional analysis tests, such as glutathione levels, inflammatory mediators and phagocytosis assays, were also performed to confirm and validate the data. Our results showed that Cu and CuO nanoparticles show toxicity at rather low dosages (5-15 μg/ml) and inhibit phagocytosis. Analyses of total proteome changes showed changes in proteins involved in oxidative stress (glutamatecysteine-ligase, ferritin…) signal transduction, and translation machinery.Our results demonstrated that the chemical nature of the particles was the essential factor, but that within the same family, the size and shapes were also important parameters. Although more research needs to be done, these data are essential to a better and safer use of the concerned nanoparticles.

Link: http://www-dsv.cea.fr/dsv/instituts/institut-de-recherches-en-technologies-et-sciences-pour-le-vivant-irtsv


[P2] Apport d’une nouvelle technique de détection et de quantification des anticorps néo-synthétisés par le nouveau-né

Célia Dechavanne1, François Guillonneau2, Laïla Sago2, Virginie Salnot2, Evelyne Guitard3, Philippe Chafey4, Marie-Paule Lefranc5, Jean-Michel Dugoujon3, Patrick Mayeux2, Florence Migot-Nabias1

1 Institut de Recherche pour le Développement, UMR 216 Mère et enfant face aux infections tropicales, Faculté de Pharmacie, Université Paris Descartes, 4 avenue de l’Observatoire, 75006 Paris, France2 Plate-forme protéomique de l’Université Paris Descartes, 22 rue Méchain, 75014 Paris, France3 Laboratoire d'Anthropologie Moléculaire et Imagerie de Synthèse, UMR 5288, Université Paul Sabatier Toulouse III, 37 allées Jules-Guesde, 31073 Toulouse, France4 Institut Cochin, Inserm U1016, 22 rue Méchain, 75014 Paris, France5 Laboratoire d’ImmunoGénétique Moléculaire, Université Montpellier 2, UPR CNRS 1142, Institut de Génétique Humaine, 141, rue de la Cardonille , 34396 Montpellier Cedex 5, France

Contact: Célia Dechavanne ([email protected])Keywords: Proteins, peptides and small molecules quantification , Clinical proteomics

Cette étude permet pour la première fois de détecter et de mesurer les anticorps néo-synthétisés par le nouveau-né en les distinguant des anticorps maternels transmis in utero. La méthode proposée utilise des caractéristiques individuelles des immunoglobulines G3 (IgG3) liées au polymorphisme des allotypes G3m situés sur les domaines constants des chaînes lourdes. Plusieurs peptides protéotypiques ont été identifiés. Des expériences préliminaires ont été effectuées sur du plasma d'adulte dont les allotypes G3m ont été déterminés par la méthode qualitative de référence d’immuno-hématologie. Les IgG3 totales ont été purifiées par chromatographie d'affinité puis digérées en gel ou en solution par une combinaison de protéases. Les peptides obtenus ont été détectés par spectrométrie de masse (Maldi TOF-TOF, Orbitrap). La sensibilité de la méthode a été vérifiée à l’aide de ratios volumiques d’échantillons plasmatiques de 2 adultes homozygotes pour des polymorphismes d’allotypes distincts. Une approche « label free » a fourni une information semi-quantitative qui sera appliquée sur des IgG3 totales purifiées à partir d’échantillons plasmatiques d'une mère et de son enfant prélevé trimestriellement de la naissance à 9 mois. La quantification ultérieure des IgG spécifiques de nouveau-nés apportera des connaissances importantes sur l'acquisition de l’immunité et sera un précieux outil de diagnostic indirect pour certaines maladies à transmission verticale.


[P3] Dialogue moléculaire dans la symbiose mycorhizienne

Virginie Puech Pagès1, Véréna Poinsot3, Jean Denarié2, Jean Charles Portais4, Guillaume Bécard1

1 LRSV, 24 Ch Borde Rouge, 31326 Castanet Tolosan2 LIPM, 24 Ch Borde Rouge, 31326 Castanet Tolosan3 IMRCP, 118 r de Nabonne, 31062 Toulouse4 ISBP, INSA, 31400 Toulouse

Contact: Virginie Puech Pagès ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Vivant en symbiose avec une grande majorité des plantes terrestres, les champignons mycorhiziens à arbuscules (MA) constituent un enjeu pour les applications en agriculture durable. L’enjeu agronomique repose sur l’exploitation de leur aptitude symbiotique à transférer de l’eau et des sels minéraux à la plante partenaire, à améliorer les défenses de la plante contre les pathogènes, pour finalement limiter les besoins d’irrigation et d’intrants chimiques dans les productions végétales (engrais et pesticides).Depuis plusieurs années, l’équipe de G. Bécard s’intéresse aux mécanismes de reconnaissance des deux partenaires dans l’étape pré-symbiotique. Dans un premier temps, nous avons réalisé la caractérisation des molécules végétales permettant l’activation du champignon mycorhizien, les strigolactones (Besserer et al, PLoS Biol, 2006, Gomez et al, Nature, 2008), via une collaboration avec l’équipe de JC Portais (INSA). Dans un second temps, nous avons caractérisé les molécules fongiques activant la plante, les facteurs Mycs LCOs (Maillet el al, Nature, 2011), via une collaboration avec les équipes de J Dénarié (LIPM) et V. Poinsot (IMRCP). Ces molécules ont été caractérisées et quantifiées par spectrométrie de masse, LC-Q-TOF (ITAV) et LC-Q TRAP (plateforme Metatoul). Nous essayons maintenant de comprendre leur production et régulation et de chercher d’autres molécules actives.


[P4] Caractérisation des RCPGs par spectrométrie de masse : les apports d’une approche multi-enzymatique

Noelle POTIER1, Lauriane KUHN3, Mélanie LEBRETON1, Celine CUNY2, Olivier BORNERT2, Fatima ALKHALFIOUI2, Emmanuelle LEIZE1, Renaud WAGNER2

1 Laboratoire de Dynamique et Structure Moléculaire par spectrométrie de masse, Institut de Chimie de Strasbourg, 1 rue B. Pascal, 67008 Strasbourg2 Institut de Recherche de l'Ecole de Biotechnologie de Strasbourg, boulevard Sebastien Brant, 67412 Illkirch3 Plateforme Protéomique de l'Esplanade, IBMC, 15 rue Descartes, 67084 Strasbourg

Contact: Noelle POTIER ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Les stratégies d’analyse protéomique classiquement utilisées pour l’étude de Protéines Membranaires (PM) (« shotgun » ou gel 1D) conduisent souvent à l’identification de protéines cibles, mais le faible taux de recouvrement de séquence lié au faible nombre de peptides générés ne permet pas une caractérisation complète. A l’aide d’un système modèle, les Récepteurs Couplés aux Protéines G (RCPG) produits et purifiés à partir d’un système levure recombinant, nous avons développé un protocole visant à l’obtention d’un recouvrement de séquence maximal, nécessaire à la mise en évidence de modifications post-traductionnelles ou d’isoformes. Ce protocole, appliqué sur 5 RCPGs, est basé sur la fusion des résultats obtenus par l’action de trois agents de digestion sur une même bande de gel 1D : un agent de digestion spécifique (trypsine), un agent de digestion peu spécifique (chymotrypsine), un agent de digestion chimique (CNBr). Alors qu’ils partagent une même structure à 7 domaines transmembranaires, les taux de recouvrement de séquence obtenus sur nos 5 RCPGs après une digestion in-gel à la trypsine se sont avérés très variables en fonction du récepteur considéré et cela quelles que soient les conditions d’extraction des peptides (présence de détergent, concentration élevée en acide). En revanche, l’utilisation de la chymotrypsine et des doubles digestions CNBr/trypsine s’est révélée très utile en permettant (i) de valider l’exactitude de certains domaines grâce à la détection de peptides dont les séquences se chevauchent partiellement, (ii) d’augmenter significativement le taux de recouvrement de séquence grâce à l’hydrolyse de plusieurs domaines transmembranaires et (iii) d’identifier des domaines possédant des modifications post-traductionnelles. Des taux de recouvrement de séquence pouvant aller jusqu’à 80% dans le cas du récepteur Purinergic P2RY1 nous ont permis de mettre en évidence la présence d’une N-glycosylation sur l’extrémité N-terminale. L’action d’endoglycosidases, suivie par MALDI, a montré que les deux asparagines N11 et N27 sont modifiées par une structure de type « high mannose ». Dans tous les cas, la complémentarité des masses mesurées par MALDI et par nanoLC-MS/MS a été exploitée.

Link: http://www-chimie.u-strasbg.fr/ldsm2


[P5] Characterization of the interaction of frataxin with the de novo iron sulfur biosynthesis complex ISCU/NFS1/ISD11

Adeline PAGE1, Stéphane Schmucker2, Alain Martelli2, Florent Colin2, Marie Wattenhofer-Donzé2, Laurence Reutenauer2, Hélène Puccio2

1 Proteomic Platform, IGBMC, 1, rue laurent Fries, 67404 Illkirch, France2 Department of Translational Medecine and Neurogenetics; Chaire de génétique Humaine, Collège de France, 1, rue laurent Fries, 67404 Illkirch, France3 IGBMC, UMR CNRS 7104, Inserm U596, University of Strasbourg, 1, rue laurent Fries, 67404 Illkirch, France

Contact: Adeline PAGE ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

Human Frataxin, the mitochondrial protein deficient in Friedreich ataxia (FRDA), a rare autosomal recessive neurodegenerative disease associated with hypertophic cardiomyopthy, is thought to be involved in multiple iron-dependent mitochondrial pathways. In particular, frataxin plays an important role in the formation of iron-sulfur (Fe-S) clusters biogenesis. In this study, we show data providing new insights into the interaction of mammalian frataxin with component of the Fe-S cluster assembly machinery. Different mass spectrometry analyses were realized to determine first the interacting partners of human frataxin and then the molecular weight of the frataxin-containing complexes.The interacting partners of human frataxin were identified by coupling immunoprecipitation (IP) with nanoLC-nanoESI-MS/MS analysis. IP was performed from HeLa mitochondrial extracts expressing a recombinant human frataxin with C-terminal flag epitope (hFXN-Flag). Three common proteins (ISCU, NFS1 and ISD11) were identified by mass spectrometry from two independent experiments to specifically co-immunoprecipited with hFXN-Flag. These data indicate that the main endogenous interactors of frataxin are ISCU, NFS1 and ISD11, three components of the core Fe-S assembly complex.By co-expression of murine proteins in bacteria, we were able to isolate a quaternary complex containing mFXN, mISCU, mNFS1 and mISD11. The molecular weight of the quaternary complex was determined by native electrospray mass spectrometry analysis. For that, two complexes, GST-mFXN/mISCU/HIS-mNFS1/mISD11 and mFXN-HIS/mISCU/mNFS1/mISD11, were purified by gel filtration and analysed by MS. Molecular weights of 237 kDa and 190 kDa were deduced for the GST-mFXN/mISCU/HIS-mNFS1/mISD11 and mFXN-HIS/mISCU/mNFS1/mISD11 complexes respectively.These results suggest that the interaction of frataxin with the ISCU/NFS1/ISD11 complex most likely defines a function of frataxin in the early steps of de novo Fe-S cluster biosynthesis and provide new elements, important for further understanding this crucial biological process. The perspectives of this work are to obtain the 3D-structure of the quaternary complex by X-ray crystallography and to determine the exact function of frataxin in the complex. Supplemental mass spectrometry analysis will allow us to analyse the different biochemical states of the de novo biosynthesis complexes (presence of iron and sulfur) occurring upon frataxin association with the ISCU/NFS1/ISD11 complex. In addition, interactors identification by IP coupled to mass spectrometry and biochemical characterization of isolated complexes will be performed on other components of the Fe-S cluster biosynthesis machinery to better understand molecular events involved in Fe-S biogenesis.Link: http://www.igbmc.fr/


[P6] ITRAQ: a method to elucidate cellular responses to Zearalenone mycotoxin.

Amel Chatti Gazzah1, Luc Camoin2, Salwa Abid1, Moncef Ladjimi3, Hassen Bacha1

1 Laboratory of Research on Biologically Compatible Compounds, Faculty of Dentistry, Rue Avicenne, 5000 Monastir , Tunisia2 Inserm,U891, CRCM, Marseille Protéomique, , , F-13009 Marseille, France3 Laboratory of Genetic and Cellular Biology, CNRS, UMR 8159, Versailles St-Quentin University, 45 Avenue des Etats-Unis ,, 78045 Versailles 78035, France.

Contact: Amel Chatti Gazzah ([email protected])Keywords: Proteins, peptides and small molecules quantification

Zearalenone (ZEN) is a secondary metabolite produced by some Fusarium species that contaminate a large variety of grains and feedstuffs worldwide [1]. ZEN has been associated with a wide variety of adverse health effects including be hepatotoxic, hematologic, immunotoxic and genotoxic. In order to better understood the mechanism of ZEN toxicity. A proteomic approach was applied to characterize cellular responses of hepatocarcinoma cells (HepG2) to ZEN exposure. Protein extracts from cultured HepG2 cells treated with 100µM ZEN for 8 hours, as well as extracts from control cells. The screening method applied to compare proteome was based on the stable isotope approach isobaric tagging for relative and absolute quantification (iTRAQ). This study identified about 982 proteins among which identification and quantification of peptides and their corresponding proteins were accomplished by MALDI-TOF mass spectrometry (MS). Ingenuity Pathways Analysis (IPA) software was then used to determine the biological functions and canonical pathways associated with the ZEN-responsive proteins.


[P7] ANALYSE PAR IMAGERIES PAR SPECTROMETRIE DE MASSE TOF-SIMS et MALDI-TOF DE L’EFFET DU BUTYRATE D’ARGININE SUR LA COMPOSITION LIPIDIQUE DU MUSCLE CARDIAQUE DE SOURIS MODELES DE LA MYOPATHIE DE DUCHENNE

Béryl DONFACK1, Sara VIANELLO2, Claudia BICH1, David TOUBOUL1, Sabine DE LA PORTE2, Alain BRUNELLE1

1 Centre de Recherche de Gif, Institut de Chimie des Substances Naturelles, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette Cedex, France2 Centre de Recherche de Gif, Institut de Neurobiologie Alfred Fessard, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette Cedex, France

Contact: Claudia BICH ([email protected])Keywords: Imaging mass spectrometry

La myopathie de Duchenne est une maladie gonosomale caractérisée par une dégénérescence des tissus musculaires. L’atteinte du muscle cardiaque représente la première cause de mortalité chez les malades.Le butyrate d’arginine semble protéger le muscle cardiaque de cette dégénérescence lorsqu’il est administré vers l’âge de 6 semaines (début de l’atteinte cardiaque) chez les souris modèles mdx.Des colorations histologiques de cœurs de souris saines, de souris mdx ayant reçues une solution saline (mdx saline) et de souris mdx traitées par du butyrate d’arginine (mdx BA) montrent que les cœurs de ces dernières présentent des zones déstructurées moins importantes que les cœurs de souris mdx saline.Des études précédentesréalisées sur du muscle squelettique de souris avaient montré que le rapport (R1) entre les phospholipides PC34 :2 et PC34 :1 est supérieur à 1 dans le muscle sain (zones structurées) alors qu’il est inférieur à 1 dans les zones déstructurées des souris mdx.Cette inversion a été caractérisée par imagerie par spectrométrie de masse d’ions secondaires (TOF-SIMS) et par spectrométrie de masse de désorption/ionisation laser assistée par matrice (MALDI-MS) qui, couplées à un analyseur par temps de vol (TOF), sont des techniques de choix pour l’analyse en surface des lipides dans les tissus biologiques. Ces deux techniques ont été utiliséespour vérifierl’effet bénéfique du butyrate d’arginine sur les souris mdx et déterminer et localiser les lipides membranairesdans les cœurs de souris.Un traitement de BA (800 mg/kg/j), d’une durée de 7 semaines a été administré par voie intra-péritonéale à des souris âgées de 6 semaines (présence de lésions légères dans le cœur).À14 semaines, les souris ont été sacrifiées, les cœurs ont été prélevés etcongelés. Des coupes consécutives d’épaisseur 16µm ont été réalisées à -20°C à l’aide d’un cryostat. Lesimages ioniques ont été obtenues grâce aux spectromètresTOF-SIMS (analyse directe de la coupe sans dépôt de matrice) et MALDI-TOF (après dépôt de matrice 9-aminoacridine pour le mode négatif et d’acide α-cyano-4-hydroxycinnamique pour le mode positif).La variation du rapport R1 entre les phospholipides PC34:2 et PC34:1 a été étudiéedans le cœur, un tissu qui ne régénère pas. Les résultats ont été comparés avec ceux obtenus dans le muscle squelettique. Des variations contraires à celles obtenues dans ce dernier ont été observées : dans les cœurs sains (tissus structuré), R1<1 et dans les cœurs mdx saline et BA (tissus déstructuré), R1>1. De plus,l’imagerie par spectrométrie de masse nous a permisd’identifierin situ lesions de lipides àm/z 772.6,m/z798.6,et le cholestérol, quisemblent être caractéristiques des zones déstructurées du cœur (souris mdx saline et BA).Ces résultats montrent que l’imagerie par spectrométrie de masse est un outil important pour l’étude in situ des variations lipidiques associés à une maladie dégénérative.


[P8] MALDI vs RSLC-ORBITRAP : Amélioration de l’identification de protéines de faible masse moléculaire issues de gels 2D

Cédric BROUSSARD1, Bastien LAUMAIN1, Virginie SALNOT1, François GUILLONNEAU1, Marjorie LEDUC1, Patrick MAYEUX1, Philippe CHAFEY2, Morgane LE GALL2, Guilhem CLARY2

1 3P5 (Plate-forme Protéomique de l'Université Paris-Descartes), 22 rue Méchain, 75014 PARIS2 E2D (Plate-forme d'Electrophorèse Bidimensionnelle de l'Institut Cochin), 22 rue Méchain, 75014 PARIS

Contact: Cédric BROUSSARD ([email protected])Keywords: Instrumentation, Separative analysis methods, High mass and high resolution mass Spectrometry

Une des activités principales de la plate-forme Protéomique 3P5 est l’identification par MALDI-MS/MS de digests trypsiques de protéines issues de gels 2D. De manière récurrente, le rendement d’identification des protéines par cette technique chute considérablement pour des protéines au-dessous de 20kDa. Nous avons donc choisi d’analyser ces digests à la fois par MALDI MS/MS et LC-ESI-MS/MS pour orienter cette catégorie de protéines vers une autre méthode analytique.Les protéines inférieures à 20kDa issues de gels 2D et colorées au bleu de Coomassie colloïdal ont été digérées par la trypsine à l’aide d’un automate. Les peptides extraits ont été ensuite analysés parallèlement sur MALDI-TOF-TOF et sur un système RSLC/LTQ-Orbitrap-Velos avec un programme « gradient rapide » permis par la RSLC. En effet, l’emploi de la RSLC avec une colonne C18 de faible granulométrie (taille des particules 2µm avec un diamètre des pores de 100Å) permet par comparaison avec une nano-HPLC classique (3µm/100Å) de travailler à des débits et des pressions supérieurs tout en améliorant la résolution chromatographique et donc l’intensité du signal.Les interrogations effectuées sur le serveur local Mascot® de 3P5 révèlent une augmentation du rendement moyen des identifications de 20% par le MALDI à plus de 90% par l’Orbitrap avec dans plus d’un cas sur deux, plusieurs protéines identifiées par spot. Une analyse RSLC-MALDI MS/MS est en cours de développement afin de permettre une comparaison plus équilibrée entre les deux spectromètres.


[P9] Identification de protéines de radiosensibilité dans les lymphocytes T par LC-MS/MS : application au cancer du sein

Jérôme Lacombe2, Alain Mangé1, Jérôme Solassol1, André Pélegrin2, David Azria2

1 Laboratoire de biostatistique, d'épidémiologie et de recherche clinique, IURC, EA2415, Université Montpellier 1, 641 avenue du doyen Giraud, 34093 Montpellier, France2 Laboratoire d'immunociblage et radiobiologie en oncologie, IRCM, INSERM, U896, 208 rue des apothicaires, 34298 Montpellier, France

Contact: Jérôme Lacombe ([email protected])Keywords: Clinical proteomics, Proteins, peptides and small molecules quantification

L’efficacité du traitement radiothérapeutique en cancérologie est principalement déterminée par la dose totale délivrée sur le foyer tumoral. Cette dose est limitée par la tolérance des tissus sains associés au volume d’irradiation, laquelle peut provoquer des effets secondaires chez certains patients. En raison de son caractère irréversible et de son impact sur la qualité de vie, cette toxicité tardive est particulièrement surveillée. Plusieurs tests ont été développés afin de prédire d’éventuels effets tardifs et ceci afin d’adapter le traitement à chaque patient. Parmi ces tests, Ozsahin M. et al. ont démontré que le taux d’apoptose radio-induite (TALRI) des lymphocytes T CD8 est inversement corrélé au développement de complications radio-induites tardives de grade élevé. Toutefois, ce test souffre encore d’un nombre trop élevé de faux positifs pour être utilisé en clinique. L’objectif de notre travail est d’identifier et de caractériser un profil protéique spécifique pouvant être associé à l’apparition d’une toxicité tardive chez des patients irradiés. Pour cela, nous avons analysé par une approche de protéomique différentielle la réponse radio-induite de populations lymphocytaires (TCD4 et TCD8) issues de patientes ayant un TALRI bas et présentant ou non une toxicité tardive. Nous avons identifié un panel de 189 protéines différentiellement exprimées entre ces deux populations et susceptibles d’être impliquées dans différentes voies cellulaires associées à la toxicité radio-induite. La validation de ces marqueurs potentiels est en cours de réalisation.


[P10] Proteomic analysis of the 5-HT6 receptor complex: towards the identification of signaling pathways underlying its physiological functions.

Martial Séveno1, Julie Meffre2, Séverine Chaumont-Dubel2, Clotilde Mannoury La Cour3, Florence Loiseau 3, Joël Bockaert 2, Mark J Millan3, Philippe Marin2

1 Plate-forme de Protéomique Fonctionnelle (FPP), IGF, 141 rue de la cardonille, 34094 Montpellier2 Institut de Génomique Fonctionnelle (IGF), CNRS, INSERM, UMI-II, 141 rue de la cardonille, 34094 Montpellier3 Institut de Recherche Servier, 125 Chemin De Ronde, 78290 Croissy-Sur-Seine

Contact: Martial Séveno ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

The serotonin 6 (5-HT6) receptor is almost exclusively localized in the CNS, predominantly in regions involved in the regulation of cognitive processes such as the cerebral cortex, the hippocampus and the striatum. Correspondingly, it has become an increasingly promising target for the treatment of cognitive deficits associated with various CNS disorders such as schizophrenia. 5-HT6 receptors also participate in neuro-developmental processes, controlling the migration and normal positioning of cortical interneurons. Although 5-HT6 receptors are known to signal through Gs-adenylyl cyclase, coupling pathways and mechanisms controlling their activity remain poorly explored. To address these issues, we have recently used proteomic approaches associating co-immunoprecipitation or affinity chromatography experiments and high-resolution mass spectrometry, to identify novel signalling proteins associated with the receptor. Affinity-purified proteins were separated by SDS-PAGE and systematically digested by trypsin. Generated peptides were analyzed by NanoLC-MS/MS with a Fourier transform tandem mass spectrometer (LTQ Orbitrap XL). Protein identification was performed by using the Mascot algorithm. Management and validation of mass spectrometry data, allowing discrimination of specific receptor partners, were carried out using the web server myProMS v2.3 (Proteome Analysis using Mass Spectrometry, Institut Curie). These proteomic studies revealed interaction of the receptor with 28 specific partners of which several members of the mammalian target of rapamycin (mTOR) cascade. These include mTOR itself and Neurofibromin (Nf1), which are known to control synaptic plasticity, learning and memory formation. They also demonstrated association of the receptor with a network of proteins involved in the actin cytoskeleton dynamics, which is crucial for neurite growth, dendritic spine formation and neuronal migration. Functional studies demonstrated that stimulation of 5-HT6 receptor activated the mTOR pathway in various brain areas including the prefrontal cortex, the site of modulation of social memory by 5-HT6 ligands. Correspondingly, blocking the mTOR pathway by peripheral administration of rapamycin in rats prevented the cognitive deficit induced by the injection of 5-HT6 receptor agonist in various tests and in developmental models of schizophrenia. Our preliminary data also showed that expression of the 5-HT6 receptor in neuroblastoma cell lines (SH-SY5Y, NG108-15) induced drastic morphological changes usually associated with neuronal differentiation, which are mediated by some of the proteins identified as receptor partners by proteomics. This study highlights the power of proteomics screen to identify novel signalling pathways underlying the physiological functions engaged by transmembrane receptors and physiopathological processes.

Link: http://www.fpp.cnrs.fr/


[P11] Development of PSAQ-SRM assay for IGF-1 quantification in serum

Guillaume Picard1, Michel Jaquinod1, Jérôme Garin1, Christophe Bruley1, Virginie Brun1

1 Laboratoire d'Etude de la Dynamique des Protéomes, Unité de Biologie à Grande Echelle, CEA/INSERM/UJF 1038, 17, rue des Martyrs, 38054 cedex 9 Grenoble, France

Contact: Michel Jaquinod (michel,[email protected])Keywords: Clinical proteomics, Proteins, peptides and small molecules quantification

Insulin-like growth factor 1 (IGF-1) is a 7.7 kDa polypeptide hormone which mediates most effects of growth hormone. In the clinical laboratory, IGF-1 is commonly quantified in blood samples using antibody-based assays with radioactive detection (RIA, IRMA). In addition to the danger posed by radioactive isotopes, these assays lack reproducibility due to the low purity of the calibration standard and due to IGF-1 binding to its carrier proteins. Thus, technological developments for safe and reliable IGF-1 dosage are still required.In this study, we have developed a proteomic assay, based on the PSAQ method (Protein Standard Absolute Quantification) [Brun et al, Mol Cell Proteomics, 2007] and Selected Reaction Monitoring (SRM) analysis, to quantify IGF-1 in serum samples. First, we optimized the expression, isotope-labelling and purification of IGF-1 to serve as quantification standard (PSAQ standard). Then, using serum samples spiked with IGF-1 PSAQ standard, we assessed several prefractionation methods, including abundant protein depletion, for their capacity to enrich IGF-1. After prefractionation and digestion with trypsin, samples were analyzed using microLC-SRM. At last, IGF-1 titration was performed in healthy and artificially spiked serum samples to assess the performances of our PSAQ-SRM assay.In conclusion and according to our results, PSAQ-SRM assays hold great promise as surrogates to radioimmunoassays for the dosage of polypeptides hormones and related biosimilars.


[P12] Optimized systems for stable isotope-labelled protein expression

Dorothée Lebert2, Guillaume Picard1, Céline Huillet1, Nicolas Mouz2, Jérôme Garin1, Christophe Bruley1, Virginie Brun1

1 Laboratoire d'Etude de la Dynamique des Protéomes, Unité de Biologie à Grande Echelle, CEA/INSERM/UJF 1038, 17, rue des Martyrs, 38054 cedex 9 Grenoble, France2 Promise Advanced Proteomics, 7, parvis Louis Néel, 38040 cedex 9 Grenoble, France

Contact: Virginie Brun ([email protected])Keywords: Proteins, peptides and small molecules quantification

Absolute quantification of proteins in complex matrices relies on the use of isotope-dilution standards. Stable isotope-labelled peptides are widely used by the proteomics community but recently, the use of full-length stable isotope-labelled proteins (PSAQ standards) has demonstrated several specific advantages [Brun et al, J Proteomics, 2009]. In particular, as PSAQ standards and protein analytes behave similarly during prefractionation and digestion, a highly-accurate quantification can be obtained. In this study, we have optimized different expression systems for the high-yield synthesis and isotope-labelling of proteins. These expression systems include:1. An E. coli lysate for «cell-free» expression,2. An E. coli strain, auxotrophic for arginine and lysine biosynthesis.A target protein was expressed and labelled on arginine and lysine residues using these 2 optimized systems. After protein purification and trypsin digestion, isotope incorporation was checked using LC-SRM. Both systems allowed high-levels of protein expression and isotope incorporation (>99%). The relative costs for the production of this labelled protein were also calculated and compared. Presently, we are optimizing a HEK mammalian cell expression system which will allow the synthesis and isotope-labelling of glycosylated proteins.In conclusion, these optimized systems will allow us to adress the expression and isotope-labelling of a large panel of proteins with high success rates.


[P13] Analyse protéomique de la réponse anti-fongique du nématode Caenorhabditis elegans.

Matthieu Pophillat1, Patrick Fourquet1, Jonathan Ewbank1, Carole Couillault1

1 Centre d'Immunologie de Marseille Luminy U631, 163 avenue de Luminy case 906, 13288 Cedex 9 Marseille, France

Contact: Matthieu Pophillat ([email protected])Keywords: Systems biology

Lorsque le nématode Caenorhabditis elegans est infecté par le champignon nématophage Drechmeria coniospora, il est capable d’activer un système de défense inné qui permet la synthèse de peptides antimicrobiens (Coullault et al, 2004). La découverte de ces peptides et les voies de signalisation qui régulent leur expression ont principalement été mises en évidence par des approches de transcriptomique, de mutagénèse et d’ARN interférence (ex. Zugasti et Ewbank, 2009 ; Dierking et al, 2011). Pour trouver de nouveaux acteurs impliqués dans les défenses innées de C. elegans nous avons réalisé par 2D-DiGE une étude comparative des protéomes de C. elegans infectés ou non par D. coniospora. Travailler sur un organisme entier est complexe pour l’extraction qualitative et quantitative des protéines. Pour augmenter la sensibilité de nos résultats nous avons opté pour un fractionnement des extraits protéiques de nématode pour obtenir 3 fractions solubles et 1 non-soluble. Cela nous a permis d’identifier par MS au total 691 protéines dans les différentes fractions. Seulement 58 protéines ont été trouvées comme différentiellement représentées suite à l’infection. Leur caractérisation a permis une meilleure compréhension des défenses innées face à l’infection fongique.


[P14] Proteomic profiling of oil-bodies isolated from the unicellular green microalga Chlamydomonas reinhardtii: with focus on proteins involved in lipid metabolism

Mai Nguyen1, Mathieu Baudet2, Stéphan Cuiné1, Jean-Marc Adriano1, Damien Barthe2, Emmanuelle Billon1, Fred Beisson1, Myriam Ferro2, Yonghua Li-Beisson1

1 Laboratoire de bioénergétique et biotechnologie des bactéries et microalgues, SBVME,IBEB, DSV, CEA Cadarache, CEA Cadarache, 13108 Saint Paul lez Durance2 Laboratoire dEtude de la Dynamique des protéomes, BGE, iRTSV, CEA Grenoble, 17 rue des Martyrs, 38000 Grenoble

Contact: Mathieu Baudet ([email protected])Keywords: High mass and high resolution mass Spectrometry, Systems biology, Bioinformatics et biostatistics dedicated to proteomics

Oil-bodies are sites of energy and carbon storage in many organisms including microalgae. As a step toward understanding oil accumulation in algae, we used proteomics to analyze purified oil-bodies from the model microalga Chlamydomonas reinhardtii grown under nitrogen deprivation. Among the 248 proteins (≥2 peptides) identified by LC-MS/MS, 33 were putatively involved in the metabolism of lipids (mostly acyl-lipids and sterols). Compared to a recently reported Chlamydomonas oil-body proteome, 19 newly identified proteins of lipid metabolism were present, spanning the key steps of the triacylglycerol synthesis pathway and including a glycerol 3-phosphate acyltransferase (GPAT), a lysophosphatidic acid acyltransferase (LPAT) and a putative phospholipid:diacylglycerol acyltransferase (PDAT). In addition, proteins putatively involved in deacylation/reacylation, sterol synthesis, lipid signaling and lipid trafficking were found to be associated to the oil body fraction. This dataset thus provides evidence that Chlamydomonas oil-bodies are not only storage compartments but also are dynamic structures likely to be involved in processes such as oil synthesis, degradation and lipid homeostasis. The proteins identified here should provide useful targets for genetic studies aiming at increasing our understanding of triacyglycerol synthesis and the role of oil-bodies in microalgal cell functions.


[P15] Amino acid analysis based on isotope-dilution and high-resolution mass spectrometry for sensitive protein quantification

Mathilde Louwagie1, Sylvie Kieffer-Jaquinod1, Yohann Couté1, Michel Jaquinod1, Alain Dupuis1, Jérôme Garin1, Christophe Bruley1, Virginie Brun1

1 Laboratoire d'Etude de la Dynamique des Protéomes, Unité de Biologie à Grande Echelle, CEA/INSERM/UJF 1038, 17, rue des Martyrs, 38054 cedex 9 Grenoble, France

Contact: Mathilde Louwagie ([email protected])Keywords: Systems biology

Over the last decade, stable-isotope labelled standards (peptides or proteins) have been increasingly used for protein absolute quantification using mass spectrometry. High-quality standards are critical for reliable quantification experiments. Critical features include purity degree, isotope incorporation yield and accurate quantification. Presently, the reference method for standard quantification is amino acid analysis (AAA). AAA analyses are classically based on: (1) an acid hydrolysis of peptides or proteins into amino acids, (2) an amino acid separation using liquid or gas chromatography, (3) a fluorescence detection after amino acid derivatization which can be performed before or after chromatography (1). Traditional AAA analyses are time-consuming (>24h) and require significant amounts of material (around 100µg for a single protein quantification). Driven by important needs for the calibration of stable-isotope labelled protein standards (PSAQ standards), we have developed a new AAA assay avoiding both derivatization and chromatographic separation of amino acids. This method is based on a microwave-assisted hydrolysis followed by high-resolution mass spectrometry analysis of amino acids, including isotopically-labelled amino acids. Quantification is achieved by sample standardization with isotope-labelled amino acids or BSA standard spiked just before hydrolysis. Our method was evaluated for the calibration of isotopically-labelled proteins (PSAQ standards) and peptides (AQUA standards). Very sensitive (only 1µg of protein is needed per analysis), rapid and accurate, this method should be useful in several domains including biotechnology and quantitative proteomics.


[P16] Quantification of wheat allergens in complex matrices by mass spectrometry

Hélène Rogniaux1, Marion Hamon1, Audrey Geairon1, David Ropartz1, Sandra Denery-Papini1, Colette Larré1

1 INRA Unité BIA, Rue de la Géraudière, 44316 NANTES

Contact: Hélène Rogniaux ([email protected])Keywords: Proteins, peptides and small molecules quantification

Wheat is an important part of the daily diet of millions of people. Wheat products are consumed in various forms including many kinds and types of breads, cakes, pastas, pizzas and confectionary items. However, this staple food is also responsible for food allergies. Population-based studies indicate prevalence as high as 0.5% in children, on the basis of positive wheat challenge tests, and high prevalence of sensitization to wheat in adults (assessed by IgE). Hyper- sensitivity reactions to wheat flour occur both by inhalation (baker's asthma) and ingestion (food allergy and celiac disease), but may also develop by contact in some cases. Clinical symptoms can be severe, leading to anaphylaxis. Many wheat proteins have been reported as causative food allergens, including some prolamin-type gluten proteins and salt soluble proteins of the albumin/globulin (A/G) type. The objective of this work was to investigate the ability of mass spectrometry-based methods to quantify previously identified allergens, in complex fractions of wheat proteins. Advantage of these methods, compared to immune detection of allergens by ELISA assays, is that they enable the concomitant monitoring of several allergens within a same protein fraction. In addition, these methods can be used to quantitatively monitor proteins that undergo modifications, for instance in the course of an industrial process: this is clearly more tedious with antibodies, since modification can alter recognition of the epitope. The MS-based quantitative monitoring of wheat allergens was implemented onto a LTQ- Orbitrap Velos mass spectrometer. A MS/MS method, with quantification from the signal of both the parent and the fragments generated in the linear ion trap, was compared to quantification from the parent signal only, recorded in SIM mode (single ion monitoring) with a high resolution in the Orbitrap. Analytical performances (limit of detection, repeatability, standard deviation, sensitivity, etc.) and experimental difficulties encountered in this study are discussed. Quantification of serpin and alpha-amylase inhibitors, both proteins identified previously as major wheat allergens, could be successfully achieved at low level of abundance in complex grain proteins extracts.


[P17] Integration between environmental stress and growth in plants

Delphine Cast1, Milena Mozzo1, Christophe Robaglia1, Marie-Hélène Montané1, Benoît Menand1

1 Laboratoire de Genetique et Biophysique des Plantes, IBEB, UMR6191 CNRS-CEA-Université Aix Marseille, 163 avenue deLuminy, 13006 Marseille

Contact: Benoît Menand ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Our laboratory uses selected model plants like the vascular plant Arabidopsis thaliana and the bryophyte Physcomitrella patens to characterize molecular mechanisms that integrate environmental changes and plant growth, and to understand how they have evolved through land plant evolution. We are focusing our work on the eukaryotic TOR (Target Of Rapamycin) / S6 kinase signaling pathway. Those kinases are central regulators of eukaryotic growth in response to environmental stresses that integrates different environmental signals to control growth and development. TOR and S6K genes are conserved in all eukaryotes but little is known about their function in plants. We will present the recent advancements on our analysis of Physcomitrella patens S6K mutants made in our laboratory. Our results suggest a function of P. patens S6 kinases in the control of plant cell growth and proliferation in response to environmental stresses. We are know starting a proteomic approach to characterize the target of these kinases and to determine how those cell growth phenotypes are associated with essential cellular activities such are protein synthesis. We are particularly focusing our work on the proteomic analysis of ribosomes and translation initiation complexes.

Link: http://www.lgbp.univ-mrs.fr/rubrique.php3?id_rubrique=14


[P18] Etude de l’état d’oligomérisation de chimiokines induit par des glycosaminoglycanes par Electrophorèse Capillaire d’Affinité couplée à la Spectrométrie de Masse Electrospray (ACE-ESI-MS)

Mehdi Prull-Janssen1, Florence Gonnet1, Cédric Przybylski1, David Bonnaffé3, Yael Hersant3, Régis Daniel1

1 Université Evry-Val-d’Essonne, Laboratoire Analyse et Modélisation pour la Biologie et l’Environnement, bd F. Mitterrand, 91025 Evry, France2 CNRS, UMR 8587, Laboratoire Analyse et Modélisation pour la Biologie et l’Environnement, bd F. Mitterrand, 91025 Evry, France3 Université Paris Sud 11, ICMMO, Laboratoire de Chimie Organique Multifonctionnelle, rue G. Clémenceau, 91405 Orsay, France4 CNRS UMR 8182, ICMMO, Laboratoire de Chimie Organique Multifonctionnelle, rue G. Clémenceau, 91405 Orsay, France

Contact: Florence Gonnet ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Separative analysis methods, Systems biology

L’étude des interactions entre polysaccharides et protéines est d’un intérêt majeur en glycobiologie, puisque les complexes résultants sont impliqués dans des processus biologiques fondamentaux. L'identification d'un ligand glycosidique spécifique d’une protéine reste une tâche difficile en raison de l'immense diversité structurale des oligosaccharides. Afin de surmonter ces difficultés, nous avons mis en place le couplage en ligne de l'électrophorèse capillaire d’affinité (ACE) avec la spectrométrie de masse (MS) electrospray (ACE-ESI/MS). Ce couplage est un outil analytique puissant pour la caractérisation de complexes non-covalents entre les protéines et les glycosaminoglycanes (GAG) (1). La composante ACE permet (a) de caractériser l’interaction via les constantes de dissociations (Kd), et (b) d’isoler le ligand glycosidique. La composante ESI/MS permet de caractériser les stœchiométries des complexes non-covalents. Nous avons ainsi pu étudier l'effet d'oligosaccharides sulfatés de synthèse sur l’état d’oligomérisation de la chimiokine MCP-1 (Monocyte Chemoattractant Protein 1), ainsi que leur spécificité de liaison.Le caractère basique de MCP-1 (pI 9.74) a nécessité le greffage d’hydroxypropylcellulose (HPC) sur la paroi interne du capillaire afin de limiter l’adsorption de la protéine. Ce greffage est compatible avec la MS.Les interactions MCP-1/GAGs ont été étudiées en utilisant six tetrasaccharides et un hexasaccharide synthétiques d’héparine, variant par le nombre et la position des groupements sulfate. La migration électrophorétique de MCP-1 a été mesurée en présence de différentes concentrations d’oligosaccharides dans l’électrolyte, afin de déterminer les Kd des complexes. Tous les paramètres de couplage ont été optimisés pour préserver l’intégrité structurale des complexes non-covalents. Nos résultats montrent qu’en solution la chimiokine MCP-1 est monomérique. En revanche, en présence d’oligosaccharides sulfatés, nous observons l’oligomérisation de MCP-1, comme précédemment observé pour SDF-1 (3). En utilisant des GAGs synthétiques, l’ACE-ESI/MS a permis de mettre en évidence l’importance à la fois de la sulfatation (nombre et position des groupements sulfate) mais aussi de la taille de l’oligosaccharide sur le degré d’oligomérisation de MCP-1.

1- S. Fermas et al. Anal Chem, 2007, 79, 4987-49932- S. Fermas et al. Anal Biochem, 2008, 372, 258-2603- S. Fermas et al. Glycobiology, 2008, 18, 1054-1064

Link: http://www.lambe.univ-evry.fr/


[P19] Relative quantification of wax esters in complex lipid mixtures

Laetitia Fouillen1, Franziska Dittrich-Domergue1, René Lessire1, Fréderic Domergue1

1 Laboratoire de Biogenèse membranaire, Université Ségalen, CNRS, UMR 5200, 146, rue Léo Saignat, 33076 Bordeaux, France

Contact: Laetitia Fouillen ([email protected])Keywords: Proteins, peptides and small molecules quantification

Wax esters are very long hydrophobic molecules made of a fatty acid and a fatty alcohol. In plants they are a part of the cuticle, a protective layer covering all aerial parts. Wax esters are much more resistant to high temperatures and pressures than normal plant oils, so that they represent an interesting class of lipids for industry, in particular as lubricants. The goal of the ICON project is to generate plants that produce wax esters in seeds instead of classical triglycerides.

The biosynthesis of wax esters is a two steps pathway: first a Fatty Acid Reductase reduces a fatty acid (RCOOH) into an alcohol (RCH2OH); second, a Wax Ester Synthase esterifies another fatty acid (R’COOH) onto the alcohol to form the wax ester (RCH2OCOR’). We induced the production of wax ester in yeast by co-expressing the two enzymes. This model produces C30 to C36 wax esters.

The goal of the present study was to develop a sensitive and powerful method to quantify complex mixtures of wax esters. Wax esters are usually identified by GC-EI-MS. Nevertheless, multiple isobaric components are not separated chromatographically making quantification problematic. To avoid theses drawbacks and to quantify all components, we developed a LC-MS/MS method using a liquid chromatograph (Dionex) with reverse-phase column and QTrap mass spectrometer (Applied Biosystem). Data were acquired using MRM mode. A C42 synthetic wax ester was used as internal standard to allow quantification.

Preliminary results show that our LC-MS/MS method allows the identification and relative quantification of wax esters components with a better sensibility compared to GC-MS analysis. This method should allow us to analyze the different wax esters produced in plants


[P20] Tandem mass spectrometric analysis of a mixture of isobars using the survival yield technique.

Antony Memboeuf1, Laure Jullien1, Remi Lartia1, Bernard Brasme1, Yves Gimbert1

1 Departement de Chimie Moleculaire, 301 rue de la Chimie, 38041 Grenoble Cedex 9, France

Contact: Antony Memboeuf ([email protected])Keywords: Separative analysis methods, Proteins, peptides and small molecules quantification , Organic and inorganic mass spectrometry

There is a growing demand on mass spectrometric techniques for high-throughput analysis, to perform more reliably and provide more information on increasingly complex samples: the analysis of compounds in biological samples, in the field of petroleomics, to study isomers or simply for separating unresolved peaks due to technical limitations. With this respect, the identification and quantification of isobars remain challenging tasks for mass spectroscopists. The identification and, possibly, elimination of an isobar becomes essential in order to perform the structural analysis, ultimately to quantify, a compound of interest. This may require a tedious preparative work, coupling with chromatographic separation techniques or more recently ion mobility spectrometry, possibly combined with complex procedures. Collision Induced Dissociation tandem mass spectrometry experiments were performed to unequivocally separate compounds from an isobaric mixture of two products. The Survival Yield curve was obtained and, is shown to consist in a linear combination of the curves corresponding to the two components separately. For such a mixture, a plateau appears on the diagram in lieu of the continuous decrease expected allowing for the structural study of the two components separately. The width of the plateau critically relates to the fragmentation parameters of the two molecular ions, which need to be structurally sufficiently different for the plateau to be observed. However, at constant fragmentation parameters, we have observed the width significantly increases at large m/z. This makes the separation more and more efficient as isobars have larger m/z and the technique complementary to those applicable at low m/z only. We have observed the vertical position of the plateau relates linearly to the relative concentration of the two compounds that may be useful for quantification. Repeatability was estimated at 2% on a quadrupole ion trap. An advantage of using Survival Yield curves only, is that a priori knowledge of the respective fragmentation patterns of the two isobars becomes unnecessary. Consequently, similar performances are obtained if fragments are isobaric, which is also demonstrated in our study. Using this methodology, structural study and quantification of a compound of interest can be performed without the need for cleaning the sample from the isobaric contaminant.


[P21] Stratégies de préparation d’échantillon en ligne en vue de l’analyse rapide de composés pharmaceutiques et cliniques dans des matrices biologiques par chromatographie liquide couplé à la spectrométrie de masse (LC-MS/MS)

Emmanuel Bourgogne1, Olivier Laprévote2, Jean Louis Beaudeux2, Emmanuel Varesio1, Gérard Hopfgartner1

1 Groupe de Spectrométrie de masse du vivant, Ecole de Pharmacie, Université Genève, Université Lausanne, 20 Bd d’Yvoy, 1204 Genève, Suisse 2 Laboratoire de Toxicologie Biologique, Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, 2 rue Ambroise Paré, 75010 Paris, France 3 Laboratoire Chimie-Toxicologie Analytique et Cellulaire, EA 4463, Faculté des Sciences Pharmaceutiques et Biologiques, Université Paris Descartes, 4 avenue de L’Observatoire, 75006 Paris

Contact: Emmanuel Bourgogne ([email protected])Keywords: Proteins, peptides and small molecules quantification , Separative analysis methods

La nécessité d'élaborer des stratégies génériques pour cribler rapidement et/ou de quantifier de nombreux composés dans l’industrie pharmaceutique ou les laboratoires de toxicologie biologique demeure un défi. Aujourd’hui, les stratégies modernes de bioanalyse vont de la simple dilution à un prétraitement des échantillons complexes, comme l'extraction en ligne en phase solide (SPE) ou l'extraction liquide-liquide (LLE). Pour accélérer le développement de méthodes et leur validation, les approches génériques à injection directe de fluides biologiques sont hautement souhaitables. Le Prospekt 2, un dispositif de SPE en ligne, a été évalué comme un système polyvalent de commutation de colonne avec une dilution en ligne et des injections répétées sur la même cartouche de piégeage. Les objectifs de ce travail sont de présenter, à travers différents exemples, l'avantage d'utiliser le même matériel, le système Prospekt, comme un dispositif de préparation de l'échantillon soit en ligne, soit hors ligne. Sa flexibilité est mise en évidence lorsque la rétention sur le matériel de piégeage ou le transfert sur la colonne analytique est problématique, en utilisant respectivement une dilution en ligne pré-/ ou post-colonne de piégeage. Sa facilité d'utilisation pour changer les cartouches de différentes chimies complète les outils Prospekt pour faire face à tous les analytes pour le développement de méthode générique et la quantification de petites molécules dans les liquides biologiques. Enfin, dans le but d'améliorer le débit d’analyse lors du suivi thérapeutique médicamenteux (STM), la SPE en ligne couplée à une chromatographie liquide et un détecteur de masse de type trappe linéaire (LC-MS/MS) a été évaluée. Dans ce cadre du STM, une approche générique est ainsi proposée pour estimer la concentration de nombreux médicaments dans des échantillons biologiques. Cet appareil peut donc être utilisé comme un «one size fits all" instrument capable d'effectuer diverses stratégies en ligne ou hors ligne. Une stratégie adaptée sera choisie en fonction des propriétés physico-chimiques du composé d'intérêt, de la sensibilité de la méthode nécessaire ainsi que du débit d’analyse souhaité.


[P22] Stringent evaluation of several label free quantitative workflows using a complex protein standard and statistical analysis

Emmanuelle Mouton-Barbosa1, David Bouyssié1, Stéphanie Bolot1, Florence Roux-Dalvai1, Bernard Monsarrat1, Anne Gonzalez de Peredo1, Odile Burlet-Schiltz1

1 Institut de Pharmacologie et de Biologie Structurale, CNRS UMR5089, Université de Toulouse, 205, route de Narbonne, 31077 BP64182 Toulouse, France

Contact: Emmanuelle Mouton-Barbosa ([email protected])Keywords: Proteins, peptides and small molecules quantification , Bioinformatics et biostatistics dedicated to proteomics

To study differential protein expression in complex biological samples, strategies for rapid, highly reproducible and accurate quantification are necessary. Label free methods offer many advantages over isotopic labeling approaches: they are easy to use at the sample preparation step, cheaper, applicable to any type of samples, and they allow the comparison of a high number of conditions, opening the way to clinical studies. However, they also require complex bioinformatic MS data processing, such as peak picking, realignment, normalization, and peptide peaks matching across different nanoLC-MS runs.Many bioinformatic tools that have been developed in recent years for label-free quantification use peptide pattern-based methods, in which the software performs feature detection in LC-MS maps through analysis of the characteristic isotopic pattern of a peptide ion in the m/z dimension, and of its chromatographic elution peak in the retention time (RT) dimension, and links afterwards this quantitative measurement to a peptide identification. On the other hand, another approach is based on the reverse process, i.e. making use initially of peptide identification results to go back in the MS scans in order to extract peptide intensity values, using experimentally measured m/z and RT as a starting point to retrieve the associated extracted ion chromatograms (XIC) of this ion.Here we evaluated three label-free workflows for the quantitative analysis of highly complex protein mixtures, using both strategies: our in-house developed software MFPaQ [1-2], which starts from identification results, and two other label-free programs, LCprogenesis and MSInspect, that were used to generate LC-MS peptide maps. Our new in-house software Prosper allowed to integrate the quantitative data extracted with each tool, and to link these quantitative results with validated identified proteins.In order to perform an unambiguous evaluation of these quantitative workflows in the context of a real differential study, we used an equimolar mixture of 48 human proteins (Sigma UPS1), spiked at different concentrations into a lysate of SILAC-labeled U937 cells. Samples were run in triplicate on an LTQ VELOS-Orbitrap mass spectrometer, and statistical analysis was performed to identify differential peptides and proteins for theoretical fold variations of 2, 10 or 100 of the spiked standards. This experimental design allowed us to determine the number of true and false-positive (respectively UPS1 or U937 background proteins found as differential), and we present the performances of each workflow in terms of sensitivity, specificity, and accuracy.1- Bouyssie, D., et al Mol Cell Proteomics, 20072- Mouton-Barbosa, E., et al. Mol Cell Proteomics, 2010


[P23] ICM-MS and Top down analysis to characterize biomarker

Valérie Labas1, Grégoire Harichaux1, Chrystelle Derache3, Thierry Magallon2, Ana-Paula Teixeira-Gomes1, Maxime Coulon3, Anne-Christine Lalmanach3

1 INRA, Plate-forme d’Analyse Intégrative des Biomarqueurs, Centre de Recherches INRA de Tours, 37380 Nouzilly2 INRA, UMR INRA 85 Physiologie de la Reproduction et des Comportements – UMR CNRS 6175 – Université de Tours - IFCE, Centre de Recherches INRA de Tours, 37380 Nouzilly3 INRA, UR1282, Infectiologie Animale et Santé Publique, Centre de Recherches INRA de Tours, 37380 Nouzilly

Contact: Valérie Labas ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Separative analysis methods, Systems biology

Intact cell matrix-assisted laser desorption/ionization mass spectrometry (ICM-MS) is a well established differential and quantitative approach to display biomarkers on prokaryotic or eukaryotic cells. ICM-MS is a fast, reproducible and sensitive method for peptidomic and proteomic studies in 2-30 kDa mass range. However, by this approach the biomarker of interest remain to be identified. Here we demonstrate the application of ICM-MS profiling coupled to Top-down analysis to characterize three avian β-defensins : AvBD1, AvBD2 and a newly isolated β-defensin AvBD7. β-defensins are important components of chicken innate immunity in mucosal tissue, a major entry site for pathogens that may cause food poisoning. Chicken inbred lines diverge phenotypically with respect to levels of pathogens intestinal carriage and to level of gene expression of two β-defensin (AvBD1, AvBD2). In order to detect the known mature β-defensins and to discover other molecular species with a potential antimicrobial activity, ICM-MS was performed on intact heterophil granulocytes, which are known to infiltrate intestinal tissue early after pathogen colonization. The in silico predicted AvBD1 and AvBD2 sequences, taking into account the three characteristic β-defensins disulfide bonds, were compared to experimental peaks. Despite the lack of precision mass in linear MALDI-TOF spectra, two peaks may correspond to AvBD1 and AvBD2.To characterize finely molecular species observed on ICM-MS profile, we purified them by chromatography from bone marrow extract, in which defensin genes have been shown to be highly expressed and that contains the heterophils precursors. All size exclusion chromatography fractions were analysed by classic bottom-up proteomic in order to identify molecular species. AvBD1 and AVBD2 and a newly isolated AvBD7 were identified. To obtain structural information, a Top-down proteomic approach was applied on RP-HPLC purified intact molecular species. By a top-down MS strategy using nano-ESI–Q-TOF MS, the AvBDs were measured with a mass accuracy of 100 ppm. By comparison with the theoretical monoisotopic mass (with 3 disulfide bonds), bone marrow AvBD2 exhibited the expected mass but AVBD1 and AvBD7 presented respectively a delta mass = -1 Da and -17 Da. Through the top-down MS/MS strategy, we confirmed respectively the C and N terminal sequences for AvBD1 and AvBD7 and characterized post-translational modifications which correspond to an amidated C-terminal and to a Gln N-terminal cyclized as a pyroglutamic acid residue. In this study, a hybrid strategy combining «ICM-MS», «bottom-up» and «top-down» proteomic approaches enabled, for the first time, characterization of AvBD1, AvBD2, and AvBD7 as well as isoforms of these defensins. The use of complementary ICM-MS – Top-down technologies allowed us to follow these structures in their biological (or cellular) context.


[P24] Human cell-line phosphoproteome mapping using a dual-funnel ETD ion trap

Yann Hébert1, Chia-feng Tsa2, Pierre-Olivier Schmit1, Andrea Kiehne3

1 BRUKER, 34 rue de l'Industrie, 67166 WISSEMBOURG2 Institute of Biomedical Sciences, Taipei 115, TAIWAN, China3 Bruker Daltonik GmbH, Fahrenheit Strasse, Bremen, Germany

Contact: Yann Hébert ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Instrumentation

One of the essential regulatory mechanisms in eukaryotic cell is driven by the action of kinases. They affect the information flow through the signaling processes and consequently exert an influence on cells, tissues and organisms phenotype and functions.Altered regulations of these processes are observed in a variety of diseases, among which many cancers. Therefore, detecting, characterizing and ultimately quantifying the phosphoproteins altered in these pathologies is an important step towards a better understanding of the implicated processes.The low concentration level and ionization efficiencies of these compounds makes it difficult to analyze them directly by mass spectrometry while in mixture with other cellular proteins at their natural ratio We are presenting here the results obtained after human cell line IMAC phosphoprotein enrichment followed by an ESI CID/ETD Auto MSn experiment. The purpose was both to assay enrichment protocol efficiency and to check the ability of the LC-MS/MS ETD System to map reproducibly the phosphorylation sites. Three technical replicates have been analyzed, yielding the identification of 95 proteins, 88 of them being identified in each of the three runs. Among these, 93 are phosphoproteins and 87 of them, representing 220 phosphorylated peptides have been found in the three replicates. The high quality of the obtained CID and ETD spectra combined with the use of dedicated bio informatics has enabled to map efficiently the phosphorylation sites for most of these peptides. We are now ready to use this technique on a higher to proceed to a more systematic mapping of the phosphoproteins present in our sample.


[P25] UPLC-ESI-MS study of the oxidation markers released from tannin depolymerisation: toward a better control of the tannin evolution over wine production.

Laetitia Mouls1, Stéphanie Carrillo 1, Ana-Belén Bautista-Ortín1, Hélène Fulcrand1

1 Laboratoire Sciences pour l'œnologie UMR1083, INRA, Montpellier SupAgro, Université Montpellier 1, 2, place Pierre Viala, 34060 Montpellier, France

Contact: Laetitia Mouls ([email protected])Keywords: Organic and inorganic mass spectrometry

Among the numerous compounds occurring in wine, condensed tannins take an important part in the sensory quality of the wine; they are thus responsible for astringency, bitterness and contribute to colour as well. Tannins, also called proanthocyanidins, are very reactive biopolymers, specifically toward oxidation. The reaction takes place with dissolved oxygen and a catalyst (mainly oxidases in the course of wine making and metal ions over storage). Two reaction pathways were established1. The first one directly involves the phenolic compounds in the oxidation process. The other one involves other wine constituents such as ethanol and hydroxy-acids, yielding aldehydes that then react with tannins and anthocyanins. The resulting pigments have a positive impact in the wine colour while other oxidation products may lead to colloidal instability. Given the intrinsic complexity of tannin structures, their direct oxidation products have not been yet characterized. Their identification is still a challenge due to the heterogeneity of the polymerisation degrees within wine tannins which is enhanced by the large structural diversity arising from oxidation. An UPLC-ESI-MS method was thus developed in order to identify oxidized tannins in wine samples. Given the difficulties to separate and detect tannins with high degrees of polymerisation (DP) by mass spectrometry2, samples were depolymerised by chemical depolymerisation prior to UPLC-ESI-MS analysis. Since the linkages created by oxidation are not cleavable in the usual depolymerisation conditions contrarily to interflavanic linkages, specific oxidation residues should be released from tannins structures after their oxidation. Furthermore, oxidation involving two tannins subunits of two different polymeric chains, which are intermolecular reactions, are supposed to give dimeric structures containing biphenyl-type linkage whereas reactions occurring between two subunits of the same polymeric chain, which are intramolecular reactions, are expected to give dimeric structures containing A-type linkage. First experiments carried out on procyanidin B2 after oxidation allowed both intramolecular and intermolecular oxidation markers to be clearly identified. This primary study was completed by other analyses carried out on several apple tannin fractions (tannins solely composed of a variable number of epicatechin subunits) after oxidation and other types of markers were identified. Analyses of tannin fractions extracted from wines are currently under way so as to identify and quantify wine oxidation markers and to better understand the relationships between phenolic composition and wine quality.

[1] H. Fulcrand, M. Duenas-Paton, E. Salas, V. Cheynier, Am. J. Enol. Vitic. 57 (2006) 289-297.

[2] L. Mouls, J-P. Mazauric, N. Sommerer, H. Fulcrand and G. Mazerolles, Anal. Bioanal. Chem. 400 (2011) 613-623.


[P26] From single cell MALDI-TOF profiling to protein identification in mammalian egg: integrative approach to study the oocyte quality

Svetlana Uzbekova1, Lucie Spina1, Ana-Paula Teixeira-Gomes1, Valérie Labas1

1 INRA, Plate-forme d’Analyse Intégrative des Biomarqueurs, Centre de Recherches INRA de Tours, 37380 Nouzilly, France2 INRA, UMR INRA 85, Physiologie de la Reproduction et des Comportements – UMR CNRS 6175 – Université de Tours -IFCE, Centre de Recherches INRA de Tours, 37380 Nouzilly, France3 INRA, UR1282, Infectiologie Animale et Santé Publique, Centre de Recherches INRA de Tours, 37380 Nouzilly, France

Contact: Svetlana Uzbekova ([email protected])Keywords: Systems biology, Imaging mass spectrometry

Capacity of female germ cell, an oocyte, to be fertilized and to develop to viable embryo is oocyte quality, which is acquired throughout meiotic maturation during pre-conceptual period in mammals. A number of proteins are produced in oocyte during this period to assure early development of future embryo. Mammalian oocyte is 100-150 microns in diameter and contain about 80 ng of protein, thus classic differential proteomics between immature and mature oocytes required thousands of eggs. We adapted Intact Cells MALDI-TOF Mass Spectrometry (ICM-MS) approach on single bovine oocyte by using MALDI-TOF mass spectrometer operating in positive linear mode. Therefore we obtained and compared the spectra profiles as fingerprints of different oocytes. Objective was to look for differential proteins between the oocytes that were able (mature) or not (immature) to be fertilized. Reproducible mass fingerprint gathering a number of peaks ranged 3 000 – 25 000 m/z were obtained for groups of immature and mature oocytes (n=30). Intensity peak variations were observed for 40 from 114 of detected peaks between the oocytes of two groups (ANOVA, p<0.01, Progenesis-MALDI, Non-Linear Dynamics). Among them intensity of 14 peaks varied more than two fold. In order to identify the differential proteins between immature and mature oocytes, we performed nano-LC-MSMS of proteins resolved by 1D-SDS-PAGE. 337 different bovine proteins were identified, among them 149 were common for immature and mature oocytes. Unfortunately, the identification of polypeptides from separated extract by SDS-PAGE does not allow the direct attribution of a candidate to a peak. By too many changes (adding post-translational chemic groups on fragments associated or not with proteolysis) no correspondence can be made between the theoretical mass and the experimental mass. However, comparison of m/z values of differential peaks with predicted molecular weight of identified proteins allowed constituting the list of potential candidates, which may to be validated by immunodetection methods. For better identification of protein origin of differential peaks, a Top down proteomic strategy consisting of nano-HLPC purification of small size proteins with their direct fragmentation using high resolution mass spectrometry will be committed.In conclusion, intact cell MALDI-MS was adapted to mammalian single oocyte and allowed discrimination between the oocytes of different maturation stages by a number of small size proteins which could be identified and served as potential biomarkers.


[P27] Biomarkers of chicken sperm quality displayed by Intact Cells MALDI-TOF Mass Spectrometry

Valérie Labas1, Grégoire Harichaux1, Isabelle Grasseau4, Jean-Didier Terlot4, Ana-Paula Teixeira-Gomes1, Xavier Druart2, Nadine Gérard2, Elisabeth Blesbois4

1 INRA, Plate-forme d’Analyse Intégrative des Biomarqueurs, Centre de recherches INRA de Tours, 37380 Nouzilly, France2 INRA, UMR INRA 85 Physiologie de la Reproduction et des Comportements - UMR CNRS 6175 – Université de Tours -IFCE, Centre de recherches INRA de Tours, 37380 Nouzilly, France3 INRA, UR1282, Infectiologie Animale et Santé Publique, Centre de recherches INRA de Tours, 37380 Nouzilly, France4 INRA, UR 83 Recherches Avicoles, Centre de recherches INRA de Tours, 37380 Nouzilly, France

Contact: Valérie Labas ([email protected])Keywords: Systems biology

Fertility is a complex and highly variable physiological parameter that depends on individual gamete composition and quality. Matrix-assisted laser desorption ionization time-of-flight (MALDI-TOF) mass spectrometry (MS) is a rapid and sensitive analytical approach. It measures molecular weights of peptides and proteins < 20 kDa that are present in complex biological samples, such as cells. This approach does not need extensive sample preparation, except for the cell isolation and matrix application.In this study, differential and quantitative analysis using Intact Cells MALDI-TOF Mass Spectrometry (ICM-MS) profiling, was performed on intact chicken ejaculated spermatozoa. Coupled to biological tests, this method was used for a rapid profiling to display potential biomarkers implicated in fertility. Sperm ICM-MS, Sperm viability (dye SyBr14/IP), motility (Computer Assisted Semen Analyses), induction of acrosome reaction (dye PNA/FITC) were examined on the same biological samples. Individual male fertility was also evaluated after a single artificial insemination of 10-12 hens/male. Three ejaculated sperm samples were collected from 12 chickens for the MS analysis. Spermatozoa were washed and suspended in Tris-Sucrose. The whole cells were spotted onto the MALDI sample probe with an aliquot of a sinapinic acid. All mass spectra were recorded using a MALDI-TOF mass spectrometer (M@LDI LR, Waters), operating in positive linear mode. Eighty four spectral profiles were collected in the mass range 2000-20000 m/z with one hundred spectra per well. Data processing was performed using MassLynx software. Alignment, peak intensity detection and statistical analysis (ANOVA and PCA) were done using Progenesis-MALDI software (Nonlinear Dynamics). The analysis by male gave abundant mass spectral information. Among a total of 144 m/z observed, differentially expressed peptides or proteins were established according to a probability value < 0.05. Twenty nine m/z were retained with progressive significant intensities variations. PCA analysis demonstrated variability between animals. Our results showed correlation between spectrum profiles and physiological parameters. We characterized 4 peaks that significantly differentiated males on fertility, 4 on acrosome reaction and 18 on motility. Only one of them was significantly different for all tests.In conclusion, we showed that ICM-MS can be used to profile peptides and proteins from chicken spermatozoa, which could be involved in fertility. Micropurification of molecular species will be considered for Top-down identification with high resolution mass spectrometry.


[P28] Evaluation de facteurs affectant l’analyse d’oligosaccharides anioniques par DESI-MS

Cédric Przybylski1, Florence Gonnet1, William Buchmann1, Régis daniel1

1 Université Evry-Val-d’Essonne, Laboratoire Analyse et Modélisation pour la Biologie et l’Environnement, bd F. Mitterrand, 91025 Evry, France2 CNRS, UMR 8587, Laboratoire Analyse et Modélisation pour la Biologie et l’Environnement, bd F. Mitterrand, 91025 Evry, France

Contact: Cédric Przybylski ([email protected])Keywords: High mass and high resolution mass Spectrometry, Systems biology, Signaling, interactomics and post-translational modifications

Les techniques d’ionisation actuellement les plus employées en spectrométrie de masse (MS) pour la caractérisation des oligosaccharides et notamment des glycosaminoglycanes (GAGs), sont l’électrospray (ESI) et la désorption ionisation laser assistée par matrice (MALDI)1,2. Récemment, la désorption ionisation assistée par électrospray (DESI)3 a été introduite. Cette méthode requiert un minimum de préparation et présente une grande tolérance aux sels, permettant l’analyse directe et en conditions atmosphériques ambiantes d’échantillons déposés sur une surface.Les GAGs sont des polysaccharides linéaires très anioniques constitués d’unités disaccharidiques répétitives. Parmi eux, l’héparane sulfate (HS) et l’héparine (HP) sont les deux représentants les plus emblématiques des GAGs. Ils comportent de 20 à 200 unités incluant un acide hexuronique et une D-glucosamine acétylée et substituée avec des groupements sulfate en position variable. A l’opposé, l’acide hyaluronique (HA) (non sulfaté) est structuralement le membre le plus simple de cette famille. De part leur taille, l’hétérogénéité de leurs chaînes et la présence des groupements sulfate très labiles, les GAGs sont parmi les biopolymères les plus difficiles à caractériser4. Impliqués dans de nombreuses fonctions physio-pathologiques, ils agissent notamment par interaction avec des protéines cibles5. Les GAGs et leurs assemblages glyco-protéiques représentent une cible thérapeutique de choix, et nécessite donc une bonne compréhension des propriétés à la fois structurales et de formation de ces complexes. Nous avons récemment démontré que le couplage DESI-MS avec un LTQ-OrbitrapTM permettait de déterminer la composition en oligosaccharides de mélanges d’HS et d’HP, ainsi que d’observer des complexes non covalents spécifiques avec des protéines.6Dans cette étude, nous évaluons différents paramètres afin d’optimiser la détection par DESI-MS d’oligosaccharides anioniques. Les limites de détection ont été déterminées. De plus, des expériences de MSn ont démontré l’efficacité d’un tel couplage pour différencier des isomères ou encore effectuer un séquençage.

(1) Zaia, J. Chem. & Biol. 2008, 15, 881-892.(2) Przybylski, C. et al. Glycobiology 2010, 20, 224-234.(3) Takats, Z. et al. R. G. Science 2004, 306, 471-473.(4) Sasisekharan, R. et al. V. Ann. Rev. Biomed. Engin. 2006, 8, 181-231.(5) Gandhi, N.S. et al. Chem. Biol. & Drug Design 2008, 72, 455-482.(6) Przybylski, C. et al. Anal. Chem. 2010, 82, 9225-9233.

Link: http://www.lambe.univ-evry.fr


[P29] The Orbitrap technology: Increased analytical performances for the analysis of peptides and proteins.

Claire Dauly1, Martin Zeller2, Catharina Crone2, Carmen Paschke2, Mathias Mueller2, Eugen Damoc2, Eduard Denisov2, Alexander Makarov2, Bernard Delanghe2, Thomas Moehring2

1 Thermo Fisher Scientific, 16 avenue du Québec, 91963 Courtaboeuf cedex2 Thermo Fisher Scientific, , Bremen, Germany

Contact: Claire Dauly ([email protected])Keywords: Instrumentation

Getting a comprehensive view of the protein content of a complex sample is still a challenge in proteomics, getting that done in one analytical run even more. This work will describe new analytical platforms and software with increased performances in terms of scan speed, resolution and sensitivity. A tryptic digest of a whole SILAC labeled HeLa cell lysate was measured on a new Thermo Fisher Scientific benchtop quadrupole Orbitrap instrument coupled to a Thermo Fisher Scientific Easy nano-LC. More than 50.000 HCD spectra were acquired. The raw files were analyzed using Mascot, SEQUEST and X!Tandem. The statistical significance of the identifications was done by applying Percolator to the primary target decoy results of the individual search engines. This resulted in more than 10.000 peptides and more than 2000 proteins identified with less than 1% FDR. Enzymatically degraded E.coli total protein extract was analyzed on a modified Thermo Fisher Scientific LTQ Orbitrap Velos instrument including a compact Orbitrap analyzer and improved pre-amplifier which results in a higher scan speed and improved dynamic range and sensitivity. Proteome Discoverer 1.2 was used for database searching and result validation. The higher scan speed in combination with the better sensitivity results in a higher number of protein and peptide identifications compared to the standard LTQ Orbitrap Velos instrument using the same sample and LC conditions. More precursor ions of low abundant compounds get over the limit of detection and the faster scan rate allows also triggering those precursor ions for MS/MS.


[P30] Protéomique, cellules endothéliales et cancer

Bruno Baudin1, Arnaud Bruneel1, Joëlle Vinh2, Nelly Bosselut3

1 EA-4530 UFR Pharmacie UPS, 5 Rue Jean-Baptiste Clément, 92296 Châtenay-Malabry, France2 USR-3149 CNRS-ESPCI, 10 Rue Vauquelin, 75006 Paris, France3 Service de Biochimie A - Pôle Biologie-Imagerie Hôpital Saint-Antoine, 184 Rue du faubourg Saint-Antoine, 75571 Paris cedex 12, France

Contact: Bruno Baudin ([email protected])Keywords: Systems biology, Clinical proteomics, High mass and high resolution mass Spectrometry

Les cellules endothéliales (CE) bordent la face interne des artères, des veines et des capillaires où elles sont à l’interface du sang et des vaisseaux. Elles exercent de nombreuses fonctions finement régulées, dont des échanges avec le sang et les tissus sous-jacents, et les régulations du tonus vasculaire, de l’hémostase, de la fibrinolyse, des réponses inflammatoires et immunitaires. Les CE interviennent dans le cancer sous plusieurs aspects : leur prolifération menant à l’angiogenèse des tumeurs, la production de facteurs de croissance pour les cellules musculaires lisses de la média favorisant la vasculogenèse tumorale, et leur sensibilité aux chimiothérapies véhiculées par le sang amenant à des effets indésirables. Nous avons étudié par la protéomique, alliant l’électrophorèse bidimensionnelle et la spectrométrie de masse (MALDI-TOF et TOF-TOF, LC-ESI-MS/MS, FTICR-MS et visualisation 3D), les CE de la veine ombilicale humaine cultivées in vitro (Nature Protocols 2007) dans diverses conditions : (1) au repos à confluence, (2) après traitement par des médicaments anticancéreux toxiques pour les vaisseaux sanguins, et (3) par des substances mimant l’angiogenèse tumorale. Nous avons identifié plus de 600 protéines incriminées dans les diverses fonctions des CE (consultables sur notre site huvec.com), dont des protéines non connues dans ces cellules à ce jour, des protéines induites dans l’apoptose des CE soumises aux chimiothérapies (Proteomics 2003 et 2005), et des protéines incriminées dans l’angiogenèse, comme l’oxygen-regulated protein 150 kDa et des protéines chaperons (HSP, GRP, PDI…) dont certaines spécifiques aux CE (endoPDI). De ces travaux pourraient émerger des nouveaux marqueurs des CE, des marqueurs d’apoptose induite par les chimiothérapies anticancéreuses, ainsi que des stratégies thérapeutiques pour la protection de l’endothélium vasculaire, ou pour inhiber l’angiogenèse tumorale.

Link: huvec.com


[P31] Mass spectrometric quantification of trastuzumab, a humanized monoclonal antibody in human plasma

Sylvere Durand1, Keyvan Rezai1, Sophie Weill1, Laetitia Cravello3, Francois Becher2, Francois Lokiec1

1 Laboratoire Pharmacologie Institut Curie - Hopital Rene Huguenin, 35 rue Dailly, 92210 Saint-Cloud, France2 CEA Laboratoire d'etude du metabolisme des medicaments, , 91191 Gif-sur-Yvette, France3 Waters Corporation, , Manchester, United Kingdom

Contact: Sylvere Durand ([email protected])Keywords: Proteins, peptides and small molecules quantification

Background: Mass Spectrometer (MS) coupled with Liquid Chromatography (LC) is a very sensitive and selective method for determination of anticancer drug concentrations in different biological matrix.Trastuzumab is a monoclonal antibody that targets the extracellular domain of HER2, a member of the epidermal growth factor receptor (EGFR) family. Trastuzumab is currently approved for the treatment of breast cancer overexpressing HER2. For the quantification of therapeutic monoclonal antibodies in biological specimens, enzyme-linked immunosorbent assay (ELISA) is the most widely used technique. ELISA has some limitations and therefore alternative analytical techniques have to be explored. The aim of this study is to develop a more sensitive analytical method using LC-MS/MS to determine plasma concentrations of trastuzumab with a lower limit of quantification than ELISA.

Methods: Method development consisted in several steps: 1- Peptide mapping of trastuzumab is done by enzymatic digestion in collaboration with Waters INC. using a Xevo G2 QToF (Quadrupole Time of Flight) and BiopharmaLynx as software. 2- Peptides potentially candidates to be used as markers are compared to peptides in an online database. The comparison follows the similarity search method (BLAST) to determine the specificity of each peptide obtained from trastuzumab. Other parameters such as ion signal intensity, miscleavage and post-translational modification are included in this analysis for peptide marker targeting. The hypothesis raised by the BLAST method has to be experimentally confirmed.3- Extraction method using immunocapture with specific antigen/antibody binding is used. Optimal protocol of protein digestion is set up by playing on pH values, solvent ratios, reagent concentrations and trypsin activity duration.4- Optimization of the coupled Ultra Performance LC and MS QToF G1 Xevo is done with synthesized peptides, similar to the previously selected ones. The specific peptides induced by the digestion are then analyzed by LC-MS/MS. The use of this previous method provides sensitivity and reproducibility necessary for quantification of specific peptides.

Results: Almost 100% of the peptide sequence is characterized and 200 peptides are identified by peptide mapping method. From BLAST, 7 peptides have been yet isolated as potentially candidates. We have a strong hypothesis about the complementary determinant receptor (CDR) location on peptides from trastuzumab trypsination.

Conclusions and Perspectives: At this point, we are about to confirm experimentally the peptide candidates. The final chosen peptides will be used for LC-MS/MS quantification. The next steps of the study are to develop an extraction method using immunocapture and an optimized quantification method in plasma using UPLC-MS/MS method.


[P32] Les polyphénols des vins rosés : MSn et MRM préliminaires à une étude à large échelle

Marine Lambert1, Arnaud Verbaere1, Emmanuelle Meudec1, Jérémie Wirth2, Gérard Mazerolles1, Gilles Masson3, Véronique Cheynier1, Nicolas Sommerer1

1 INRA, UMR1083 SPO, Sciences Pour l’œnologie, Plate-Forme d’analyse des polyphénols, 2 place Viala, 34060 Montpellier2 INRA, UMR1083 SPO, Sciences Pour l’œnologie, Equipe Polyphénols et Intéractions, 2 place Viala, 34060 Montpellier3 Centre de Recherche et d'Expérimentation sur le Vin Rosé, 70 avenue Wilson , 83550 VIDAUBAN

Contact: Marine Lambert ([email protected])Keywords: Separative analysis methods, Proteins, peptides and small molecules quantification

Les polyphénols, métabolites secondaires des végétaux, forment une famille chimiquement très hétérogène et complexe. Issus de fruits, végétaux, aliments ou produits transformés, ils trouvent leurs applications dans des domaines variés, tels que l’industrie alimentaire, cosmétique ou pharmaceutique, en raison des propriétés anti-oxydantes qu’on leur attribue.Contrairement aux vins rouges, les vins rosés contiennent une faible quantité de polyphénols qui jouent toutefois un rôle important dans la perception sensorielle (couleur par exemple) du produit fini.Le couplage de la chromatographie ultra-haute performance (UHPLC) à la spectrométrie de masse de type triple quadripolaire (ESI-QqQ-MS) permet d’allier rapidité, sensibilité et spécificité, et ainsi de classer de grandes séries d’échantillons. En effet, le mode de détection MRM (Multiple Reaction Monitoring) permet de détecter et doser sélectivement des molécules cibles préalablement identifiées à partir d’un ou plusieurs fragments, les données générées permettant ensuite l’analyse statistique et chimiométrique, dans le cadre d’approches métabolomiques.Nous présentons ici la méthode d’analyse rapide par MRM des polyphénols contenus dans des vins rosés en provenance de différentes régions du monde que nous avons mise au point, préalable à l’étude à très large échelle (plusieurs centaines de vins du monde). Elle permet de suivre l’évolution et de quantifier en une seule injection une centaine de composés polyphénoliques différents (anthocyanes, acides phénols, flavonols, flavanols, stilbènes…). A terme, les données obtenues doivent permettre d’élaborer une typologie des vins analysés en corrélant leur composition polyphénolique à leur origine géographique, leur cépage, leur couleur, ou de déceler d’éventuelles fraudes (obtention de vin rosé par mélange de vins rouge et blanc notamment).

Link: http://www.montpellier.inra.fr/spo/structures_collectives/plate_forme_polyphenols


[P33] Development of original cross-linkers specifically designed for mass spectrometry analysis

Christian Malosse1, Jingjing Zhao1, Ashley C. Gudzinski1, Guillaume van der Rest1, Julia Chamot-Rooke1, Sébastien Dautrey2, Anthony Romieu2, Pierre-Yves Renard2

1 Laboratoire des Mécanismes Réactionnels, Ecole Polytechnique, 91128 Palaiseau2 COBRA-CNRS UMR 6014 & FR 3038, rue Lucien Tesnière, 76131 Mont-Saint-Aignan

Contact: Guillaume van der Rest ([email protected])Keywords: Signaling, interactomics and post-translational modifications, High mass and high resolution mass Spectrometry

In the variety of approaches to assess ternary and quaternary structure of proteins and protein complexes by mass spectrometry, chemical cross-linking could provide a unique means to obtain direct distance measurements at the molecular level. While the experimental procedure for chemically cross-linking proteins is now well established, there are several analytical challenges that remain in the identification of the cross-linked peptides by MS. A main difficulty is the differentiation of cross-linked peptides from unmodified ones in the extremely complex peptides mixtures that result from digestion of cross-linked proteins. Another difficulty is the ability to identify the specific location of the cross-link using tandem MS. Thus, we have started the development of new chemical cross-linkers giving both a specific signature in the MS (or MS/MS) spectra as well as high sequence coverage in tandem MS experiments.

The approach that we have chosen is based on click chemistry. Our new cross-linkers are trifunctional: they bear two reactive groups designed to react with various protein side-chains, whereas the third consists of an alkyne function. This latter will be used for click-chemistry addition of a tag on an azide containing compound (Copper I catalyzed cycloaddition), which will provide a specific marker for mass spectrometry analysis. Two types of tripod cores have served as building blocks: a rigid core (phenyl group) and a soft lysine-like core. Reaction on peptide side-chains can be introduced as two N-hydroxy-succinimide (NHS) activated carbamate groups, or as one NHS activated carbamate and one benzophenone group for photoactivated cross-linking. Cross-linker length can be varied by repetition of (CH2-CH2-O) motives, which will also help solubilizing the tripod.

Based on this versatile synthesis strategy, a first series of 6 cross-linkers were synthesized and assayed on a peptide (Substance P) and a small protein (myoglobin). Experimental parameters were optimized to maximize derivatization efficiencies and minimize cross-linker hydrolysis. Among the parameters that were assayed were temperature, reaction time, buffer pH and composition. One interesting observation is that our cross-linkers lead to less dead-end products than the commercial ones. For mass spectrometry analysis, the procedure was optimized to provide efficient detection of the labeled peptides, through the use of a permanent charge added by click-chemistry.

Link: http://www.dcmr.polytechnique.fr/spip/spip.php?rubrique33


[P34] NwCompare et AutoCompare, deux outils pour l'analyse de données protéomique et transcriptomique.

Frédéric PONT1, Jean Jacques FOURNIE2

1 Plateau technique Interactions et Profils d'expression Protéiques. INSERM UMR1037-Cancer Research Center of Toulouse, UDEAR. Hôpital PURPAN. TSA 40031, 31059 TOULOUSE cedex 092 INSERM UMR1037-Cancer Research Center of Toulouse. ERL 5294 CNRS, BP3028, CHU Purpan, 31300 Toulouse

Contact: Frédéric PONT ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics

La protéomique, la transcriptomique et la métaobolomique produisent des listes de protéines, de gènes ou des noms de métabolites. Il est souvent très utile de pouvoir comparer rapidement et facilement ces listes afin de déterminer si des protéines, des métabolites ou des gènes sont spécifiques à certains échantillons.NwCompare (*) est un petit logiciel, très simple d'utilisation, qui permet la comparaison d'un nombre quasi illimité de listes au format texte. Il est donc possible avec nwCompare, de comparer des listes de noms de protéines, de gènes, de métabolites … en quelques secondes sans avoir recours à une syntaxe complexe et sans avoir besoin d'un serveur ou d'un accès internet.AutoCompare (**) va comparer automatiquement une liste de donnée avec des listes de références et calcule la probabilité que la concordance des listes soit due au hasard. Nous avons collecté et généré environ 5500 listes de références, contenant les noms de gènes impliqués dans des fonctions cellulaires, des métabolismes, des voies de signalisation etc... Avec AutoCompare, il est donc possible d'obtenir très facilement des informations sur la signification biologique d'une liste de gènes. Comme nwCompare, AutoCompare nécessite peu de puissance et sa prise en main est immédiate. Ces logiciels sont libres et gratuits.

Références :(*) Pont F, Fournié JJ. Proteomics. 2010 Mar;10(5):1091-4. Sorting protein lists with nwCompare: a simple and fast algorithm for n-way comparison of proteomic data files.(**) soumis pour publication.


[P35] Détection d’esters de stéroïdes dans le sang par UPLC-MS/MS – Une stratégie analytique permettant de révéler certaines pratiques anabolisantes en élevage

Zied KAABIA 1, Gaud DERVILLY-PINEL 1, Philippe PLOU 2, Yves BONNAIRE 2, Bruno LE BIZEC 1

1 Laboratoire d’Étude des Résidus et Contaminants dans les Aliments (LABERCA), Atlanpole - La Chantrerie, BP 40706, Nantes, F-44307, France, 44307 Nantes2 Laboratoire des Courses Hippiques (LCH), 15 Rue de Paradis, 91370 Verrières-le-Buisson, France

Contact: Zied KAABIA ([email protected])Keywords: Separative analysis methods

La lutte contre le dopage est un sujet en perpétuelle évolution pour lequel ces dernières décennies ont vu l’essor de techniques de pointe basées principalement sur la spectrométrie de masse, permettant des avancées considérables dans la détection de substances dopantes chez les athlètes (humains ou animaux) ou les animaux de production. Si le système de contrôle dans son ensemble n’est pas remis en cause, force est de constater qu’il se heurte aujourd’hui à certaines limites parmi lesquelles le cas des hormones stéroïdes naturelles qui s’avère particulièrement délicat à traiter. Il semble en effet que certaines substances anabolisantes considérées jusqu’alors comme strictement xénobiotiques puissent être retrouvées, dans certaines conditions, dans les fluides biologiques d’animaux n’ayant pas reçus de traitement anabolisant. Si diverses hypothèses expliquant ce phénomène sont avancées, avec parmi elles une modification de l’alimentation, des pratiques de courses différentes (déferrage, fréquence des courses, saisonnalité, …), une influence de la saisonnalité, ou encore des conditions physiologiques particulières (gestation, blessures, …), il n’existe à l’heure actuelle aucun critère analytique permettant de statuer quant à la conformité de l’échantillon face à une telle situation. Face à ces constats récents, il apparaît en effet primordial de trouver un ou plusieurs critères autorisant la discrimination entre des situations de fraude avec certains stéroïdes et des conditions naturelles d’excrétion urinaire. En particulier, le développement d’une méthode autorisant la recherche d’esters de stéroïdes, composés signant sans ambiguïté une administration exogène, dans les fluides biologiques (urine / sang) afin d’autoriser la mise en évidence directe des composés administrés est une des stratégies analytique privilégiée par le LABERCA et le LCH dans le cadre d ‘un programme de recherche collaboratif. L’objectif de ce travail est de mettre en œuvre une méthode analytique rapide pouvant détecter un large panel d’esters de stéroïdes à l’état de trace (de l’ordre de la dizaine de ppt) dans le sérum/plasma de bovins et d’équins. La préparation d’échantillon implique un passage de l’échantillon aux ultrasons suivie d’une étape d’extraction en phase solide (SPE). L’identification des esters de stéroïdes est réalisée par UPLC-MSMS sur un instrument de dernière génération (Xévo TQS, Waters) permettant d’atteindre des niveaux de sensibilité de la détection compatibles avec les taux circulants attendus. L’analyse de sérum bovins collectés après administration de teststérone-propionate ont permis d’éprouver la méthode et dresser le profil cinétique de l’ester de quelques heures (centaine de ppt) jusqu’à plusieurs jours après son administration.


[P36] Quantification des Bisphénol-A halogénés par HPLC-MS/MS

Emilien JAMIN1, Hanna KULYK1, Isabelle JOUANIN 1, Laurent DEBRAUWER1

1 INRA, UMR1331 TOXALIM, plateforme MetaToul, 180 Chemin de Tournefeuille, F31027 Toulouse

Contact: Emilien JAMIN ([email protected])Keywords: Proteins, peptides and small molecules quantification

Si le bisphenol-A (BPA) est un perturbateur endocrinien contaminant de l’environnement bien connu, ses dérivés bromés et chlorés présentent également une problématique toxicologique, mais sont beaucoup moins recherchés. Le tétrabromobisphénol-A (TBBPA) est un retardateur de flamme produit industriellement en grande quantité. Il conduit à la formation de produits de dégradation correspondant au tri, di et monobromobisphenol-A (tBBPA, dBBPA et mBBPA). Le tétrachlorobisphenol-A (TCBPA) est quant à lui produit en plus faibles quantités en tant que retardateur de flamme, mais peut être généré directement par simple chloration du bisphenol-A (1), tout comme ses analogues tri, di et monochlorobisphenol-A (tCBPA, dCBPA et mCBPA). L’exposition quotidienne de l’Homme à ces composés perturbateurs endocriniens est avérée et leur présence dans le tissu adipeux humain a déjà été montrée (2). Dans ce contexte, nous présentons dans ce travail le développement d’une méthode de quantification de ces analogues halogénés du bisphenol-A par HPLC-MS/MS dans des échantillons biologiques, et en particulier dans des échantillons de lait.Ainsi, le BPA, le mBBPA, le dBBPA, le tBBPA, le TBBPA, le mCBPA, le dCBPA, le tCBPA et le TCBPA, ont été quantifiés par calibration interne en utilisant ces substances marquées par des isotopes stables (carbone 13). L’ensemble de ces composés ont été synthétisés au laboratoire à partir de BPA et de [13C]-BPA. Les analyses ont été réalisées par un couplage HPLC-MS/MS constitué d’un système Accela 600 (Thermo Scientific), d’un gradient de phases mobiles méthanol / eau (0,2 mL/min), et d’une colonne Modulo Cart QS Uptisphere 3BIO P2 (150 x 2,1 mm), 3 µm (Interchim) maintenue à 25°C. La détection a été réalisée avec un spectromètre de masse TSQ Quantum Discovery MAX (Thermo Scientific) de type triple quadripôle opérant en mode MRM avec une source d’ionisation Electrospray en mode négatif.La méthode ainsi développée permet de séparer l’ensemble des composés étudiés en 12 min. La détection est assurée sur la base de 3 transitions (2 pour le mBBPA). Les performances de la méthode seront discutées en termes de linéarité (supérieure à 0,992 pour tous les composés sur une gamme comprise entre 3 et 3000 pg injectés), répétabilité (inférieure à 14%) et de sensibilité (limites de détection (S/N>3) comprises entre 0,3 et 3 pg injectés selon les composés).Enfin, dans l’optique d’appliquer notre méthode au dosage des dérivés halogénés du BPA dans le lait maternel, un protocole d’extraction/purification a été développé sur la base d’une méthode existante pour le dosage du TBBPA (3), qui utilise différentes étapes d’extraction liquide/liquide successives, suivies d’une purification SPE Si-OH sur cartouches en verre.(1) H. Liu et al., Environ. Sci. Technol. 43 (2009) 7712(2) M.F. Fernandez et al., Reprod. Toxicol. 24 (2007) 259(3) R. Cariou et al., J. Chromatogr. A 1100 (2005) 144


[P37] Spéciation de l’iode en milieu biologique par desorption/ionisation par electrospray (DESI)

Diane Lebeau1, Jean Baptiste Fournier2, Catherine Leblanc2, Pascal Reiller1, Thierry Pourcher3, Denis Doizi1

1 CEA-Saclay, DEN/DANS/DPC/SECR/LSRM, 91191 Gif-sur-Yvette2 UMR 7139, CNRS-UPMC, Station Biologique, 29680 Roscoff3 Unité TIRO, CEA-Université de Nice, 06107 Nice

Contact: Diane Lebeau ([email protected])Keywords: Organic and inorganic mass spectrometry

L’iode est un oligoélément présent dans la plupart des formes de vie évoluée et essentiel à la vie humaine. Il est principalement présent dans les mers et les produits marins et se retrouve dans une moindre mesure dans les terres et diverses plantes et animaux. Il peut être relargué dans l’atmosphère sous diverses formes chimiques inorganiques (I-, I2, IO3-, HIO) ou organiques (CH3I et autres dérivés alkyls ou phénoliques). La répartition de l’iode entre ses différentes formes chimiques conditionne son devenir et son impact sur l’environnement. Chez les mammifères, un apport quotidien, essentiellement par l’alimentation, est nécessaire pour notamment, la synthèse des hormones thyroïdiennes.L’objectif de ce travail a consisté en la mise au point d’une méthode analytique permettant la spéciation par spectrométrie de masse de l’iode dans son environnement biologique. Ainsi deux modèles naturels ont pu être étudiés : la surface d’algues brunes Laminaria digitata et le contenu du tractus digestif de souris. Les laminaires sont d’importants accumulateurs d’iode et des contributeurs majeurs au cycle de l’iode en milieu marin cotier. Le deuxième système étudié a pour but de caractériser la biodistribution et le métabolisme de l’iode au niveau du tractus digestif. L’iode est constitutivement accumulé au niveau de l’estomac et des glandes salivaires et il est absorbé au niveau de l’intestin. Une des finalités de ce travail est notamment un meilleur contrôle de l’exposition des organes en cas de contamination par un isotope radioactif (125,129,131I). La désorption/ionisation par electrospray (DESI) est l’une des dernières techniques analytiques utilisées en spectrométrie de masse permettant la détection de molécules organiques directement dans leur environnement à pression atmosphérique. Cette méthode a donc été choisie afin de caractériser l’iode sur les deux modèles d’étude choisis. Cette technique d’ionisation douce permet, en effet, l’analyse de la spéciation d’un grand nombre d’espèces organiques ou inorganiques. Il a ainsi été possible de détecter les diverses formes de l’iode sur ces deux modèles étudiés. Il a été montré que la détection des ions I- et IO3- sur des coupes de colon enrichis en iode par addition de solutions de NaI et NaIO3 par DESI était possible. Ainsi, la spéciation de l’iode a été conservée, les ions I- (m/z 126,9) et IO3- (174,9) ayant été respectivement détectés. L’optimisation des conditions expérimentales (choix du solvant, paramètres géométriques de la source, pression de gaz, tension du capillaire, etc…) a ensuite permis d’atteindre une limite de détection de l’ordre de 0,2 nmol/mm². La concentration d’iode estimée étant de l’ordre du µM, cette limite de détection obtenue est donc parfaitement compatible avec nos objectifs. Une étude de la distribution de ces différentes espèces organiques et inorganiques de l’iode sur la surface des modèles est en cours.


[P38] Avantages des couplages de la chromatographie de partage centrifuge avec la chromatographie liquide et la spectrométrie de masse pour la purification de composés dans des extraits de plante

Emilie Destandau1, Thomas Michel1, Alix Toribio2, Claire Elfakir1

1 Institut de Chimie Organique et Analytique, rue de chartres, 45067 orleans2 phycosource, 13 boulevard de l'Hautil, 95000 Cergy pontoise

Contact: Emilie Destandau ([email protected])Keywords: Separative analysis methods, Organic and inorganic mass spectrometry, Instrumentation

La Chromatographie de Partage Centrifuge (CPC) utilise un mélange liquide biphasique pour séparer ou purifier des molécules à l’échelle semi-préparative. Grâce à son absence de support solide et à sa grande capacité d’injection, la CPC s’avère être une technique de choix pour la séparation ou la purification de molécules naturelles à partir d’extraits de plantes. Lors de la purification des molécules d’intérêt la CPC est généralement couplée à un détecteur UV qui permet d’obtenir le chromatogramme CPC de l’extrait. Dans ce cas, les informations structurales sont faibles et les composés isolés sont analysés off-line par spectrométrie de masse (SM) afin de les identifier. Le développement du couplage CPC-MS permet d’avoir immédiatement lors de la purification, un accès direct à des informations structurales sur les molécules d’intérêt ; ainsi le suivi de purification est facilité et plus rapide. Lorsque l’extrait de plante est complexe et que les molécules ne peuvent pas être purifiées une à une, la CPC peut être utilisée dans le but de fractionner cet extrait complexe ce qui permet d’obtenir une empreinte plus exhaustive de l’extrait et de faciliter l’identification ultérieure des composés d’intérêt par LC-MS. En permettant d’associer en simultané l’empreinte chromatographique des différentes fractions et les spectres de masse des différents constituants, le développement innovant du couplage CPC-LC-MS favorise et facilite le guidage en ligne du fractionnement. Les deux couplages de la CPC directement avec la SM ou avec la LC-MS sont délicats de part, le changement d’échelle préparative pour la CPC et analytique pour la LC et la MS, et de part le risque de non miscibilité des solvants utilisés. Une fois développés et optimisés, ces couplages ont été respectivement appliqués à la purification de xanthones dans un extrait de mangoustan et au fractionnement de flavonoïdes dans un extrait de baies d’argousier. Un réel gain sur la qualité du fractionnement, sur l’identification structurale et sur la durée totale des expériences a été observé.


[P39] Study of ESBL producing- and beta lactam-sensitive E.coli using MALDI-TOF-MS and hybrid MALDI-QIT-TOF tandem mass spectrometry

Omar BELGACEM1, Emmanuel WEY2, Indran BALAKRISHNAN2, Shervanthi HOMER-VANNIASINKAM3, Valery EDWARDS-JONES3, Pranav SOMAIYA3

1 SHIMADZU KRATOS, Trafford Wharf Road - Wharfside, M17 1GP MANCHESTER (UK)2 ROYAL FREE HOSPITAL, , LONDON (UK)3 NPIMR-UCL, , LONDON (UK)

Contact: Omar BELGACEM ([email protected])Keywords: Clinical proteomics

IntroductionThe emergence of multi-drug resistant (MDR) enterobacteriaceae that can produce Extended Spectrum β-lactamses (ESBLs) is currently a major worldwide concern. ESBLs are a group of enzymes that are transfered via plasmids in gram negative bacteria. They confer reistance to a wide spectrum of beta-lactam antibiotics currently used as 1st line empirical therapy in the management of gram negative bacterial infections. E.coli is the most frequent gram-negative rod isolated from blood cultures in clinical settings. Microbial biotyping is generally obtained using fingerprinting methods. Here, we deviate from MS-only pattern recognition methods and use tandem mass spectrometry to find biomarkers in ESBL producers. Polypeptides from ESBL producing E.coli samples were desorbed directly from the MALDI plate using hybrid MALDI-QIT-TOF instrumentation.

Method Two groups of organisms beta lactam sensitive E.coli and an ESBL-producing (ESBLp) E.coli were grown and analysed by MALDI-TOF and MALDI-QIT-TOF.

Preliminary DataLinear MS of the two organisms showed consistent reproducibility in replicate of linear mode spectra obtained in the 2-20 kDa mass range. There were significant differences between beta lactam sensitive and ESBLp E.coli. The difference was such that no identifications could be obtained with the ESBLp E.Coli. Two peaks at 2341.3 Da and 3790.0 Da detected in the ESBLp E.coli spectra exhibited unusually high intensity relative to other peaks. When subjected to MS2 analysis using the reflectron mode of operation, we obtained no workable tandem MS. This was explained by the unusual crystallization process observed for ESBLp E.Coli which led ultimately to poor ionization efficiency. In order to avoid adverse effects of uneven sample surfaces, we decided to use a hybrid MALDI-QIT-TOF instrument where the ionization source is decoupled from the TOF analyser typical for such instrument configuration. CID experiments performed on several peaks allowed us to detect two main components that exhibited isotopic resolution across the whole mass range. After performing a Mascot search we identified two peptides (2341.3 Da and 3790.0 Da) originating from the same acid shock protein. The fragmentation pattern of these amino acid sequences were exhibiting b- and y-type ion series and hence led to identifications with high confidence. This protein is known to be found in the periplasm and our results indicate that such proteins seem to be easily detected in the ESBLp sample. The presence of several lysine residues in the detected peptides could also explain its high proton affinity and this may explain the lack of detection of other protein signals in this sample. Future work will consist of explaining the presence of this protein in the ESBLp E.Coli sample as well as investigate if such methods can be used for different organisms.Link: www.shimadzu.com


[P40] Evidence for the involvment of anthranilate degradation pathway in Pseudomonas aeruginosa biofilm formation by global approaches.

Patricia Costaglioli 1, Christophe Barthe1, Stéphane Claverol2, Michel Perrot2, Marc Crouzet1, Marc Bonneu2, Bertrand Garbay1, Sébastien Vilain2

1 Laboratoire de Biotechnologie des Protéines Recombinantes à Visée Santé, 146 rue Léo Saignat, 33076 BORDEAUX Cedex2 Pôle Protéomique, 146 rue Léo Saignat, 33076 BORDEAUX Cedex

Contact: Sébastien Vilain ([email protected])Keywords: Proteins, peptides and small molecules quantification

Pseudomonas aeruginosa is a genetically complex bacterium which can adapt to its environment andswitchbetween a free-living or biofilm lifestyle. This versatility enables P. aeruginosa to thrive in many different environments and contributes to its success as a human pathogen. Biofilms are complex bacterial communities found attached to biotic or abiotic surfaces and surrounded by an extracellular matrix composed of exopolysaccharides, DNA and proteins produced by the bacteria. In this work we investigated the genome expression of sessile cells present in biofilms developed on glass wool substratum, which can concentrate extracellular DNA. By using microarrays and mass spectrometry associated with iTRAQ labelling, transcriptome and proteome of sessile cells were explored and compared with those of two kind of planktonic cell cultures , one in exponential growth phase and the other one in stationary phase. A statistical study by Principal Component Analysis revealed the existence of a specific genome expression during biofilm formation and the expression of a cluster of mRNAs and proteins was specifically modified when compared to planktonic cells. We observed an overexpression of Mg2+ regulon and of genes involved in the production of the low-affinity siderophore pyochelin system. The Rlh and PQS systems were also upregulated in biofilms when compared to exponentially growing cells. The sessile cells obtained in our experimental model exhibited several features with P. aeruginosa isolated from the lungs of cystic fibrosis patients. Our study also highlighted the overexpression of genes controlling the anthranilate degradation pathway in the sessile cells grown for 24 hours on glass wool. In addition, we did not observe any significant induction of the metabolic pathway which uses anthranilate for PQS production. These results suggest that anthranilate was mainly used for energy metabolism. Transposon mutants defective for anthranilate degradation were analyzed in a simple assay of biofilm formation by P. aeruginosa. The phenotype analyses confirmed that biofilm formation was partially dependent on the activity of the anthranilate degradation pathway. This work revealed a new feature concerning the anthranilate use in P. aeruginosa sessile cells.


[P41] Glycosylation Profiling of Therapeutically Active Glycoproteins: Identification of Glycans in Recombinant Factor IX using Directed MALDI-QIT-TOF-MSn and a Glycan Database

Matthew OPENSHAW1, Daniel SPENCER2, Louise ROYLE2, Katharina POCK3, Omar BELGACEM1

1 SHIMADZU KRATOS, Wharfside, Trafford Wharf Road , M17 1GP Manchester (UK)2 LUDGER Ltd, , Oxford (UK)3 OCTAPHARMA PHARMAZEUTIKA PRODUKTIONS, , Vienna (Austria)

Contact: ([email protected])Keywords: Signaling, interactomics and post-translational modifications

IntroductionHigh levels of quality control are required for the characterisation of recombinant biopharmaceuticals to ensure batch-to-batch reproducibility, safety and efficacy. Post-translational processing of recombinant proteins must be carefully characterised and methods must be developed for the profiling of such glycosylation patterns in the products of biomanufacturing. Due to the branched nature of glycans, the unambiguous identification of glycan structures is not trivial. Here, we use a software-directed multistage MALDI mass spectrometric approach which guides the user through the structural analysis of glycans with the aim of identifying a single structure contained in a glycan database, without the need for manual interpretation of MSn data.

Preliminary DataMethods for the release, capture, PA-derivatisation & purification of free glycans have been optimised for subsequent MALDI analysis. Released glycans were captured using a combination of C18 and porous graphite carbon (PGC). Reductive amination (PA-labelling) was performed using 2-aminopyridine and 2-picoline borane. Optimisation of the labelling conditions was performed in an attempt to produce the highest yield of labelled glycans whilst minimising non-specific modification of the glycans. We have compared previously published methods for subsequent purification of PA-labelled glycans (solid phase extraction, gel filtration (Sepharose-based method), acetone precipitation, porous graphite carbon) with the aim of providing a clean sample suitable for direct MALDI analysis without the need for HPLC purification. Without effective sample clean-up, excess reagents from the PA-labelling procedure can reduce sensitivity in subsequent MALDI analysis.

We applied the optimised sample preparation protocols to the analysis of glycans released from Fetuin (test protein) and recombinant Factor IX (BeneFix (Wyeth Europa, Maidenhead (UK))) to demonstrate the application of the described workflow for the quality control of biotherapeutics.

Using this approach, we have identified several glycans from fetuin and have detected several glycans released from the blood coagulation factor IX sample. We will apply the optimised sample preparation protocols and will attempt to identify the factor IX N-glycans using this workflow. Identification of sialylated glycans is more challenging and work is on-going to apply the described approach for the identification of these sialic acid-containing glycans.

While QC of such biotherapeutics is typically performed using HPLC-based methods, the MALDI-based identification method could significantly reduce analysis time in cases where differences in glycosylation pattern (relative to a reference batch) are observed. Using the software-directed MSn approach, glycan structures can be identified without the need for interpretation of MSn data.

Link: www.shimadzu.com


[P42] Identification and quantification of Serine/Threonine/Tyrosine phosphorylated proteins of wild type and mutants of Listeria monocytogenes

Sandeep MISRA1, Eliane Milohanic2, Josef Deutscher2, Francine Aké2, Ivan Mijakovic3, Véronique Monnet1, Céline Henry1

1 Plateforme d'Analyse Protéomique Paris Sud Ouest, UMR 1319 MICALIS, Domaine de Vilvert, 78352 Jouy en Josas2 Physiologie et Génétiques des Bactéries, UMR 1319 MICALIS, Domaine de Vilvert, 78352 Jouy en Josas3 INRA-AgroParisTech, Domaine de Vilvert, 78352 Jouy en Josas

Contact: Céline Henry ([email protected])Keywords: Proteins, peptides and small molecules quantification , High mass and high resolution mass Spectrometry

Listeria monocytogenes is a gram positive, food borne pathogen that is responsible for listeriosis. The infection with L. monocytogenes causes abortion and leads to septicemia and other complications mainly in newborn babies, immunocompromised adults or senior citizens. In this bacterium, two interconnected events, carbohydrate utilization and protein phosphorylation are known to be involved in virulence. The importance of phosphoproteins in bacteria was only recently recognized and is still not well understood. Phosphoproteomes of several bacteria have been deciphered. These studies suggest that Ser/Thr/Tyr phosphorylation is involved in a diverse range of cellular regulatory networks and controls numerous physiological processes, including virulence in bacteria. The objective of the present work is to identify and quantify L. monocytogenes, proteins phosphorylated at Ser/Thr/Tyr residues in order to investigate their role in the regulation of virulence factors, especially via sugar utilization. We are working on a «gel free» approach to determine the phosphoproteome of L. monocytogenes. After digestion of total proteins with trypsin and endopeptidase Lys-C, the resulting phosphopeptides are enriched in two steps: first by cation exchange chromatography followed by enrichment on titanium beads. The samples are run on an LTQ Orbitrap mass spectrometer and phosphopeptides are identified by using different algorithms: Mascot in conjunction with Maxquant, Sequest and X!Tandem. All the sites of phosphorylation are validated by Ascore. The quantitative phosphoproteome of a prpC (stp) mutant, with innactivated S/T-specific P-protein phosphatase, are compared to the wild-type strain using SILAC. Quantification is realized via freely available softwares QUIL and MassChroQ*.

*http://pappso.inra.fr/bioinfo/


[P43] EasyMSI: a competitive software tool for the interpretation of Mass Spectrometry Imaging datasets

Jean-Pierre BOTH1, Vincent PICAUD1, Marie-France ROBBE1, Isabelle ESPAGNON1

1 CEA Saclay, LIST, Laboratoire d'Outils d'Analyses de Données, Bâtiment 516, 91191 Gif sur Yvette cedex

Contact: Jean-Pierre BOTH ([email protected])Keywords: Imaging mass spectrometry

EasyMSI is a software tool for spatial and spectral visualization and processing of mass spectrometry imaging, with several modules providing user assistance for the interpretation of data. It has been developed by CEA-LIST during the Computis European project (2006-2009) and the Masda-Eye ANR project (2010-2012).

EasyMSI can read MALDI and SIMS datasets in Analyze format (Applied Biosystems), GRD format (IonTof) and the imzML standard format for mass spectrometry imaging based on mzML. EasyMSI provides basic functionalities for data display and exploration (spectrum and image display, peak and pixel picking, zooming on spectra and images, ROI selection), and some more specialized treatments such as denoising spectra or structure analysis.

EasyMSI offers the advantage to display MALDI data without binning. The user can choose to bin or not SIMS data, and the associated binning rate.

As assistance to the interpretation of data, EasyMSI computes several indicators. The relative variance spectrum enhances peaks that have a highly contrasted space distribution. The Moran index is an autocorrelation indicator adapted to detect thin local structures such as membranes, in images. The correlation spectrum associated to a given m/z brings out correlated m/z, often co-localised or complementary with the given m/z.

EasyMSI is able to extract the peak list of the total spectrum, with parameterized criteria of extraction, to best adapt to the dataset peak shapes versus noise. Peak list can be used for molecule identification through the interrogation of biological databases.

EasyMSI also includes clustering tools to perform spatial (i.e. pixel-based) classification or spectral (i.e. m/z-based) classification on peak lists or binned data. The K-means clustering is one of the simplest and fastest classification methods. The time for running a K-means clustering usually lasts only some seconds. The hierarchical clustering enables to perform clustering inside a zone defined by a preceding clustering. The diffusion map method consists in reducing dimensionality by embedding data in a space in which data are more easily synthesized, and to do a clustering analysis in the reduced data.


[P44] Comparaison Triple-Quadripôle versus hybride quadripôle/temps-de-vol pour la quantification de peptides protéotypiques de cytochromes P450

Ahmad AL ALI1, David Touboul2, Alain Brunelle2, Olivier Laprévote3, Philippe Beaune1

1 Bases Moléculaires de la réponse aux xénobiotiques, INSERM UMR-S775, Centre Universitaire des Saints-Pères, 45 rue des Saint Pères, 75270 Paris Cedex 06 Paris, France2 Centre de Recherche de Gif, Institut de Chimie des Substances Naturelles, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette Cedex Gif-sur-Yvette, France3 Chimie Toxicologie Analytique et Cellulaire, EA4463, Faculté des Sciences Pharmaceutiques et Biologiques, Université Paris Descartes, 4 avenue de l’Observatoire, 75006 Paris Paris, France

Contact: Ahmad AL ALI ([email protected])Keywords: Proteins, peptides and small molecules quantification

Les cytochromes P450 (CYP) sont des enzymes essentielles dans le métabolisme des xénobiotiques. Ils participent de façon centrale à l’élimination des xénobiotiques et dans certains cas à la production de métabolites toxiques et/ou réactifs. Il est très important d’être capable de les doser individuellement avec précision, compte tenu de leur spécificité en terme de réactivité, ce qui est rendu délicat par leurs similitudes de séquences.Les CYPs sont en général quantifiés par amplification de gènes (PCR) ou immuno-marquage mais ces méthodes donnent soit une information indirecte (quantité d’ANR messager), soit une information lacunaire (difficulté de produire des anticorps spécifiques pour les CYP minoritaires). La spectrométrie de masse, permettant d’analyser de très faibles quantités de protéines en mélange, peut être considérée comme une méthode de choix pour l’identification et la quantification de CYP.Trois CYPs (1A2, 2D6, 2J2) ont été choisis comme modèles. Après digestion trypsique des protéines sur-exprimées dans des baculosomes, 7 peptides protéotypiques ont été identifiés puis synthétisés. Afin d’évaluer la technique la plus sensible et robuste de dosage par spectrométrie de masse, deux instruments (triple quadripôle et hybride quadripôle/temps-de-vol avec cellule de mobilité ionique) utilisant différents modes d’analyses (SIM, pseudo-SRM, MRM) et couplés à une chaîne UPLC ont été évalués. En mode SIM, les deux appareils ont montré des performances identiques. La mobilité ionique ne permet pas une quantification des peptides mais peut aider à leur identification. Finalement le mode MRM du triple quadripôle s’avère moins sensible mais plus spécifique que le mode SIM. Afin de finaliser cette étude, les peptides protéotypiques marqués 13C et 15N vont être synthétisés et les différents modes d’analyse seront comparés sur des échantillons biologiques complexes (biopsies de foie et de cerveau humains).


[P45] Nucleotide cycle in the archeal aIF2 system probed by native and denaturing mass spectrometry.

Christian Malosse1, Emmanuelle Schmitt2, Yves Mechulam2, Michel Panvert2, Guillaume van der Rest1

1 Laboratoire des mécanismes réactionnels DCMR, Ecole polytechnique route de saclay, 91128 palaiseau2 Laboratoire de biochimie, Ecole polytechnique route de saclay, 91128 palaiseau

Contact: Christian Malosse ([email protected])Keywords: Systems biology, High mass and high resolution mass Spectrometry

In eukaryotes, a 43S complex, comprising a ribosomal 40S subunit, eukaryotic initiation factors (eIF), 1, 1A, 3, 5 and eIF2:GTP:Met-ARNtiMet binds to the 5’-capped end of mRNA with the help of eIF4s and scans downstream to the initiation codon to form a 48S complex. Regulation of the nucleotide cycle of e/aIF2 is crucial for the accuracy of the initiation of translation.In archaea, orthologs of eukaryotic subunits are presents and the corresponding heterotrimeric factor was therefore named aIF2. However, archaea have no equivalent of the catalytic subunit of eIF2B (eIF2Bε and of eIF5. Therefore, GTP hydrolysis on aIF2 is likely to occur without GAP assistance, and the recycling of aIF2-GDP into aIF2-GTP is thought to be spontaneous. Nevertheless, until now, no measurement of the kinetic or equilibrium association constants for GTP and GDP binding to aIF2 are available. Therefore, new methods allowing such measurements are required to understand the nucleotide cycle on archaeal aIF2 and to give new insights into the specificity of the initiation of translation in archaea. Non-covalent and dissociative mass spectrometry approaches have been carried out using Q-TOF nano-ESI experiments on the Sulfolobus solfataricus aIF2 complex incubated with various nucleotides. Native mass spectrometry measurements were conducted after Bio-Spin column desalting of the initial protein solution. Measurement of the purified native complex led to the observation of an intact complex (charge states 19-23+, 93 kDa) containing all three subunits, as well as a Zn2+ cation and a GDP nucleotide. The latter was unexpected, as the solution did not contain any additional GDP, which should have shifted the equilibrium towards complete GDP loss. Furthermore, after incubation in GDP, GDP-NP, or GTP, one observes formation of complexes bearing two nucleotides, indicating the presence of a second, weaker binding site. Gas-phase dissociation of the native complex gave insights as to the general topology of the complex, and the subunits on which the cofactors (Zn2+, nucleotides) are bound. Denaturing the complex gives access to the individual elements of the complex, and interestingly allows measurement of the incorporation of GDP vs GTP (or GDP-NP), which is not possible on the intact complex. Combining native and denaturing approaches on the same samples leads to the determination of both kinetic and thermodynamic parameters for the aIF2 nucleotide binding.


[P46] Photofragmentation and action spectroscopy of gas phase peptide and protein polyanions. From near-UV to vacuum UV.

Claire Brunet1, Rodolphe Antoine1, Philippe Dugourd1, Francis Canon2, Alexandre Giuliani2, Laurent Nahon2

1 Laboratoire de Spectrométrie Ionique et Moléculaire, Bat. A. Kastler, 43 bd du 11 novembre, 69622 Villeurbanne Cedex2 SOLEIL, l'Orme des Merisiers, St Aubin, 91192 Gif sur Yvette Cedex3 Cepia, Institut National de la Recherche Agronomique (INRA), BP 71627, 44316 Nantes

Contact: Claire Brunet ([email protected])Keywords: Organic and inorganic mass spectrometry

Photon activation methods are emerging techniques[1, 2] complementary to collision or electron based methods for structural characterization of peptides and proteins. Especially in the UV range, the photon induces an electronic excitation of molecular ions. After excitation, direct dissociation in excited states competes with internal conversion to the electronic ground state and with radiative de-excitation. Therefore, new fragmentation channels may be opened.

For peptide and protein polyanions containing natural aromatic amino-acids, electron photodetachment is the main relaxation channel observed after UV excitation[3]. This results in a radical species, which can be isolated and further activated by collisions (activated-EPD)[4]. Experiments on peptides and proteins will be described in this presentation.

The synchrotron radiation allows us to work in the vacuum UV (under 200 nm), where electronic excitations are originating from absorptions of different natures and locations in polypeptides and may open new pathways for electron loss and/or fast dissociation products. Results on caerulein model peptide will be given as example in this presentation.

Besides activated-EPD experiments, electron photodetachment yield as a function of photon energy can be used to record optical spectra of peptide and protein ions. Action spectra for both non-radical and radical caerulein ions and protein polyanions will be presented[5].

1. Ly, T. and Julian, R.R., Ultraviolet Photodissociation: Developments towards Applications for Mass-Spectrometry-Based Proteomics. Ang. Chem. Int. Ed., 2009. 48, p. 7130-7137.2.Reilly, J.P., Ultraviolet Photofragmentation of Biomolecular Ions. Mass Spectrom. Rev., 2009. 28, p. 425-447.3.Joly, L., et al., Ultraviolet Spectroscopy of Peptide and Protein Polyanions in Vacuo: Signature of the Ionization State of Tyrosine. J. Am. Chem. Soc., 2007. 129, p. 8428-8429.4.Larraillet, V., et al., Activated-Electron Photodetachment Dissociation for the Structural Characterization of Protein Polyanions. Anal. Chem., 2009. 81, p. 8410-8416.5.Brunet, C., et al., Vacuum UV Electron Photodetachment Dissociation of Peptide Polyanions. Submitted.

Link: http://www-lasim.univ-lyon1.fr/spip.php?rubrique8


[P47] Etudes de l’adsorption des protéines de plasma riche en plaquettes sur un biomatériau en titane bioactivé avec du polystyrène sulfonate de sodium

S. Oughlis 1, F. Poirier1, S. Lessim1, S. Changotade1, G. Helary1, F. Bollotte1, J.J. Lataillade2, V. Migonney1, D. Lutomski1

1 UMR CNRS 7244 - CSPBAT – LBPS , 74 rue M. Cachin UFR, SMBH Léonard de Vinci, Université Paris 13 , 93000 Bobigny, France2 Laboratoire de thérapie cellulaire, CTSA, HIA Percy , 92140 Clamart

Contact: S. Oughlis ([email protected])Keywords: Separative analysis methods, Organic and inorganic mass spectrometry

Le titane est couramment utilisé dans les implants orthopédiques et dentaires pour son excellente résistance à la corrosion et sa biocompatibilité. Malgré cela, 15% des prothèses posées chaque année en France, sont des ré-interventions après échec de la prothèse de première intention. La principale cause d’échec reste des problèmes d’ostéointégration avec descellement aseptique par décohésion de l’interface os/implant, due à une destruction progressive des tissus biologiques au contact de la prothèse (formation d’un tissu fibreux).

Afin d’améliorer l’ostéointégration à long terme du titane, nous avons développé des protocoles permettant de greffer de manière covalente des groupements chimiques à la surface du métal. Cette modification chimique par polymérisation radicalaire de polymères bioactifs porteurs de groupements ioniques tels que le sulfonate (polystyrène sulfonate de sodium) permet de moduler la fixation des cellules et l'activité cellulaire des ostéoblastes.

Néanmoins, la fixation biologique de la prothèse à l’os est influencée par plusieurs facteurs, incluant la nature de la prothèse, la chimie de surface mais également les protéines adsorbées à la surface.

Le plasma riche en plaquettes (PRP) contient des facteurs de croissance connus pour favoriser la régénération osseuse et pour avoir des applications potentiels en ingénierie tissulaire. Dans le cadre de cette étude, l’utilisation combinée du titane bioactivé et du PRP a été envisagée. Du PRP a été adsorbé de façon non covalente sur la surface du titane bioactivé. Pour identifier les protéines adsorbées sur la surface de titane, dans un premier temps, les protéines ont été désorbées du biomatériau. Elles ont ensuite été séparées par électrophorèse bidimensionnelle avant d’être identifiées par spectrométrie de masse par la technique d’empreinte peptidique massique. Les propriétés de surface montrent une sélectivité du titane bioactivé vis-à-vis de certaines protéines du PRP.

Dans un second temps, des études in vitro ont été réalisées afin d’étudier le comportement de cellules souches mésenchymateuses humaines (CSM) sur du titane bioactivé sur lequel des protéines de PRP ont été adsorbées.

Link: http://www.univ-paris13.fr/cspbat/accueil.html


[P48] Structure and dynamics of membrane proteins using hydrogen/deuterium exchange: how to cope with detergents.

Shahid Mehmood1, Martial Rey2, Benjamin Clémençon2, Ludovic Pelosi2, Jean-Michel Jault1, Petr Man3, Eric Forest1

1 Institut de Biologie Structurale, 41 rue Jules Horowitz, 38027 Grenoble, France2 Laboratoire de Biologie à Grande Echelle, iRTSV, 17 rue des Martyrs, 38054 Grenoble, France3 Institute of Microbiology, Videnska 1083, 14220 Prague, République Tchèque

Contact: Eric Forest ([email protected])Keywords: Systems biology

Membrane proteins represent 30% of the proteins coded by the human genome and 50% of drug targets. Although it is critical to understand the interplay between structure, function and dynamics, elucidation of their structure remains a major challenge due to their hydrophobic nature. HDX MS offers an alternate approach to probe structure and dynamics of membrane proteins even though developments are needed to cope with detergents, necessary for solubilization, but often deleterious to MS.Different transmembrane proteins were extracted with different detergents: dodecyl maltoside (DDM), Triton X100 or C8E4, chosen among several for their capacity to solubilize them and to be eliminated before reaching the ESI source. After deuteration in vitro, or directly in the mitochondria, the membrane proteins were digested with immobilized pepsin or rhizopuspepsin in presence of 1.5 M guanidinium chloride. In the case of DDM the separation column was connected to the electrospray source until 30% acetonitrile and then disconnected to avoid pollution of the source by the detergent. The other detergents were washed with dichloromethane after proteolysis of the deuterated proteins and before elution of the peptides.The ABC transporter BmrA exports multiple drugs out of the cell in vivo, hence conferring multidrug resistance. It is capable of hydrolyzing ATP in a transient closed conformation. After membrane extraction with DDM, HDX was compared for open and closed conformations, giving information on the transport mechanism at the level of the nucleotide binding and intracellular domains. VDAC, a beta-barrel porin from the outer membrane of mitochondria, was extracted with C8E4. HDX showed that the N-terminal part is structured, in agreement with the X-ray structures (but in contrast with NMR observations).The ADP-ATP carrier, in the inner membrane of mitochondria, imports ADP from the intermembrane space and exports ATP from the matrix. After extraction with Triton X100, the comparison of HDX for two different inhibited states of the bovine carrier enabled us to propose a model of the translocation mechanism. After direct deuteration of bovine mitochondria and fast extraction of the carrier the difference of HDX for both inhibited forms was similar to the differences observed in vitro except for the matrix loops. These loops are much less exchangeable in the in situ experiments, indicating probably a stronger interaction with the native membrane. Finally the yeast ADP-ATP carrier was also studied. No X-ray structure has been solved. However HDX results were compared with biochemical and mutagenesis data, giving further evidence that the translocation mechanism involves a conformational change of matrix loop m2.These HDX MS studies on different transmembrane proteins and with different detergents could be extended to gain insight on the structure and dynamics of various membrane proteins.


[P49] Unusual Peptide fragmentation by C-terminal residue exclusion in ESI and MALDI Tandem Mass Spectrometry

Christine Enjalbal1, Mathieu Dupré1, Sonia Cantel1, Jean Martinez1

1 Institut des Biomolécules Max Mousseron (IBMM), UMR 5247, Université Montpellier 2, 34095 Montpellier

Contact: Christine Enjalbal ([email protected])Keywords: Organic and inorganic mass spectrometry

By screening a dataset of 150 synthetic peptides MS/MS spectra, we found that an unexpected fragmentation was occurring from monoprotonated molecular ions in both ESI and MALDI tandem mass spectrometry upon low and high energy collision activated dissociations with QqTof and Tof/Tof mass analyzer configuration, respectively. The residue positioned at the C-terminal end was lost provided that a basic amino acid, such as arginine and to a lesser extent histidine and lysine, was present in the sequence leading to a new y-type ion corresponding to a shortened peptide. Such a residue exclusion from the sequence gave a fragment ion that was in certain cases the base peak of the MS/MS spectrum. A potent fragmentation mechanism was envisaged within the frame of the mobile proton model. Thus, regarding proteomics studies, any miscleavage from trypsin protein digestion or the use of other proteolytic enzymes (such as Lys-N for instance) will lead to arginine-containing peptides showing such parasite fragmentation from the MH+ precursor ion.


[P50] Apport de la spectrométrie de masse à haute résolution pour la détection ciblée ou non ciblée de PBDE et de leurs métabolites par LC-APPI-MS.

Charlotte MARTEAU1, Sylvie CHEVOLLEAU1, Jean Philippe ANTIGNAC3, Bruno LE BIZEC3, Daniel ZALKO2, Laurent DEBRAUWER1

1 INRA, TOXALIM UMR1331 INRA-INP-UPS, plateforme MetaToul, BP 93173, 31027 Toulouse, France2 INRA, TOXALIM UMR1331 INRA-INP-UPS, BP 93173, 31027 Toulouse, France3 ONIRIS, USC 2013 INRA, LABERCA, Atlanpôle-La Chantrerie, BP 50707, , 44307 Nantes, France

Contact: Laurent DEBRAUWER ([email protected])Keywords: Organic and inorganic mass spectrometry, Separative analysis methods

Les polybromodiphenylethers (PBDE) constituent l’une des principales familles de retardateurs de flamme bromés (RFB) utilisés dans l’industrie des plastiques et des polymères. Leur présence a été mise en évidence dans tous les compartiments environnementaux, et leur devenir dans l’environnement et chez l’animal constitue une préoccupation importante. Cependant, l’analyse de ces composés et de leurs métabolites reste un défi analytique important en raison à la fois de leur diversité en termes de poids moléculaire (pouvant aller de 250 à 950) et de la complexité des mélanges de congénères natifs ou métabolisés. Pour ces raisons, bien qu’elle présente certaines limitations pour l’analyse des congénères fortement bromés ainsi que pour certaines classes de métabolites, la GC-MS reste à l’heure la technique la plus utilisée pour la détection des PBDE [1].Lors de précédents travaux, nous avons montré que la photo-ionisation à pression atmosphérique (APPI) pouvait constituer une méthode performante pour l’analyse des PBDE par LC-MS [2,3], et étudié le comportement de ces composés vis-à-vis de cette technique d’ionisation [4]. Nous présentons ici une étude sur le développement d’une méthode LC-APPI-MS à haute résolution sur un instrument à piège orbital, pour l’analyse de PBDE et de leurs métabolites par LC-MS.Plusieurs colonnes de type UPLC (greffages C18 ou PFP, 100mm ou 150 mm) ont été testées pour leur capacité à séparer des mélanges de PBDE et PBDE hydroxylés pouvant comporter un nombre important d’isomères de position, et dont la séparation par HPLC reste difficile. Les paramètres d’ionisation par APPI (nature et % de dopant, débit de phase mobile, température du nébuliseur chauffé) ont ensuite été optimisés. Le comportement de différents congénères modèles de PBDE et PBDE hydroxylés vis-à-vis de l’ionisation APPI a été étudié de façon à identifier les signaux de travail les plus pertinents.Nos résultats montrent que la spectrométrie de masse à haute résolution offre une meilleure sélectivité de détection que la MRM étudiée en comparaison, avec une sensibilité équivalente. Une application à l’identification de métabolites du BDE-47 formés in vitro sera présentée, montrant que l’acquisition en mode spectre complet à haute résolution permet non seulement la détection de métabolites ciblés mais également l’identification de nouveaux métabolites non ciblés.[1] A. Vonderheide, Microchem. J. (2009) 92, 49-57.[2] L. Debrauwer, A. Riu, M. Jouahri, E. Rathahao, Jouanin I., Antignac J.P., Cariou R., Le Bizec B., Zalko D., J. Chromatogr. (2005) 1082, 98-109.[3] L. Debrauwer, C. Marteau, D. Zalko, S. Chevolleau, Spectra Analyse (2010) 276, 38-44.[4] A. Riu, D. Zalko, L. Debrauwer, Rapid Commun. Mass Spectrom. (2006) 20, 2133-2142.


[P51] Quantification of total ApoE and ApoE4 isoform by targeted mass spectrometry across a clinical cohort (n=800): a case study for SRM-based assay validation and methionine-containing proteotypic peptide.

Romain Simon1, Catherine Fonbonne1, Jean Charles Lambert2, Philippe Amouyel2, Jean Philippe Charrier3, Arnaud Salvador1, Jérôme Lemoine1

1 Institut des Sciences Analytiques UMR 5280, Bd 11 Novembre 1918, 69622 Villeurbanne2 Institut Pasteur de Lille, Lille Centre, 59800 Lille3 bioMérieux, Chemin de l'Orme, 69280 Marcy l'Etoile

Contact: Jérôme Lemoine ([email protected])Keywords: Clinical proteomics, Proteins, peptides and small molecules quantification

Cerebrospinal fluid and plasma apoE levels have been proposed as diagnostic biomarkers to discriminate patients with Alzheimer disease (AD) against normal ederly. However, controversy remains about the clinical significance of plasma apoE levels due to inconsistency across the correlations between those patients, which might arise from different ELISA protocols and/or size and demographic cohorts. Coupling between liquid chromatography and targeted mass spectrometry, in the so-called selected reaction-monitoring mode (LC-SRM), has been shown to be an effective and orthogonal alternative to immuno-enzymatic tests for absolute protein quantification in biofluids. In the present study, we have developed SRM-based assays of total ApoE and ApoE4 isoform in plasma to address the lack of consensus regarding the possible association between ApoE and ApoE4 genotype and AD.AQUA standardization was carried out with the heavy forms of proteotypic sequence LGPLVEQGR tracking total ApoE and of allele specific sequence LGADMEDVR monitoring ApoE4 isoform, respectively. Robustness and precision of the workflow have been extensively evaluated over a one-month period, with 12 technical replicates per weak carried out by two experimentalists. Statistics on the replicates show CV’s better than 10% and a lower limit of quantification of 1 microgram/mL for the less sensitive peptide sequence LGADMEDVCGR specific of ApoE4 allele. The validated SRM-based assay was then applied to the absolute quantification of total ApoE and ApoE4 isoform across a clinical cohort of 800 patients.


[P52] IDENTIFICATION DE SUBSTRATS D’ENZYMES DE MODIFICATION DES ARN PAR SPECTROMÉTRIE DE MASSE MALDI-TOF et MALDI-TOF/TOF

Vincent Guérineau1, Amandine Guelorget2, Djemel Hamdane2, Béatrice Golinelli2, David Touboul1, Alain Brunelle1

1 Centre de Recherche de Gif, Institut de Chimie des Substances Naturelles, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette, France2 Centre de Recherche de Gif, Laboratoire d'Enzymologie et Biochimie Structurales, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette, France

Contact: Vincent Guérineau ([email protected])Keywords: Organic and inorganic mass spectrometry, Systems biology

Pour accéder à la base qu’elles modifient, les enzymes de modification des ARN retournent le nucléotide cible et plusieurs nucléotides voisins. Bien que de nombreuses structures cristallographiques de ces enzymes en complexe avec un ARNt aient révélé ce retournement de la base, la cinétique rapide du retournement du nucléotide cible par des enzymes de modification des ARN n’a jamais été étudiée par stopped-flow de fluorescence. En revanche, plusieurs études cinétiques de ce phénomène ont été réalisées sur des enzymes de modification de l'ADN. Cette approche est basée sur l’utilisation d’un analogue fluorescent de l’adénine, la 2-aminopurine, comme indicateur des changements conformationnels de la structure de l'ADN. Pour étudier le mécanisme de retournement de la base par les m1A58 méthyltransférases d’ARNt de T. thermophilus et de P. abyssi (TthTrmI et PabTrmI), la première étape était de trouver un mini- ARN substrat des enzymes TrmI. Les adénines 57 ou 58 de ce mini-substrat sont remplacées par une 2-aminopurine (2AP57 et 2AP58) et les deux mini-ARN ainsi obtenus sont testés comme substrats de TthTrmI et PabTrmI.

Le mini-ARN 29-mer est incubé avec l'enzyme TthTrmI ou PabTrmI. La réaction est stoppée par ajout d’un mélange phénol/chloroforme/alcool isoamylique pour précipiter la protéine. L'ARNt est extrait par centrifugation et précipitation éthanolique puis dessalé sur une colonne MicroSpin G-25. L'ARNt est ensuite digéré par la RNase A. Les oligonucléotides résultants sont analysés par spectrométrie de masse MALDI-TOF en mode réflectron positif. La matrice DHB est choisie et le mode de dépôt « dried droplet » utilisé. Les oligonucléotides modifiés d’intérêt (incrément de masse dû aux méthylations supposées) sont étudiés par spectrométrie de masse MALDI-TOF/TOF en mode MS et MS/MS (gaz de collision Ar, P=4,6x10-6 hPa, énergie de collision 2 keV).

Le spectre de masse du produit de digestion du mini-ARN à partir de l'échantillon témoin (non incubé avec l'enzyme) contient tous les pics attendus confirmant la séquence nucléotidique. Après incubation avec l'enzyme TthTrmI, le spectre MS montre un ion à m/z 1326,17 correspondant à l’oligonucléotide AAAUp monométhylé. Le spectre MS/MS indique que la méthylation est localisée uniquement sur l’adénine 58, comme l’indiquent les ions fragments à m/z 997,18 (y3) et 673,14 (c2). Après incubation avec PabTrmI le fragment AAAUp est diméthylé et le spectre MS/MS montre que ces méthylations sont localisées sur les adénines 57 et 58. Nos résultats montrent que l’ARN 29-mer est un substrat de TthTrmI et de PabTrmI. Nous avons également déterminé que la 2-aminopurine n’est pas méthylée par les enzymes TrmI. Ceci nous permettra par la suite de différencier la méthylation des autres étapes catalytiques de façon à pouvoir attribuer les vitesses correspondant à la liaison de l’ARN à l’enzyme, puis du retournement de la base par stopped-flow de fluorescence.


[P53] Etude de la distribution spécifique de sels de benzalkonium par imagerie par spectrométrie de masse : Application à la pharmacocinétique oculaire chez le lapin.

Grégory Hamm1, Nicolas Desbenoit2, Raphael Legouffe1, Christophe Baudouin2, Alain Brunelle3, Isabelle Fournier4, Olivier Laprévote3, Maxence Wisztorski4, Françoise Brignole-Baudouin2, Jonathan Stauber1

1 ImaBiotech, Campus Cité Scientifique, 59655 Villeneuve d’Ascq, France2 Institut de la Vision, INSERM, UMR_S968, 17 rue Moreau, F-75012 Paris, France3 Institut de Chimie des Substances Naturelles, Centre de recherche de Gif, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette, France4 Laboratoire de Spectrométrie de Masse Biologique Fondamentale et Appliquée (FABMS), EA 4550, Université de Lille, 59655 Villeneuve d’Ascq, France5 Chimie Toxicologie Analytique et Cellulaire, EA 4463, Faculté des Sciences Pharmaceutiques et Biologiques, Université Paris Descartes, 4 Avenue de l’Observatoire, 75006 Paris, France

Contact: Grégory Hamm ([email protected])Keywords: Imaging mass spectrometry

Les chlorures de benzalkonium (BAK) sont les conservateurs les plus largement utilisés dans les collyres, présents généralement sous forme de sel de benzododecinium (C12) et myristalkonium (C14). Ils permettent d’améliorer la pénétration des composés actifs. Cependant, certaines études ont reporté un possible effet toxique de ces derniers au niveau de la surface oculaire et plus particulièrement dans le cadre de traitements de longue durée comme celui contre le glaucome [1]. Ainsi, l’imagerie par spectrométrie de masse est utilisée afin de caractériser la distribution spatiale des BAKs et évaluer leur impact physiologique au niveau moléculaire. Cette étude a été réalisée sur des yeux de lapin instillés avec des solutions de BAKs pendant différents temps de cinétique (1 ou 5 mois) et nous as permis de détecter deux types d’ions m/z 304.32 et m/z 332.36 correspondant respectivement au BAK C12 et C14. Une approche multi-technique a été choisie afin de mener ces travaux utilisant la spectrométrie de masse MALDI-TOF, le TOF-SIMS [2] ou encore le MALDI-Orbitrap. Cela a permis de faciliter la détection d’un large panel de composés (petites molécules, lipides [2], peptides, etc…) et d’accéder aux plus hautes résolutions spectrale et latérale. Cette présentation sera consacrée plus précisément aux résultats d’imagerie MALDI-TOFMS. Nous discuterons de la localisation spécifique et de l’accumulation des BAKs dans certaines zones histologiques d’intérêt (cornée, angle iridocornéen, conjonctive, limbe,…) connues pour être des régions inflammatoires de l’œil. L’apport de la haute résolution latérale sera démontré sur deux régions de l’œil particulièrement importantes que sont le trabéculum et le nerf optique. Nous pointerons également une différence fine de comportement des deux types de BAK suivant leur structure. De plus, leur présence sera validée par des études structurales par spectrométrie de masse en tandem ou assimilées. Par exemple, le mode FAST-SRM permettra de suivre un fragment spécifique d’un composé, dans notre cas, m/z 212.42 (fragment du BAK C12) et ainsi valider sa distribution au niveau des structures oculaires précédemment citées. Des expériences croisées ont également été menées entre deux laboratoires utilisant différents spectromètres de masse MALDI-TOF et modes de déposition de matrice afin de valider ces données. L’imagerie par spectrométrie de masse apparait donc comme un outil de choix pour l’étude de la distribution de composés connus pour avoir des effets délétères et peut être utile dans le cadre d’étude préclinique dans les domaines pharmacologique et toxicologique.

1 Baudouin, C., Detrimental effect of preservatives in eyedrops: implications for the treatment of glaucoma. 2008, Blackwell Publishing Ltd. p. 716-726.2 Desbenoit, N., SMAP 2011, Avignon


[P54] Polymères synthétiques à groupement terminal fragile : pré-traitement de l’échantillon avant analyse MALDI

Christophe Chendo1, Caroline Barrère2, Valérie Monnier1, Thomas Trimaille3, Trang N.T. Phan3, Didier Gigmes3, Stéphane Viel2, Stéphane Humbel4, Laurence Charles2

1 Fédération des Sicences Chimiques - CNRS, FR1739, Spectropole, Campus Scientifique de St Jérôme - Av. Escadrille Normandie Niemen, 13397 Cedex 20 Marseille2 Laboratoire Chimie Provence, UMR 6264, Equipe Spectrométries Appliquées à la Chimie Structurale, Campus Scientifique de St Jérôme - Av. Escadrille Normandie Niemen, 13397 Cedex 20 Marseille3 Laboratoire Chimie Provence, UMR 6264, Equipe Chimie Radicalaire, Organique et Polymères de Spécialité, Campus Scientifique de St Jérôme - Av. Escadrille Normandie Niemen, 13397 Cedex 20 Marseille4 Institut des Sciences Moléculaires de Marseille, UMR 6263, Equipe Chimie Théorique et Mécanismes, Campus Scientifique de St Jérôme - Av. Escadrille Normandie Niemen, 13397 Cedex 20 Marseille

Contact: Christophe Chendo ([email protected])Keywords: Organic and inorganic mass spectrometry

Les techniques de polymérisation radicalaire contrôlée (PRC) sont très largement utilisées pour synthétiser divers types de polymères de faibles indices de polydispersité en maîtrisant leur taille. Parmi ces techniques, la polymérisation assistée par nitroxyde (NMP) repose sur le piégeage réversible de radicaux polymères par l’espèce radicalaire stable qu’est le nitroxyde. Parmi les radicaux les plus utilisés, le nitroxyde SG1 (N-(2-méthylpropyl)-N-(1-diéthylphosphono-2,2-diméthyl propyl)-N-oxyl) permet la synthèse de copolymères à blocs amphiphiles de type poly(oxyde d’éthylène)/polystyrène mais aussi la croissance de segments acrylates.

Cependant, l’homolyse réversible de la liaison C-ON qui est la base du processus NMP devient un inconvénient majeur lorsqu’il s’agit de caractériser ces macromolécules par spectrométrie de masse après ionisation MALDI. En effet, le nitroxyde SG1 devient un groupement terminal labile, éliminé sous forme radicalaire lors du processus MALDI et l’analyse des groupements terminaux n’est plus fiable. Une précédente étude a montré que lorsque le processus d’ionisation favorisait la protonation spécifique de l’azote du nitroxyde, la liaison C-ON liant SG1 au polymère était renforcée et des adduits cationiques intacts produits en phase gazeuse. Toutefois, les polymères synthétiques présentant une affinité protonique d’autant plus faible que leur taille augmente, cette méthode reste limitée à l’étude de petits oligomères.

Cette étude montre qu’une modification chimique du groupement terminal à l’issue de la polymérisation permet de renforcer la liaison C-ON et de conserver le groupement terminal lors de l’analyse MALDI. Le traitement du polymère par l’acide trifluoroacétique permet la substitution, par un atome d’hydrogène, du groupement tert-butyl porté par l’azote du nitroxyde. La production d’adduits intacts du polymère ainsi modifié montre que l’augmentation de l’énergie de dissociation de la liaison C-ON est effective et suffisante pour résister à l’augmentation d’énergie interne associée au processus MALDI. Cette méthodologie a été appliqué avec succès à l’analyse des polymères de type polystyrène, poly(oxyde d’éthylène) et poly(butylacrylate).


[P55] Complémentarité des méthodes GC-MS/EI et LC-MS/APPI pour la comparaison de 29 résines végétales

Boutayna Rhourri-Frih1, Laure Fanton2, Patrice André2, Caroline West1, Michel Lafosse1, Patrick Chaimbault3

1 Institut de Chimie Organique et Analytique (ICOA) UMR CNRS 6005 Université d'Orléans, Rue de Chartres - BP 6759, 45067 Orléans Cedex 2, France2 LVMH Recherche, 185, Avenue de Verdun, 45804 Saint Jean de Braye, France3 Laboratoire de Spectrométrie de Masse et de Chimie Laser (LSMCL). UPV-M .ICPM, 1, Boulevard Arago, 57078 Metz Technopole Cedex 03, France

Contact: Patrick Chaimbault ([email protected])Keywords: Separative analysis methods, Organic and inorganic mass spectrometry

Les résines sont des mélanges complexes contenant un grand nombre de composés terpènoïdes de structures proches dont certains ont des propriétés biologiques intéressantes. L’analyse de ces résines a été déjà largement réalisée par GC-MS/EI (1-3) mais les données (temps de rétention et fragments m/z) sont abondantes et laborieuses à utiliser pour comparer rapidement un grand nombre de résines. Par ailleurs il est parfois difficile de caractériser une résine nouvelle par manque de disponibilité des standards.Etant donné la provenance variée des 29 résines présentées dans ce travail (Inde, Cote d’ivoire, Madagascar, Pakistan, Afghanistan), la diversité des familles, genres et espèces (Gardenia gummifera, Daniellia oliveri, Boswellia serrata et dalzielli, Commiphera mukul et Canarium madagascariensis) dont elles sont issues et leur complexité (diterpènes, triterpènes, sesquiterpènes…) évoluant selon l’âge de la résine, il a été nécessaire, pour les comparer, d’utiliser deux méthodes chromatographiques couplées à la spectrométrie de masse de façon orthogonale (GC-MS/EI et LC-MS/APPI). Pour exploiter le grand nombre d’informations générées par ces méthodes, nous avons utilisé les diagrammes 3D bulles pour une comparaison rapide des résines. La méthode d’analyse par GC-MS/EI a été réalisée après silylation de l’extrait. Le diagramme 3D bulles représente en 2D chaque composé selon son temps de rétention et les valeurs m/z de chacun de leur fragment, chaque signal m/z étant représenté par une bulle dont la grosseur détermine l’intensité. Ainsi dans un groupe de résines il est possible de comparer celles qui sont similaires, celles qui ont des composés en commun et celles qui sont très différentes de façon qualitative et quantitative. Pour compléter l’étude, le même raisonnement est appliqué aux résultats obtenus par LC-MS/APPI dont la détection a été précédemment optimisée pour analyser les composés triterpénoides (4). Ces résultats confirment ou infirment ceux de GC-MS/EI.

1- C. Mathé, G. Culioli, P. Archier, C. Vieillescazes, Characterization of archaeological frankincense by gas chromatography–mass spectrometry, J. Chromatogr. A, (2004), 1023, 277-2852- Laura Osete-Cortina, Marıa Teresa Dom´enech-Carb´ Analytical characterization of diterpenoid resins present in pictorial varnishes using pyrolysis–gas chromatography–mass spectrometry with on line trimethylsilylation Journal of Chromatography A, (2005), 1065 265–2783- A. Otto, B. Simoneit, V. Wilde, L. Kunzmann, Wilhelm Püttmann Terpenoid composition of three fossil resins from Cretaceous and Tertiary conifers Review of Palaeobotany and Palynology (2002), 120, 203-215 4- B. Rhourrhi-Frih, P. Chaimbault, B. Claude, C. Lamy, P. André, M. Lafosse, Analysis of pentacyclic triterpenes by LC-MS. A comparative study between APCI and APPI, J. Mass Spectrom. (2009), 44, 71-80


[P56] Comparison of different liquid chromatography systems for the detection of low-level biomarkers in biological fluids by MRM

Florence Roux-Dalvai1, Violette Gautier1, Alexandre Stella1, Jérôme Lemoine2, Anne Gonzalez de Peredo1, Bernard Monsarrat1, Odile Burlet-Schiltz1

1 Institut de Pharmacologie et de Biologie Structurale, CNRS, UMR5089, Université de Toulouse, 205, route de Narbonne , 31077 Toulouse, France2 Institut des Sciences Analytiques, UMR 5280 CNRS, Université de Lyon, , 69622 Villeurbanne, France

Contact: Florence Roux-Dalvai ([email protected])Keywords: Clinical proteomics, Separative analysis methods, Proteins, peptides and small molecules quantification

Detection of low-abundant proteins in biological samples is usually hampered by limited sensitivity and dynamic range of mass spectrometers. In the Selected Reaction Monitoring (SRM) mode, the dynamic range problem is alleviated, as target parent and fragment ions are respectively selected in a narrow mass range window by the two quadrupole analyzers, filtering out other highly abundant peptide ions that otherwise would lead to signal suppression in a full MS scan. Nonetheless, SRM analysis of weakly concentrated molecule results in low ion currents in the mass spectrometer, and intrinsic sensitivity of the instrument may then become the limiting factor of the analysis. Injecting higher amounts of analyte in the mass spectrometer could thus in this case help to improve the detection of species present at very low level in a complex matrix.Here, we tested different sample processing methods and LC-MS instrumental settings to optimize the detection of biomarker candidates in two biological fluids. Increasing amounts of sample were loaded either on a 75µm I.D. capillary column coupled to a nanospray source, or on a 2mm I.D. column coupled to an ESI source. In each case, several proteins were monitored by SRM on a 5500QTrapTM mass spectrometer (ABSciex), in order to determine the optimal loading capacity of the chromatographic system. In the case of the nanoLC setting, samples were loaded on C18 precolumns with different loading capacity, and gradients of different lengths were tested in order to increase the amount of material loaded on the system without affecting the linearity of the MS response. For each experimental setting, the limit of detection by SRM of candidate biomarkers, spiked at different concentrations in plasma or cerebrospinal fluid, was determined. Our results indicate that the loss of sensitivity of conventional HPLC compared to nanoLC is balanced by the higher amount of sample that can be injected in the instrument, making this instrumental configuration an interesting alternative for the detection of low-abundant species, as long as the absolute quantity of starting material does not represent a limiting factor.


[P57] Détection rapide de toxines de la menace NRBC sur surfaces par DESI-MS

Alexandre Seyer1, François Becher1, François Fenaille1, Sandra Alves2, Jean-Claude Tabet2

1 CEA, iBiTec-S, Service de Pharmacologie et d’Immunoanalyse, , 91191 Gif-sur-Yvette, France2 Université Pierre et Marie Curie - Institut Parisien de Chimie Moléculaire, Chimie Structurale Organique et Biologique (CSOB), (UMR 7201), 4, place Jussieu, 75252 Paris cedex 05, France

Contact: Alexandre Seyer ([email protected])Keywords: High mass and high resolution mass Spectrometry

Parmi tous les agents liés au bioterrorisme répertoriés par le Center of Disease Control (CDC, Atlanta, USA), les toxines protéiques comme la ricine (issue de Ricinus communis) ou la toxine epsilon (issue de Clostridium perfringens) sont considérées comme des armes potentielles. Néanmoins, les méthodes de détection de ces toxines nécessitent souvent de longues étapes de préparation d’échantillon, allongeant ainsi le temps de réponse. Celles basées sur la spectrométrie de masse font notamment appel à des approches de reconnaissance anticorps/antigènes et de digestion enzymatique très sensibles mais pouvant demander plusieurs heures (≈ 16h).[1]Notre étude consiste à réduire au maximum ces étapes de préparation d’échantillon et à détecter ces protéines directement sur plusieurs types de surfaces, afin de rendre l’analyse réalisable à un plus haut débit. Ces objectifs pourraient être atteints grâce à l’utilisation d’un spectromètre de masse à haute résolution et précision de mesure de masse (LTQ-Orbitrap, Thermo Scientific, San Jose, CA) couplé à une source d’ionisation/désorption à pression atmosphérique de type DESI (Desorption Electrospray Ionization; Prosalia, Indianapolis, IN). La capacité de la source DESI à détecter des petites molécules (explosifs, drogues, pesticides…) a déjà été largement explorée,[2] mais son utilisation pour la détection de toxines de hautes masses moléculaires n’a pas encore été mise en valeur. Ainsi, nous avons évalué deux approches différentes. Une première, mettant l’accent sur la rapidité et la simplicité d’analyse, a consisté à détecter les toxines de manière intacte, et une seconde, plus sensible, faisant appel à une étape de digestion enzymatique in situ. Les paramètres expérimentaux, i.e. la composition du faisceau de gouttelettes primaires, la géométrie de la source DESI et le capillaire de transfert (capillaire ESI ou « nez » DESI), influençant le transfert des gouttelettes/agrégats secondaires dans le spectromètre de masse, ont été optimisés dans chaque cas (protéines intactes ou mélange complexe de peptides). Les résultats montrent qu’une dizaine de femtomoles d’une protéine modèle de 17 kDa déposée sur une surface hydrophobe, peuvent être détectées sans aucun traitement de l’échantillon. Il a aussi été possible d’identifier quelques picomoles d’une protéine de 66 kDa après seulement deux heures de digestion enzymatique in situ. L’objectif est maintenant d’appliquer ces méthodes à des toxines protéiques présentes dans diverses matrices complexes (eau de boisson, lait…) et sur différents types de surfaces (cartons, plastiques…).

[1] Duriez, E.; Fenaille, F.; Tabet, J.C.; Lamourette, P.; Hilaire, D.; Becher, F.; Ezan, E. J. Proteom. Res. 2008, 7, 4154-63.[2] Takáts, Z.; Wieman, J.M.; Cooks, R.G. J. Mass Spectrom. 2006, 40, 1261-75.


[P58] Etude du Profil de Méthylation de l’Histone 3 (H3.1) par Spectrométrie de Masse

Magalie Duchateau1, Monica Rolando2, Carmen Buchrieser2, Abdelkader Namane1

1 Plate-Forme de Protéomique, Institut Pasteur, 25-28 rue du Docteur Roux, 75724 Paris Cedex 15, France2 Unité postulante de Bioloie des Bactéries intracellulaires, 25-28 rue du Docteur Roux, 75724 Paris Cedex 15, France

Contact: Magalie Duchateau ([email protected])Keywords: Clinical proteomics, Signaling, interactomics and post-translational modifications

Cette étude s’intéresse à une protéine recombinante de Legionella pneumophila qui a la capacité de modifier les histones des cellules de l’hôte. Les histones sont de petites protéines basiques sujettes à de nombreuses modifications post-traductionnelles (MPT) comme les acétylations, les phosphorylations ou encore les méthylations. La méthylation affecte particulièrement les résidus lysine et arginine, induisant des différences de masse de 14 Da (mono-méthylation), 28 Da (di-méthylation) ou 42 Da (tri-méthylation). Les variations d’expression de ces MPTs sont connues comme jouant un rôle clef dans de nombreux processus biologiques (activation , répression de la transcription…).

L’approche bottom-up classiquement utilisée en protéomique consiste à digérer la protéine d’intérêt par une enzyme, comme la trypsine, et à analyser les peptides résultant de cette digestion enzymatique par spectrométrie de masse couplée à la chromatographie liquide (LC-MS/MS). Bien que suffisante pour la majorité des protéines, la digestion trypsique présente des limitations pour l’étude des histones. En effet, les histones sont des protéines extrêmement riches en résidus lysine et arginine conduisant à l’obtention de nombreuses petites séquences peptidiques monochargées dont les spectres MS/MS sont difficilement interprétables. Ces résidus sont, de plus, particulièrement localisés du côté N-terminal des histones, là où le phénomène de méthylation est principalement attendu.

Afin de déterminer précisément le profil de méthylation de l’histone H3.1, deux stratégies complémentaires ont été mises en œuvre : (i) l’utilisation d’enzymes protéolytiques, autre que la trypsine, comme la lysine C évitant ainsi le clivage au niveau des résidus arginine, (ii) l’utilisation d’un peptide de synthèse correspondant aux 21 premiers acides aminés de notre protéine d’intérêt. Ce peptide, une fois la réaction de méthylation réalisée, a été étudié par approche top-down et les efficacités de plusieurs modes de fragmentation ont été comparées (CID, HCD et ETD). Cette combinaison d’approches nous a permis d’identifier et de localiser les résidus ayant subi une ou plusieurs méthylations.

Link: http://genopole.pasteur.fr/PF3


[P59] Differential proteomic 2d-dige analysis of failing left ventricles in mice overexpressing fkbp12.6

Patricia ROUET-BENZINEB1, Christian FEDERICI3, Miresta PREVILON1, Morgane LE GALL2, Guilhem CLARY2, Cédric BROUSSARD3, François GUILLONNEAU3, Philippe CHAFEY2, Jean-Jacques MERCADIER1

1 Inserm U698, Université Paris Diderot, 46 rue Henri Huchard, 75018 Paris2 Plateforme protéomique Institut Cochin, 22 rue Méchain, 75014 Paris3 Plateforme protéomique Université Paris Descartes, 22 rue Méchain, 75014 Paris

Contact: Philippe CHAFEY ([email protected])Keywords: Systems biology

In cardiac myocytes, FKBP12.6 (FK506 binding protein or calstabin 2) binds to and modulates the activity of the ryanodine receptor type 2 (RyR2), the Ca2+-channel of the sarcoplasmic reticulum (SR). FKBP12.6 is thought to favour synchronous RyR2 opening during systole and to prevent SR calcium leak during diastole. Increased Ca2+ leak through RyR2 during diastole has been implicated in the pathophysiology of heart failure (HF). We made the hypothesis that, by altering SR Ca2+ homeostasis, FKBP12.6 overexpression would influence Ca2+-dependent signalling pathways during pressure overload-induced HF. In addition, RyR2 may not be the only cellular target for FKBP12.6 in cardiomyocytes. We used our mouse model of cardiac specific conditional overexpression of FKBP12.6. Wild type (WT) mice and mice overexpressing FKBP12.6 (DT) were submitted to transverse aortic constriction (TAC) and compared at 30 days to sham-operated mice of the same genotype. We analyzed total proteins extracted from the LV of 48 mice of both gender (8 WT sham-operated (WT sham), 16 WT TAC, 8 FKBP12.6 sham-operated (DT sham), and 16 FKBP12.6 TAC (DT TAC)). TAC mice were selected for the presence of congestive heart failure according to the presence of pulmonary oedema (defined as the ratio of lung weight to tibia length > lung weight to tibia length in sham-operated mice + 3 SD). Quantitative differential proteomic analysis was performed using 2D-DIGE (2 Dimensional- Differential In-Gel Electrophoresis). Data processing and spot quantification were performed using DeCyder software (GE Healthcare Bio-Sciences). Spots differentially expressed in either group as compared to the others (WT Sham vs WT TAC, DT Sham vs DT TAC, WT Sham vs DT Sham, WT TAC vs DT TAC) were identified by tandem mass spectrometry. Our results show that there are a large number of differentially expressed proteins between WT and DT failing left ventricles. Whatever the alteration (up or down regulation), the effect appeared less pronounced in DT TAC than in WT TAC vs the respective sham group. Our Results will be described and discussed.


[P60] Analyses de xénobiotiques dans une matrice aqueuse pour valider un système d’élimination de ces composés

Marion Martignac1, Samuel Pollet2, Maïté Maurette1, Esther Oliveros1, Jacques Debuire2, Florence Benoit-Marquié1, Catherine Claparols3

1 Laboratoire des IMRCP (UMR CNRS 5623), Université Paul Sabatier (Toulouse III), 118 route de Narbonne, 31062 Toulouse Cedex 92 Loïra, Bât II, 1 rond point de Flotis, 31240 Saint Jean3 Laboratoire de Chime de Coordination, 205 route de Narbonne, 31077 Toulouse Cedex 44 Serv. Commun de Spectrométrie de Masse, université Paul Sabatier, 118 route de Narbonne, 31062 Toulouse Cedex 9

Contact: Catherine Claparols ([email protected])Keywords: Organic and inorganic mass spectrometry, Separative analysis methods

Les xénobiotiques, substances chimiques étrangères aux organismes vivants qui proviennent des utilisations humaines et vétérinaires [1], sont présents dans les eaux de différentes origines. Les rejets des industries chimiques et pharmaceutiques ainsi que ceux des établissements de soins, les eaux usées collectées par les égouts mais aussi les rejets d’élevages industriels, contiennent des xénobiotiques d’origine médicamenteuse [2]. Généralement, non totalement éliminées dans les stations d’épuration [3], ces substances sont rejetées dans le milieu naturel qu’elles perturbent avant de se retrouver à nouveau dans le circuit d’alimentation et de distribution d’eau potable [4,5]. Les impacts que les xénobiotiques peuvent avoir sur la santé humaine sont encore mal connus mais leurs conséquences même à très faible concentration (de l’ordre du ng/L) sur le comportement et la biologie de la faune piscicole sont déjà avérées [6].Pour lutter contre ce phénomène, la société Loïra expérimente un nouveau procédé (appelé Loïlyse), qui combine un bioréacteur à membranes avec un réacteur photochimique.Dans une phase d’évaluation préliminaire, certaines molécules organiques ont été choisies parmi celles référencées dans la littérature [7] (paracétamol, ibuprofène, diclofénac, 5FU, carbamazépine, parabène…). Il s’agissait de vérifier la dégradation de solutions synthétiques de ces molécules par le procédé Loïlyse. Les dégradations ont été effectuées sur des solutions de concentrations variables de composés purs et en mélanges; les solutions synthétiques ont été préparées dans de l’eau du robinet, de l’effluent de station d’épuration et de l’effluent hospitalier.Les dégradations sont suivies en LC/MS/MS (Q-Trap Applied Biosystems). La LC/MS/MS est la technique de prédilection en raison de sa polyvalence, de sa spécificité et sa sélectivité. Les tests que nous avons effectués montrent que la dégradation est pratiquement totale (concentrations non quantifiables, inférieures au seuil de détection (ng/L)) en seulement quelques minutes. De plus, la carbamazépine qui n’est pas du tout éliminée par les traitements des stations d’épuration [5,8] est dégradée par cette méthode.1. Virvoulet, G., Environnement Risques et Santé 5, 239-241 (2006)2. Langford K.H. et Thomas K.V., Environment International 35, 766-770 (2009)3. Piram A., Salvador A., Gauvrit J-Y, Lanteri P. et Faure R., Talanta 74, 1463-1475 (2008)4. Mompelat S., Le Bot B. et Thomas O., Environment International 35, 803-814 (2009)5. Togola A. et Budzinski, H., Journal of Chromatography A 1177, 150-158 (2008)6. Lange A., Parell G.C., Coe T.S., Katsu T.S., Urushitani Y., Iguchi T., Tyler C.R., Environmental Science & Technology 43, 1219-1225 (2009)7. Besse J.P., Garric J., Toxicology Letters 176, 104-128 (2008)8. Heberer T., Journal of Hydrology 266, 175-189 (2002)


[P61] Minimization of back-exchange in a top-down ecd/etd h/d exchange approach for protein structural characterization

Ophélie Robine1, Edith Nicol1, Guillaume van der Rest1, Julia Chamot-Rooke1

1 Laboratoire des Mécanismes Réactionnels, CNRS, Ecole Polytechnique, route de Saclay, 91128 Palaiseau, France

Contact: Ophélie Robine ([email protected])Keywords: High mass and high resolution mass Spectrometry

The association of hydrogen/deuterium exchange and mass spectrometry (HDX MS) emerged in past years as a powerful experimental tool capable of probing both structural and dynamic features of proteins. However, this approach suffers some important limitations due to the occurrence of (i) back-exchange, which can take place at different stages of the experiment, and (ii) scrambling between protons and deuterons in the gas phase, especially in MS/MS experiments. These processes have to be minimized in order to get interpretable results. In the course of the development of a top-down ECD HDX method based on the ECD fragmentation in the gas phase of the entire deuterated protein, difficulties arising in experimental reproducibility led us to analyze more deeply the different factors influencing the extent of back exchange as observed in the spectra. Indeed, although it has been show that ECD or ETD [1, 2] can minimize scrambling (intramolecular hydrogen migration process before backbone cleavage), back exchange that can occur before the fragmentation step can lead to uninterpretable results. However, back exchange is not easy to track since it can occur at different stages of the experimental procedure, from the quench step to the last desolvation process to form ions in the gas phase.In this work, we studied the different parameters having a potential influence on the back-exchange with the aim to find a set of optimized parameters allowing for robust HDX MS/MS experiments. The parameters tested were: solvent composition, temperature, flow rate and type of ion source. Several modes of sample introduction were studied : ice cooled syringe, which was first described by Pr. Jørgensen, as well as a home-made «cryosource» which is an air-locked box kept at low temperature (-30°C) where samples are stored before their introduction in the mass spectrometer. This study led us to a set of optimized experimental conditions that were further used for the analysis of peptides specifically designed for HDX experiments and small proteins. Our results clearly indicate that the minimization of back-exchange is a key parameter for successful HDX MS/MS experiments, providing robust and confident conditions for the analysis.

[1] K. Rand, et. al., Electron transfer dissociation facilitates the measurement of deuterium incorporation into selectively labeled peptides with single residue resolution, J. Am. Chem. Soc.,(2008), 130(51), 17453-17459[2] J. Pan, et. al., Electron capture dissociation of electrosprayed protein ions for spatially resolved hydrogen exchange measurements, J. Am. Chem. Soc.,(2008), 130(35), 11574-11576


[P62] Fragmentation patterns of unesterified bisphosphonates by electrospray tandem mass spectrometry

Erwann Guénin2, Thierry Jouenne1, Julie Hardouin1

1 Laboratoire PBS -UMR CNRS 6270, Université de Rouen, 76821 Mont-Saint-Aignan cedex2 Laboratoire CSPBAT , 74 rue Marcel Cachin, 93017 Bobigny cedex

Contact: Julie Hardouin ([email protected])Keywords: Systems biology

Bisphosphonates are important drugs for the treatment of a variety of bone diseases. Since some of these compounds have no chromophore, their detection is challenging and mass spectrometry (MS) appears to be an appropriate sensitive tool. Previous studies were done by ESI-MS(n) in positive and negative modes for studying bisphosphonates. The compounds were analyzed by ESI-MS(n) (1,2). Following the side chain and the esterification functions, different fragmentation pathways were deduced. Here, new unesterified bisphosphonates were synthesised. Our work deals with the analysis by ESI-MS(n) of these unesterified bisphosphonates on both an ion trap (to carry out MS(n) experiments (until n=5)) and a Q-TOF mass spectrometer (to have better mass accuracy) in positive and negative modes.The dissociation mechanisms of these prodrugs were elucidated both in positive and in negative ion modes. We presented here complete fragmentation fingerprints of the unesterified bisphosphonates both in positive and negative modes by ESI-MS(n). We showed the influence of the side chain on the fragmentation. Moreover the use of D2O allowed us to check the fragmentation pathways from the mass spectra acquired on a LTQ Velos Orbitrap. These fingerprints will be of great value for differentiating these potential prodrugs in complex biological mixtures.

(1) Hardouin, Guénin, Monteil, Caron, Lecouvey, Journal of Mass Spectrometry 2008, 43: 1037-1044.(2) Hardouin, Guénin, Malosse, Caron, Lecouvey, Rapid Communications in Mass Spectrometry 2008, 22: 2287-2300.


[P63] Protéomique fonctionnelle de la signalisation du récepteur TrkA dans la réponse au NGF versus proNGF dans le cancer du sein

Cyril Corbet1, Léo Aubert1, Hubert Hondermarck1, Xuefen Le Bourhis1, Robert-Alain Toillon1

1 INSERM U908 Signalisation des fecteurs de croissance dans le cancer du sein-Protéomique fonctionnelle, Cité Scientifique Bâtiment SN3, 3ème étage, 59655 Villeneuve d'Ascq, France

Contact: Cyril Corbet ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Notre laboratoire a démontré que le Nerve Growth Factor (NGF) est sécrété par les cellules cancéreuses de sein et qu’il induit leur prolifération, leur survie et leur migration/invasion suivant une boucle autocrine. Nous avons récemment mis en évidence que son précurseur, le proNGF, est aussi produit et sécrété par les cellules de cancer du sein. Longtemps décrit comme inactif biologiquement, les effets du proNGF dans les réponses cellulaires ont été sous-estimés voire ignorés. Quelques travaux commencent à les décrypter. Ainsi, dans les cellules neuronales, le proNGF est décrit comme un inducteur d’apoptose. Dans ce contexte, l’objectif de nos travaux consiste à dissocier et caractériser les effets du proNGF par rapport au NGF sur les cellules cancéreuses de sein. Grâce à l’utilisation de siRNA et d’inhibiteurs pharmacologiques spécifiques, nous avons montré que, bien qu’agissant via le récepteur tyrosine kinase TrkA, le NGF et le proNGF induisent des cascades de transduction différentes. Nous avons donc recherché les partenaires de ce récepteur par protéomique fonctionnelle. L’analyse protéomique LC-MS/MS a permis d’identifier des protéines différentiellement recrutées en fonction du ligand, avec l’existence nouvelle de co-récepteurs membranaires. Ces interactions sont en cours de validation par des techniques d’immunoprécipitation inverse et de co-localisation en microscopie confocale et leur rôle dans l’activation des voies de transduction est appréhendé par inhibition par siRNA et/ou anticorps bloquants. Ainsi, l’ensemble de nos résultats obtenus par cette approche de protéomique fonctionnelle montrent que les voies du NGF et du proNGF, bien qu’apparemment identiques, sont au contraire significativement dissociables. La discrimination de ces deux voies offre ainsi la possibilité de nouvelles modulations thérapeutiques dans le cancer du sein.


[P64] Identification systématique du peptidome exocellulaire de Lactococcus lactis

Mylène Boulay1, Alain Guillot2, Véronique Monnet1, Vincent Juillard1

1 Equipe Peptides et Communication Bactérienne, INRA, UMR1319 MICALIS, Domaine de Vilvert, 78352 Jouy en Josas2 Plate-Forme d'Analyse Protéomique de Paris Sud-Ouest, INRA, UMR1319 MICALIS , Domaine de Vilvert, 78352 Jouy en Josas

Contact: Alain Guillot ([email protected])Keywords: Separative analysis methods

La détection des peptides dans un milieu de culture bactérien représente un enjeu important. Certains sont potentiellement impliqués dans divers phénomènes physiologiques tels que l’induction de la virulence ou la communication cellulaire. Leur caractérisation s'est généralement faite en suivant des démarches ciblées s'appuyant sur leur purification. Notre objectif est de caractériser de façon systématique l'ensemble des peptides produits par la bactérie lactique Lactococcus lactis IL1403 pendant sa croissance dans un milieu chimiquement défini ne contenant pas de peptides au départ. La base de données génomiques utilisée a été enrichie avec les petites séquences codantes, généralement mal détectées, et qui ont été spécifiquement recherchées in silico dans le génome de L. lactis. Les peptides sont concentrés et pré-purifiés sur la base de leur hydrophobicité et leur taille avant d’être séparés par 2D-LC off line sur phase inverse de type C18. La première séparation chromatographique est réalisée à pH neutre. Chacune des fractions collectées est ensuite séparée à pH acide en couplage à un spectromètre de masse LTQ-Orbitrap. L’identification des peptides est réalisée par empreinte de fragmentation contre la base enrichie via X!tandem et Bioworks.Plus de 1500 séquences peptidiques distinctes ont été identifiées. Elles dérivent en majorité de protéines (> 10 kDa) de surface et, dans une moindre mesure, de protéines cytoplasmiques, ce qui reflète une activité protéolytique de surface. Des peptides fortement hydrophobes correspondant à des fragments de séquences signal d’adressage sont également identifiés. Pour des raisons encore indéterminées, peu de séquences attribuées aux petits gènes sont détectées.


[P65] Synthesis and structural characterisation of pamam and modified pamam using mass spectrometry

Emma-Dune LERICHE1, Gael Coadou1, Corinne Loutelier-Bourhis1, Martin Grossel2, Catherine Lange1

1 Université de Rouen, UMR 6014, COBRA, FR CNRS 3038, Rue tesnière, 76821 Mont-saint-Aignan cedex, France2 University of Southampton, School of chemistry, Highfield, Hants SO17 1BJ Southampton, UK

Contact: Emma-Dune LERICHE ([email protected])Keywords: Ionic mobility, Separative analysis methods

Polyamidoamine (PAMAM) dendrimer have grown in popularity in the past decade in variety of disciplines. This can be attributed to their application in biomedicine and their capacity to be used as nonviral gene delivery vector1. Indeed, PAMAM can function as highly efficient cationic vectors for delivering genetic material into cells. However, the shortcoming of these compounds is their quite significant cytotoxicity linked to their cationic surface. To decrease toxic effects and increase efficiency as drug and gene carrier of dendrimers, functionalization with hydrophobic groups on surface can be performed to minimize the overall charge density. The modification of PAMAM surface has been described in literature which related papers focus on biological aspect and cytotoxicity2,3.For this study, full generations of PAMAM (G0, G1) with ammonia and ethylenediamine (EDA) core4 activity and minimize cytotoxicity are under progress5. Synthesis and chemical modifications are performed according to 4-5. The structural characterization and identification of the synthesized dendrimers are performed by Electrospray/Multi-stage Mass Spectrometry (ESI/MSn)6. The purity and monodispersity of individual whole generation were monitored using capillary electrophoresis (CE), hydrophilic interaction liquid chromatography (HILIC) and Ion-mobility spectrometry (IMS).

1- Roseita Esfand and al., Drug discovery today, 2001, 6, 427-436. 2- R. Jevprasesphant and al., International Journal of Pharmaceutics, 2003, 252, 263-2663- R. B. Kolhatkar and al., Bioconjugate Chem. 2007, 18, 2054-20604- 5- D. A. Tomalia and al., Polymer Journal, 1985, 17, 117-1325- X. Wang and al., Biomacromolecules, 2010, 11, 245–2516- T. J.-C. Vincent, R. Dolé and C. M. Lange, Rapid commun. Mass Spectrom. 2008, 22: 363-372


[P66] Investigation of in-source decay of oxime-linked peptide by MALDI-TOF-MS

Julie Hardouin1, Gaëlle Anne Cremer 1, Agnès Delmas1

1 Centre de Biophysique Moléculaire - UPR 4301 CNRS, rue Charles Sadron, 45071 Orléans Cedex, France2 Laboratoire PBS - UMR CNRS 6270, Université de Rouen, 76821 Mont-Saint-Aignan cedex, France

Contact: Julie Hardouin ([email protected])Keywords: Organic and inorganic mass spectrometry

Chemoselective ligation methods which allow for the condensation of unprotected peptide fragments under mild aqueous conditions without any activation step have been of growing importance in the last decade for the preparation of peptide conjugates. These bioconjugation approaches are based on reactions belonging to the «click» chemistry repertoire. Oxime ligation is one of the most preferred procedures, due to the high chemoselectivity between aminoxy-conjugates and an aldehyde or a ketone provided that the high reactivity of aminooxy-linked peptides towards carbonyl-containing compounds and the N-overacylation of the NH-O group are well controlled. To characterize and improve these new procedures, it was necessary to reliably identify all the compounds associated with the targets. MALDI-TOF-MS is the preferred method for the routine characterisation of peptide-based conjugates because of its high sensitivity, rapidity, and simplicity of operation. Although MALDI is a soft ionization technique, a significant degree of decay behavior can occur in the source. In-source decay (ISD) is directly observed after desorption/ionization step in the source region (1-3). However, some prompt fragmentations of labile proline-containing peptides observed in a MALDI source cannot be understood as a classical ISD fragmentation as recently highlighted (4). UV laser irradiation can also lead to the photodissociation of photolabile molecules during MALDI analysis and product ions are detected in their mass spectra (5). Oxime-containing peptides are known to absorb UV irradiation in solution but, despite the use of oxime bioconjugation, only few articles have noticed that the oxime bond may dissociate during a MALDI analysis. We have therefore decided to investigate, in gas phase, the fragmentation of peptides containing an oxime bond by MALDI-TOF-MS. The goal of this study is to propose structures of these product ions generated in the MALDI source. For this purpose, different compounds were synthesized: two linear peptides with only one oxime bond and two branched peptides containing two oxime bonds.

(1)Brown and Lennon, Anal Chem, 1995, 67, 3990-3999.(2)Hardouin, Mass Spectrom Rev, 2007, 26, 672– 682.(3)Takayama, J Am Soc Mass Spectrom, 2001, 12, 420-427.(4)Sachon, Clodic, Blasco, Jacquot, Bolbach, Anal Chem, 2009, 81, 8986-8992.(5)Low, Kang, DiGruccio, Kirby, Perrin, Fischer, J Am Soc Mass Spectrom, 2004, 15, 1156-1160.


[P67] Application of Electrospray Charge-Detection Mass Spectrometry to the Characterization of «Megadalton» Sized Macromolecules and Block Copolymer Micelles

Tristan Doussineau1, Cong Yu Bao1, Wenjing Zhang2, Franck D’Agosto2, Bernadette Charleux2, Rodolphe Antoine1, Philippe Dugourd1

1 LASIM-UMR 5579 CNRS / UCBL, Domaine Scientifique de la Doua, Université Claude Bernard Lyon 1, Bâtiment Alfred Kastler, 43 Bd du 11novembre 1918, 69622 Villeurbanne, Cedex2 LCPP/C2P2-UMR 5265 CNRS/UCBL, Bât. CPE, 43 Bd du 11novembre 1918, 69622 Villeurbanne, Cedex

Contact: Rodolphe Antoine ([email protected])Keywords: Instrumentation

Mass is a critical parameter for characterization and identification of biological molecules, complexes, assemblies, and particles. The development of electrospray ionization (ESI) sources, has led to widespread applications of mass spectrometry in modern biomedical and biotechnology research. Very large objects, such as proteic complex assemblies and viruses were analyzed by electrospray mass spectrometry. However, the extension of ESI to the «mega- to gigadalton» size regime is trickier due to the large amount of charge that can be carried by such ions. Charge detection mass spectrometry (CD-MS) measures simultaneously the charge and the velocity of individual multicharged macroions allowing the determination of their respective mass.An innovative mass spectrometer based on charge detection has recently been developed in Lyon. In particular, the device was used to study poly(ethyleneoxide) (PEO) samples with average molecular weight ranging from 1,000,000 to 7,000,000 Da. This single event technique allowed mass and charge distributions to be determine for each sample as well as their respective polydispersity index.Moreover, 3D charge-vs-mass image were plotted allowing the investigation of the charging of these electrosprayed macroions as a function of concentration and nature of alkali cations present in sample solutions.

Self-assembled nanometric micelles prepared via RAFT-mediated emulsion polymerization of styrene using a poly(methacrylic acid-co-PEG methacrylate) macroRAFT agent with a trithiocarbonate reactive group have also been studied with the developed instrument. Mass distributions and polydispersity index have been compared to those obtained with conventional techniques.


[P68] Faire son choix parmi la multitude des techniques d'analyse d'un phosphoprotéome : application à celui de Bacillus subtilis.

Théophile Cocquerez1, Lauriane Kuhn1, Philippe Hammann1

1 Plate-forme Protéomique Strasbourg – Esplanade, Institut de Biologie Moléculaire et Cellulaire, FRC1589, 15 rue René Descartes, 67084 Strasbourg Cedex

Contact: Lauriane Kuhn ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Separative analysis methods

Le développement des plate-formes technologiques pour l'analyse des protéines par spectrométrie de masse permet à la communauté scientifique de disposer d'équipements de qualité pour réaliser des prestations de service et des collaborations dans le domaine de la protéomique. Notre plate-forme, située sur le site de l'Esplanade à Strasbourg, est sollicitée à la fois pour identifier les protéines contenues dans un échantillon plus ou moins complexe, mais aussi pour caractériser plus finement les éventuelles modifications portées par des protéines d'intérêt.

Les phosphorylations sont l'une des modifications qui rencontrent le plus d'intérêt. En effet, la phosphorylation des protéines est l'un des mécanismes de régulation le plus fréquent et le plus important, ayant un rôle prépondérant dans un très grand nombre de processus cellulaires. Cette modification post-traductionnelle, rencontrée sur les résidus sérine, thréonine et tyrosine, a très tôt séduit la communauté scientifique utilisant la spectrométrie de masse, donnant ainsi lieu au développement des stratégies d'analyse ciblées pour sa détection et sa caractérisation. Pour répondre à une demande croissante d'analyse de protéines phosphorylées, nous avons donc orienté nos développements sur ce sujet. Notre but est de pouvoir disposer de techniques d'analyse pour mettre en évidence la présence de phosphorylations sur des protéines isolées ou sur un extrait protéique plus complexe, à l'aide de techniques d'enrichissement de type MOAC et de la spectrométrie de masse disponible sur le site (MALDI-TOF/TOF et nanoLC-MSMS).

Le matériel biologique utilisé pour réaliser ces essais a été composé à la fois de standards protéiques (Beta-caseine, mélange de peptides synthétiques phosphorylés ou non) et d'un extrait protéique comprenant les protéines solubles de Bacillus subtilis. L'étude présentée ici a consisté à comparer les stratégies suivantes : (i) analyse off-gel en utilisant une approche nanoLC-MS/MS, (ii) une séparation par SDS-PAGE couplée à des analyses nanoLC-MS/MS et finalement (iii) une séparation par électrophorèse 2D couplée à des analyses par MALDI-TOF(/TOF). Pour chacune de ses 3 stratégies, les échantillons ont été : (i) soit analysés directement sans traitement préalable, (ii) soit après l'utilisation d'une technique d'enrichissement commerciale de type MOAC (comparaison de 3 kits commerciaux sous forme de cônes ou de spin-colonnes), (iii) soit avec l'utilisation de colorants révélant spécifiquement la présence de protéines phosphorylées sur gel d'électrophorèse.


[P69] Differential and quantitative analysis of dog oviductal fluid

Grégoire Harichaux1, Valérie Labas1, Marie Saint-Dizier3, Sylvie Chastant-Maillard3, Karine Reynaud3

1 INRA, Plate-forme d'Analyse Intégrative des Biomarqeurs, Centre de Recherches INRA de Tours, 37380 Nouzilly2 INRA, UMR INRA 85, Physiologie de la Reproduction et des Comportements – UMR CNRS 6175 – Université de Tours -IFCE, Centre de Recherches INRA de Tours, 37380 Nouzilly3 ENVA, UMR 1198 INRA-ENVA Biologie du Développement et Reproduction, 7 Avenue du Général de Gaulle, 94700 Maisons-Alfort

Contact: Grégoire Harichaux ([email protected])Keywords: Proteins, peptides and small molecules quantification

The major reproductive peculiarity of the bitch is that ovulation releases prophase I (Germinal Vesicle, immature) oocytes. Resumption of meiotic maturation, as well as fertilisation and embryonic development to the morula stage occur in the oviduct. The dog is a biomedical model of human diseases and also a model for endangered canid species, so the development of reproductive biotechnologies may be of great interest.In many mammalian species, embryos and offspring can be obtained in vitro. However, in the canine, in vitro-produced embryos remain exceptional and no puppy has been born to date after IVF. The main limiting factor of in vitro embryo production remains the in vitro oocyte maturation process and mean MII rates are usually around 10–20%. A better knowledge of the composition of oviductal fluid may help to mimic the in vivo conditions during in vitro maturation, fertilisation and embryonic development.

The objective of this study was to analyse the oviductal fluid by a label-free quantitative proteomic workflow based on SDS-PAGE protein separation, nanoLC-MS/MS analysis and quantitative method using spectral counting. Oviductal fluids were collected from 3 bitches, 3.5 days after ovulation (moment of oocyte maturation in the oviduct). Two oviductal regions (ampulla and isthmus) were dissected and flushed with 50µl of PBS. Oviductal fluids were submitted to 1D SDS-PAGE and all bands were digested with trypsin. Peptide extracts were analysed on an Ettan MDLC system (GE HealthCare) coupled to a linear ion trap LTQ mass spectrometer (Thermofisher). After protein identification using Mascot server with SwissProt and NCBI databases, bioinformatic processing of data and statistic analysis (T-test with p value < 0.05) were performed using the spectral counting quantitative module of the Scaffold software. Using this strategy, more than 420 proteins were qualitatively identified in canine oviductal fluid and the gene ontology analysis displayed biological pathways specific to the biology of reproduction. Quantitatively, few proteins were differentially expressed between ampulla and isthmus. Now, this list of protein candidates may to be validated by immonodetection methods.


[P70] FragMixer : un Programme pour l’Identification de Phosphopeptides à partir de deux Modes de Fragmentation MS/MS

Véronique Hourdel1, Mathias Vandenbogaert2, Olivia Jardin-Mathé2, Jean Bigeard3, Heribert Hirt3, Benno Schwikowski2, Delphine Pflieger4

1 Institut Pasteur, Plate-forme de Protéomique, 28 rue du Docteur Roux, 75015 Paris2 Institut Pasteur, Laboratoire de Biologie Systémique, CNRS URA 2171, 28 rue du Docteur Roux, 75015 Paris3 URGV Plant Genomics, INRA/CNRS/Université d’Evry Val d’Essonne, rue Gaston Crémieux, 91057 Evry4 Laboratoire Analyse et Modélisation pour la Biologie et l’Environnement, UMR CNRS 8587, Université d’Evry Val d’Essonne , bd Mitterrand, 91025 Evry

Contact: Delphine Pflieger ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics, Signaling, interactomics and post-translational modifications

Identifier par spectrométrie de masse des peptides phosphorylés est encore une entreprise difficile, parce que les spectres de fragmentation obtenus sur ces espèces ne contiennent pas toujours suffisamment d’ions pour établir avec certitude la séquence en acides aminés et les sites précis de phosphorylation. La combinaison de deux spectres de fragmentation a été décrite comme une option pertinente afin d’améliorer l’identification des phosphopeptides, par exemple en utilisant différents modes de fragmentation – CID, ETD et/ou HCD – disponibles sur les appareils hybrides comme le LTQ-Orbitrap. Les séquences identifiées à partir des deux spectres obtenus sur le même précurseur doivent alors être fusionnées en une unique séquence consensus, en termes de séquence en acides aminés et de site(s) de phosphorylation. Dans la présente étude, nous avons évalué, sur des échantillons de phosphopeptides analysés sur un appareil LTQ-Orbitrap, l’intérêt d’acquérir sur chaque précurseur sélectionné des spectres MS2 et MSA (MultiStage Activation) dans la trappe linéaire, en dépit de la forte similitude de ces deux spectres. Nous avons développé FragMixer, un programme qui détermine la séquence consensus à partir des identifications fournies par Mascot sur les paires de spectres. Le Mascot Delta score (1), différence de scores entre la première séquence théorique attribuée à un spectre MSn et la suivante, a été récemment validé sur des phosphopeptides synthétiques comme permettant de discriminer les sites de phosphorylation corrects à partir des résultats d’identification de Mascot. FragMixer, qui offre plusieurs options pour filtrer les séquences de peptides exportées, utilise essentiellement le Mascot Delta score afin d’établir les séquences phosphorylées consensus à partir des paires de scans acquises, en conservant automatiquement l’incertitude de position de phosphate si nécessaire. FragMixer permet de traiter les résultats d’identification Mascot obtenus sur les paires de spectres MS2/MSA testées dans cette étude, mais aussi d’autres paires de spectres qui requièrent des paramètres différents de recherche dans les banques (par exemple MSA/ETD ou ETD/HCD).

(1) Savitski MM et al. Confident phosphorylation site localization using the Mascot Delta Score. Mol Cell Proteomics. 2011 Feb;10(2):M110.003830.


[P71] Validation de la levure S. cerevisiae comme modèle d’étude de la translecture.

David Cornu1, Sandra Blanchet2, Manuela Argentini3, Jean-Pierre Rousset2, Olivier Namy2

1 FRC 3115, ICSN, avenue de la Terrasse, 91190 Gif-sur-Yvette2 Institut de Génétique et Microbiologie, Université Paris-Sud 11, 15 Rue Georges Clemenceau, 91405 Orsay3 IFR 115, ICSN, avenue de la Terrasse, 91190 Gif-sur-Yvette

Contact: David Cornu ([email protected])Keywords: Proteins, peptides and small molecules quantification

La terminaison de la traduction correspond à la dernière étape de la synthèse protéique. Elle se produit lorsqu’un codon stop entre dans le site A du ribosome et fait intervenir deux facteurs protéiques eRF1 et eRF3. La terminaison est un processus fidèle. Toutefois, il existe des séquences sur certains ARNm permettant de reprogrammer le ribosome afin de provoquer une erreur traductionnelle. Parmi les erreurs traductionnelles possibles, la translecture de codon stop correspond à l’incorporation d’un ARNt chargé au niveau du codon stop, permettant la poursuite de la traduction dans la même phase jusqu'au codon stop suivant. D'après les règles du code génétique nous pouvons prédire l'existence de plusieurs ARNt suppresseurs naturels capables de décoder un codon stop. L'efficacité d'incorporation de chacun de ces ARNt dépend non seulement de la complémentarité codon stop/anticodon mais aussi du contexte nucléotide entourant le codon stop. Afin de mieux comprendre les mécanismes moléculaires de la translecture, nous avons déterminé par spectrométrie de masse la nature des acides aminés incorporés lors de la translecture chez Saccharomyces cerevisiae.Nous avons mis au point un nouveau système rapporteur permettant de purifier spécifiquement les protéines issues de la translecture chez la levure. Ce système rapporteur est basé sur l'utilisation de la GST dont la séquence codante est interrompue par un codon stop. Ainsi seule les protéines obtenues par translecture pourront être purifiées. Les protéines sont purifiées par chromatographie d’affinité, proteolysées et les mélanges peptidiques sont analysés par spectrométrie de masse MALDI, nanoLC-MS/MS et nanoLC-MS. Les recherches des peptides chevauchant le site de translecture sont effectuées en utilisant une banque constituée des 20 séquences GST qui diffèrent entre elles par la nature de l’acide aminé positionné au niveau du codon stop dans la séquence de translecture.Pour un contexte nucléotidique donné, les acides aminés majoritairement insérés sont la glutamine et la tyrosine pour les codons stops UAA et UAG et la cystéine et le tryptophane pour le codon UGA. Des analyses quantitatives ont permis de montrer que l'efficacité relative d’incorporation des acides aminés Q et Y varie selon les codons stop. Ces résultats confirment que plusieurs ARNt naturels ont la capacité de décoder les codons stop chez la levure. De plus nos résultats démontrent que la nature du mésappariement entre le codon stop et l'anticodon de l'ARNt joue un rôle majeur dans l'efficacité d'incorporation de l'ARNt suppresseur naturel. Ces résultats valident la pertinence de la levure S. cerevisiae comme modèle pour l’étude de la translecture.

Link: https://www.imagif.cnrs.fr/plateforme-23-Service_d%E2%80%99identification_et_de_caract%C3%A9risation_des_prot%C3%A9ines_par_spectrom%C3%A9trie_de_mass


[P72] Imagerie par spectrometrie de masse tof-sims et etude immuno-histologiques appliquees a l’ophtalmologie : etude des effets du chlorure de benzalkonium

Nicolas Desbenoit1, Christophe Baudouin1, Olivier Laprévote4, Alain Brunelle2, Françoise Brignole-Baudouin1

1 Institut de la Vision, INSERM, U968, 17 rue Moreau, 75012 Paris2 Centre de recherche de Gif, Institut de Chimie des Substances Naturelles, CNRS, Avenue de la terrasse, 91198 Gif-sur-Yvette3 Centre Hospitalier National d’Ophtalmologie des Quinze-Vingts Paris, 28 rue de Charenton, 75571 Paris4 Chimie Toxicologie Analytique et Cellulaire, EA 4463, Faculté des Sciences Pharmaceutiques et Biologiques, Université Paris Descartes, 4 Avenue de l’Observatoire, 75006 Paris

Contact: Nicolas Desbenoit ([email protected])Keywords: Imaging mass spectrometry

Grâce à leurs propriétés désinfectantes, les chlorures de benzalkonium (BAK) sont des conservateurs essentiellement employés dans les collyres où ils sont réputés pour favoriser la pénétration des principes actifs. Les effets cytotoxiques sur la surface oculaire de faibles doses en utilisation chronique sont désormais bien connus et concernent de manière cruciale les patients glaucomateux qui sont obligatoirement traités à vie pour éviter la cécité. Ainsi, la distribution des BAKs dans l’œil mérite d’être réévaluée à l’aide de l’imagerie par spectrométrie de masse (IMS), afin de comprendre les impacts de cette toxicité sur des structures primordiales dans la pathologie glaucomateuse.L’IMS est une technique de choix pour l’analyse en surface des tissus biologiques. En effet cette technique permet en une simple acquisition de localiser de nombreux composés biologiques. Les deux techniques d’imagerie par spectrométrie de masse les plus couramment utilisées aujourd’hui sont le ToF-SIMS et le MALDI. Les résultats obtenus par IMS dans le cadre du consortium Masda-Eye, et qui font l’objet d’une autre présentation, montrent que le BAK est retrouvé dans de nombreuses zones histologiques de l’œil, en particulier le nerf optique [1].Ce résumé a pour objet de mettre en valeur l’apport de l’imagerie ToF-SIMS pour caractériser les variations lipidiques générées par le BAK, avec une haute résolution spatiale de l’ordre du micromètre, et afin de montrer les conséquences physiopathologiques au niveau moléculaire en termes de lipidomique. Des yeux de lapins albinos ont été instillés avec une solution de BAK à 0,01% pour une durée de cinq mois. Après sacrifice, les yeux ont été rapidement énucléés, et conservés à -80°C dans une gomme tragacanthe. Des coupes sériées de 14 µm d’épaisseur ont été réalisées à -30°C à l’aide d’un cryostat. Les images ioniques sont obtenues avec un spectromètre de masse ToF-SIMS. Les images de 500x500 µm² (résolution spatiale de 2 µm) ont été enregistrées en mode d’ionisation positif.Nous avons montré une forte corrélation spatiale entre le BAK (deux ions détectés correspondant respectivement au benzododecinium à m/z 304,32, et au myristalkonium à m/z 332,36) et un antioxydant, la vitamine E, dans le cul-de-sac conjonctival. Les images ioniques ont indiqué une distribution à la périphérie extérieure du globe oculaire. La corrélation spatiale entre les images ioniques et l’immunohistologie a mis en évidence les zones de mort cellulaire.En conclusion, l’imagerie par ToF-SIMS ouvre d’importantes perspectives pour l’évaluation fine de la toxicité liée à la présence de la molécule en termes de lipidomique et de métabolomique.[1] G. Hamm et al., SMAP 2011, Avignon.


[P73] Identification par une approche protéomique des protéines membranaires de Plasmodium falciparum exprimées à la surface de l'érythrocyte, en fonction de son affinité pour un récepteur d'adhésion

Gwladys Bertin1, François Guillonneau2, Virginie Salnot2, Nadine Fievet3, Philippe Deloron1

1 UMR216 mère et enfant face aux infections tropicales, 4 avenue de l'observatoire, 75006 Paris, France2 Plate-forme protéomique Paris Descartes, 22 rue méchain, 75014 Paris, France3 UMR216 mère et enfant face aux infections tropicales, 08 B.P 841, Cotonou, Bénin

Contact: Gwladys Bertin ([email protected])Keywords: Systems biology

Le paludisme est présent en Afrique Sub-Saharienne et est particulièrement dangereux chez les jeunes enfants et les femmes enceintes. Il est admis que la virulence du parasite est liée à sa capacité à exprimer des antigènes variable de surface (VSA). Ces derniers présentent une affinité pour différents récepteurs de l'hôte, impliqués dans la physiopathologie des formes graves (paludisme gestationnel et cérébral). Lors de sa maturation, le parasite met en place un trafic protéique conséquent au niveau membranaire et sub-membranaire de l'érythrocyte. Cet adressage protéique donne lieu à la formation de knobs permettant l'expression des VSA dont PfEMP1, protéine au rôle majeur dans la gravité de l'infection. Ces PfEMP1 sont des protéines minoritaires noyées dans une masse protéique érythrocytaire présentant un haut de degré d'insolubilité. Toutes les études du protéome membranaire de Plasmodium n'ont permis d'identifier les VSA, et notamment PfEMP1, qu'avec un nombre de peptides restreint et de faibles scores. Notre étude, actuellement en cours, repose sur un comparatif 2 à 2 d'isolats parasitaires d'accès simple, cérébral ou gestationnel visant la structure des knobs et les VSA, dont PfEMP1. L’obtention d’extraits protéiques issus d’isolats de terrain en fait l’originalité et permettra d’identifier la ou les PfEMP1 impliquées dans les accès pernicieux. Actuellement, nous avons optimisé les protocoles de préparation d'échantillons à savoir un enrichissement de 90% des formes matures du parasite par colonne macs et une déplétion des hématies saines. Le culot cellulaire est lysé par choc osmotique et les protéines sont solubilisées avec 2% SDS et digérées en solution par la trypsine. Les peptides sont analysés par nano LC-Orbitrap. Nous avons identifié à partir d’isolats placentaires et d’accès simple 530 protéines parasitaires dont 1/3 issues de la membrane parasitaire et/ou érythrocytaire, dont PfEMP1 avec un score de 70 avec 2 peptides. Ces résultats sont encourageants pour la suite de l'étude au vu de la littérature.


[P74] Etude allergomique du pollen de cyprès

Youcef SHAHALI1, Jean-Pierre SUTRA1, Iman HADDAD1, Joëlle VINH1, Philippe CHAFEY2, Sylvie CHOLLET-MARTIN3, Denis CHARPIN4, Adriano MARI5, Hélène SENECHAL1, Pascal PONCET1

1 ESPCI, LSABM et LSBMP, 10 rue Vauquelin, 75005 Paris, France2 INSERM ICGM, 22 rue Méchain, 75014 Paris, France3 INSERM, Hôpital Bichat, 46 rue Henri Huchard, 75018 Paris, France4 Hôpital Nord de Marseille, Chemin des Bourrely, 13915 Marseille Cedex 205 CCEA, via dei Monti di Creta, 104 I-00167 Rome, Italie

Contact: Youcef SHAHALI ([email protected])Keywords: Clinical proteomics, Systems biology, Separative analysis methods

INTRODUCTION: L'analyse du répertoire des allergènes et des familles moléculaires d'allergènes permet de distinguer les polysensibilisations des réactions croisées et est à la base des progrès du diagnostic de l'allergie. L'allergie au pollen de cyprès (Cupressus sempervirens), principale pollinose en région méditerranéenne à la symptomatologie parfois très sévère, touche près de 10% des enfants et sa prévalence est en augmentation.

OBJECTIF: Etablir le répertoire des allergènes de C. sempervirens et celui de la réponse IgE des patients allergiques. Mettre en évidence des corrélations entre les données cliniques et des profils électrophorétiques d'immunoréactivité IgE.

METHODE: L'analyse allergomique dérive de la protéomique. Les protéines, extraites en conditions aqueuses ou en détergent à partir de pollen de cyprès, sont séparées par électrophorèse 2D ou 2 x 1D, technique récemment appliquée à l’allergomique. Elles sont ensuite transférées sur nitrocellulose et incubée avec des sérums de patient. Les IgE fixées sur les allergènes sont ensuite révélées. Les spots protéiques correspondants aux allergènes sont prélevés et identifiés par spectrométrie de masse.

RESULTATS: Deux profils d'immunoréactivité IgE sont observés (n=80). Une catégorie de patients reconnaît des allergènes glycosylés de hautes masses molaires (HMW) et une deuxième catégorie, des motifs peptidiques d'une protéine basique de 14 kDa. L'allergène majeur Cup s 1 (43kDa, pI 7,0) est retrouvé parmi les allergènes HMW et nous décrivons, pour la première fois, la polygalacturonase de C. sempervirens à 43kDa de pI basique (Cup s 2). La protéine de 14 kDa semble spécifique du pollen de C. sempervirens. Elle pourrait être de type lectinique et présente des homologies avec le facteur d’élongation de l’hévéa, Hev b 1, allergène majeur du latex. Les six peptides internes séquencés en LC/MS/MS couvrent 52% de la séquence de Hev b 1. De plus, une réactivité IgE autoanticorps dirigée contre des neutrophiles humains a pu être mise en évidence seulement dans les sérums de patients reconnaissant la protéine de 14 kDa.

CONCLUSION: L’étude de ce modèle d’allergie débouche sur des problématiques d’ordre analytique (nouveaux allergènes) et mécanistique (réactions croisées/inflammation/autoimmunité). Le séquençage complet de la protéine de 14kDa de C. sempervirens ainsi que sa pertinence clinique dans l'inflammation, dans l'autoimmunité ainsi que dans la dégranulation des basophiles restent à préciser.


[P75] Towards complete sets of plant proteins by positional proteomics approaches: expanding and integrating the knowledge of N- and C- protein modifications

Thierry Meinnel1, Willy Bienvenut2, Wojciech Majeran1, Carmela Giglione1

1 CNRS, ISV, UPR2355, Bâtiment 23A, 1 avenue de la Terrasse, 91198 Gif-sur-Yvette2 CNRS, ISV, FRC3115, Bâtiment 23A, 1 avenue de la Terrasse, 91198 Gif-sur-Yvette

Contact: Thierry Meinnel ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

Novel proteomic approaches combining (i) low abundant proteomes biochemical enrichment, (ii) in vivo labeling with reactive precursors to specifically tag some posttranslational modifications, and (iii) powerful separation or peptide purification methods, now make it possible to select either N- or C-terminal peptides [1-5]. Analysis of the selected peptides by state-of-the-art mass spectrometry with the concept of one peptide-one protein – provided MS/MS data are convincing enough - leads to the identification of weakly abundant and very small proteins which otherwise are undetectable in classic proteomics. Quantification is possible between various samples and within each sample when dealing with the various states of protein modifications. With such approaches applied to plant proteomes, it is now possible to deepen our knowledge to the less abundant proteins and to identify the many protein variants displaying N- and C-modifications. Such modifications – frequently including acylation and proteolytic events – are essential to guide the fate of any protein and route them to the proper cell compartment where they are supposed to exert their activity. The workflow of such an approach - as now developed in our laboratory using Arabidopsis thaliana and Chlamydomonas reinhardtii [6]- will be presented and discussed here. We will also discuss the strong added-value of including bio-informatic tools in the pipeline for the sake of adding to the robustness of the conclusions. Finally, N- or C-lipidation are known to involve many major membrane signal transduction proteins - including many kinases and phosphatases as well as a wide range of cell membrane functions – which specifically respond to different physiological conditions. Similar to phosphoproteomics - but restricted to a smaller number of candidates and reactive sites - any variation of the N- and C-acylation proteome should lead to uncover new mechanisms in signal perception at the molecular level. System biology analysis using such data could be initiated as a result.

Reference1. Meinnel & Giglione (2008) Proteomics 8, 626-49.2. Mischerikow & Heck (2011) Proteomics 11, 571-89.3. Mohammed & Heck (2011) Curr Opin Biotechnol 22, 9-16.4. Schilling et al. (2010) Nat Methods 7, 508-11.5. Kleifeld et al. (2010) Nat Biotechnol 28, 281-8.6. Bienvenut et al. (2011) Proteomics 11, 1734-50.

Keywords: complete proteomes, proteolysis, lipidation, acetylation, cell compartments


[P76] Comparative large-scale characterisation of plant vs. mammal proteins: Divergences and convergences

Willy V. Bienvenut2, Christelle Espagne1, Aude Martinez1, David Sumpton3, Sergio Lilla3, Wojciech Majeran1, Thierry Meinnel1, Carmela Giglione1

1 CNRS, ISV, UPR2355, Bâtiment 23A, 1 avenue de la Terrasse, 91198 Gif-sur-Yvette2 CNRS, ISV, FRC3115, Bâtiment 23A, 1 avenue de la Terrasse, 91198 Gif-sur-Yvette3 Beatson Institute for Cancer Research, Garscube Estate, Switchback Road, G61 6BD Glasgow, UK

Contact: Willy V. Bienvenut ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

N-terminal modifications play a major role for the fate of proteins in terms of activity, stability, or subcellular compartmentalization [1, 2]. Such modifications remain poorly described and badly characterised in proteomic studies. Recent advances in the field allow now specifically enrich and select N-terminal peptides in the course of proteome-wide mass spectrometry analyses. These targeted approaches unravel as a result the extent and nature of the protein N-terminal modifications. Here, we aimed at studying extensively such modifications in the model plant Arabidopsis thaliana and to compare these results to those obtained from a human sample run and analysed in parallel. We applied large-scale analysis to compile robust conclusions on both datasets. Our data show strong convergence for some of the characterised modifications between the mammal and plant Kingdoms such as N-terminal Methionine Excision or N-Myristoylation. Although proteins N-terminus acetylation show some similarities for substrates specificity in general, a large proportions of plant organelle-targeted proteins feature post-translational N-alpha-acetylation of the mature protein after removal of the transit peptide. Also, downstream alternative starts of translation appear to be frequent in humans but exceptional in plants.

References1. Martinez et al. (2008) Proteomics 8, 2809-31.2. Meinnel & Giglione (2008) Proteomics 8, 626-49.

Keywords: proteolysis, lipidation, acetylation, cell compartments


[P77] Détection d’Escherichia coli dans un milieu complexe par amplification phagique et spectrométrie de masse en mode MRM

Armelle Martelet1, Guillaume L'Hostis1, Eric Ezan2, Christophe Junot2, Christine Rozand3, Alain Theretz3, Gaspard Gervasi3, Jean-Claude Tabet4, Bruno Muller1, François Becher2

1 Equipe mixte CEA/bioMérieux, iBiTec-S, Service de Pharmacologie et d'Immunoanalyse, CEA Saclay, 91191 Gif-sur-Yvette, France2 CEA, iBiTec-S, Service de Pharmacologie et d’Immunoanalyse, Laboratoire d'Etude du Métabolisme des Médicaments, CEA Saclay, 91191 Gif-sur-Yvette, France3 bioMérieux S.A., Chemin de l’orme, 69280 Marcy-l’Etoile, France4 Equipe de Spectrométrie de masse, Institut Parisien de Chimie Moléculaire, UMR 7201, Université Pierre et Marie Curie-Paris 6, 4 place Jussieu, 75252 Paris Cedex 05, France

Contact: Armelle Martelet ([email protected])Keywords: Clinical proteomics, High mass and high resolution mass Spectrometry, Proteins, peptides and small molecules quantification

La détection rapide d’espèces bactériennes pathogènes est cruciale en santé publique, et dans le domaine de la sécurité alimentaire. Escherichia coli est une bactérie fréquemment trouvée dans les contaminations alimentaires, et dont certaines souches peuvent engendrer de graves problèmes de santé et parfois entraîner la mort. À l’heure actuelle, l’identification bactérienne nécessite une culture de plusieurs heures afin d’obtenir une quantité de bactéries compatible avec la sensibilité des méthodes de détection. Il y a donc un réel besoin de développer de nouvelles méthodes de détection bactérienne à la fois rapide et sensible. Notre objectif est de raccourcir significativement le temps de culture nécessaire à la détection bactérienne à l’aide d’une amplification phagique.Un bactériophage (ou phage) est un virus n'infectant que des bactéries. Leur utilisation présente plusieurs intérêts pour la détection bactérienne comme la spécificité de reconnaissance pour leur bactérie hôte, qui peut aller de la souche bactérienne à plusieurs genres bactériens. Un autre intérêt est lié à leur multiplication au sein de la bactérie. En effet, en fonction de la taille du phage, l’infection d’une bactérie par un phage aboutit à la libération de 102 à 104 particules virales néo-formées, dans la plupart des cas après lyse de la bactérie hôte. Le nombre de protéines constituant le phage est donc multiplié par le même facteur et le phénomène d'amplification est d’autant plus intéressant qu’il se déroule en seulement quelques dizaines de minutes. D’autre part, les phages utilisent la machinerie cellulaire de la bactérie hôte pour se multiplier et offrent ainsi l’avantage de pouvoir différencier les cellules viables et non viables. Nous avons choisi de combiner l’utilisation des phages à la spectrométrie de masse en étudiant le modèle du phage lytique T4 et son hôte naturel Escherichia coli. Ce phage, qui comporte plus de 300 protéines, est l'un des plus complexes. Une analyse protéomique par chromatographie liquide couplée à la spectrométrie de masse haute résolution (Orbitrap) nous a permis d'identifier deux marqueurs de l'infection bactérienne par le phage T4 : une protéine de la capside du virion (9 kDa), et une protéine interne à la tête du phage (8 kDa). Par la suite, nous avons démontré la faisabilité de détection de peptides protéotypiques de ces deux marqueurs dans différentes matrices grâce à une approche ciblée par LC-MS/MS en mode Multiple Reaction Monitoring [MRM]. Nos premiers essais ont permis de détecter 105 cfu/mL d’E.coli en milieu de culture et 106 cfu/mL dans une matrice alimentaire complexe (cassoulet). Ces premiers résultats, en cours d’amélioration, montrent le potentiel du couplage de l’amplification phagique et de la spectrométrie de masse dans le développement de techniques de détection bactérienne dans le domaine de la sécurité alimentaire.


[P78] Use of procaine and procainamide as co-matrices for the analysis of oligosaccharides by MALDI-TOF mass spectrometry

Hélène Lavanant1, Corinne Loutelier-Bourhis1

1 Université de Rouen, UMR CNRS 6014 COBRA, FR 3038, rue Tesnière, 76821 Mont St Aignan CEDEX, France

Contact: Hélène Lavanant ([email protected])Keywords: Organic and inorganic mass spectrometry

Reductive amination of oligosaccharides is widely used as a method to enhance sensibility and facilitate sequence determination. The derivation protocol involves one or two steps and requires purification of the excess reagents by extraction and reversed-phase HPLC. As an alternative, we used procaine and procainamide as co-matrices with 2,5-dihydroxybenzoic acid (DHB). We added a 10g/L procaine hydrochloride or procainamide hydrochloride solution in acetonitrile with 10% acetic acid to a maltooligosaccharide solution one minute before preparing our MALDI targets with DHB with the dried droplet method. This protocol resulted in deposits composed of very fine homogeneous crystals, contrary to DHB which tends to form large inhomogeneous crystals around the rim of the MALDI spot. As a result, mass spectra could easily be acquired in an automated mode and presented a very high percentage of derivatised oligosaccharides. The derivatised oligosaccharides were the unreduced Schiff base with a mass difference of 218,142 u for procaine and 217,158 u for procainamide. The presence of procaine or procainamide on the target did not impede the ionization and rather improved the signal to noise ratio. Mass spectra reacquired several days after sample preparation showed the Schiff base derivatives were more stable than the underivatised oligosaccharide, as the percentage of derivatised oligosaccharides increased with time.Although tests of enhancement of sensibility with a maltoheptaose standard were not very favorable, one advantage was found in the structural information derived from MALDI TOF/TOF experiments with procaine and procainamide derivatives. Indeed, while underivatised maltooligosaccharides could only be detected as sodium adducts MNa+, procaine derivatives were mainly observed as protonated molecules MH+. With MH+ precursor ions, MALDI TOF/TOF mass spectra showed exclusively y series ions because the proton was fixed on the basic Schiff base. When MNa+ ions of derivatised maltooligosaccharides were selected as precursor ions, both y and b series fragment ions could be observed, although with low intensity as the major fragmentation involved loss of the Schiff base.

Link: ircof.crihan.fr


[P79] Proteomic analysis of glutathionylation in the phosynthetic bacteria, Synechocystis sp PCC 6803

Solenne CHARDONNET1, Samer SAKR2, Pierre LE MARECHAL1, Corinne CASSIER-CHAUVAT2, Paulette DECOTTIGNIES1

1 Institut de Biochimie et Biophysique Moléculaire et Cellulaire, UMR 8619, Université Paris-sud, Bât 430, 91405 Orsay cedex, France2 iBiTec-S,SBIGeM, LBI, URA2096, CEA-Saclay, 91191 Gif-sur-Yvette, France

Contact: Solenne CHARDONNET ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Redox regulation of proteins through various modifications of cysteine residues is now widely recognized as an important regulatory process. Among these modifications, protein glutathionylation is emerging as a crucial mechanism for signal transduction and regulation of protein function, in mammals but also in photosynthetic organisms. This reversible post-translational modification consists in the formation of a mixed-disulfide bridge between an accessible free thiol on a protein and a molecule of glutathione. Glutathionylation can protect specific cysteines from irreversible oxidation but can also modulate protein activities and thereby play a role in many cellular processes. Several methods have been developed to identify proteins undergoing gluthathionylation but they have been mostly applied to mammals while little is known in photosynthetic organisms. To investigate this mechanism at a large scale in the phosynthetic bacteria Synechocystis sp. PCC 6803, we used a method based on labelling with biotinylated glutathione (BioGSSG). BioGSSG was synthetized from hydroxysulfosuccinimide-biotin and glutathione, and incubated with a total soluble protein extract from Synechocystis. Glutathionylated proteins were purified by avidin affinity chromatography, separated on SDS-PAGE and identified using nLC-CHIP-IT-MS/MS with the X!TANDEM search engine. This strategy allowed us to obtain the most complete list of in vitro glutathionylated targets (about 200) proposed in a photosynthetic organism up to now. These proteins are involved in several cellular processes, especially photosynthesis, amino-acid metabolism and protein biogenesis and degradation. Moreover, the sites of glutathionylation were determined for 70 proteins after trypsin cleavage. For one of these targets, peroxiredoxin II, glutathionylation of the recombinant protein with oxidized glutathione was confirmed by MALDI-TOF mass spectrometry, and its effect on the activity was studied.


[P80] Comparative analysis of histone post-translational modification patterns obtained by mass spectrometry on intact proteins, Asp-N/Glu-C and tryptic peptides

Kévin Contrepois1, Eric Ezan2, Carl Mann1, François Fenaille2

1 CEA, iBiTec-S, SBIGeM, CEA Saclay, 91191 Gif Sur Yvette, France2 CEA, iBiTec-S, SPI, CEA Saclay, 91191 Gif Sur Yvette, France

Contact: François Fenaille ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Histones are subjected to extensive post-translational modifications including mainly acetylation and methylation of lysine residues. These post-translational modifications (PTMs) are known to play key roles in DNA-based biological processes. We have recently developed a fast and reproducible method involving ultra-high performance liquid chromatography (UHPLC) coupled to a high resolution/high mass accuracy LTQ-Orbitrap mass spectrometer to characterize core histone modifications/variants from WI-38 primary human fibroblasts [1]. However, under these conditions, modifications with the same nominal mass (e.g., acetylation and tri-methylation) can not be unambiguously distinguished and site-specific information is lacking.

To overcome these limitations and to further validate the data obtained on intact proteins, the results were compared to those from 'conventional reference methods' (middle-down and bottom-up approaches). Kelleher and coworkers have previously reported that solution ratios of defined mixtures of unmodified and acetylated H4 peptides (2 kDa) vary dramatically from the observed MS ratios (due to differences in ionization efficiency), while solution ratios of recombinant H4 protein mutants (11 kDa) correspond closely with MS ratios [2]. In this context, the aim of this work was to evaluate whether similar observations could be made on Asp-N, Glu-C (middle-down), and propionylated tryptic peptides (bottom-up), by comparison with data obtained at the protein level (top-down).

The reproducibility of each approach was first assessed by performing independent biological replicate experiments. The in-depth study of histones H4, H2A.Z and H2A.O modifications revealed that similar relative abundances were observed, whatever the method used. Moreover, we will present examples indicating that these approaches are highly complementary and that the use of an integrated approach is required for optimal characterization of histone PTMs and variants. To the best of our knowledge, this study is the first comparative evaluation of those three distinct platforms.

References[1] Contrepois et al, J Proteome Res 2010, 9, 5501-10.[2] Pesavento et al, Anal Chem 2006, 78, 4271-80.


[P81] Analysis of headspace of flavour compounds using PTR-ToF Mass Spectrometry: optimisation of acquisition parameters

Xaviéra Pennanec1, Etienne Sémon1, Jean-Luc Le Quéré1

1 Centre des Sciences du Goût et de l'Alimentation, UMR6265 CNRS, UMR1324 INRA, Université de Bourgogne, Agrosup Dijon, 17 rue Sully, 21000 Dijon

Contact: Xaviéra Pennanec ([email protected])Keywords: Instrumentation

Food aroma is complex, normally composed of a mixture of volatile compounds in a wide range of concentration. Besides, temporal aspect of flavour release is an important part contributing to sensory impression during food consumption. Thus, real time techniques such as atmospheric pressure chemical ionisation (APCI-) or proton transfer reaction (PTR-) mass spectrometry have been widely applied to the measurement of in vivo volatiles release for in-nose measurement of the expired air composition. Proton transfer reaction-mass spectrometry (PTR-MS) experiments are based on volatile compounds chemical ionisation mainly using H3O+ as precursor ion. H2O is firstly ionised in the ion source to generate H3O+. Reagent ions then react with neutral molecules into the drift tube, mainly producing [MH]+ protonated ions. Ionisation is only possible for molecules with a proton affinity (PA) superior to that of water (PAWater = 691 kJ/mol). By varying E/N values (E: electric field strength in the drift tube; N: buffer gas number density in the drift tube), detection of analytes can be improved. The optimal E/N value is linked to the physico-chemical nature of the analyte.The aim of this work was to optimize proton transfer parameters for flavour compounds detection with our PTR mass spectrometer.Analyses were conducted on the headspace of eleven different aroma compounds belonging to various chemical classes, chosen for their frequent use in food flavouring. Signal response was followed according to varying E/N values, paying attention to molecular ions intensities and presence of fragment ions. The results highlighted that the E/N parameter is closely linked to the chemical structure of the ionised molecules.Using proton transfer reaction mass spectrometry, it clearly appears that it is crucial to control acquisition parameters and especially the E/N value to optimise the detection of flavour compounds in complex matrices such as food.


[P82] Modification d'un spectromètre de masse TSQ700 pour le dépôt non destructif de molécules sous Ultra Vide

Audrey Bodin1, Pierre Abeilhou1, David Martrou1, Sébastien Gauthier1

1 Centre d'Elaboration de Matériaux et d'Etudes Structurales, 29 rue Jeanne Marvig BP94347, 31055 Toulouse Cedex 4

Contact: Audrey Bodin ([email protected])Keywords: Instrumentation

La technique de dépôt généralement utilisée pour déposer des molécules sous vide est l’évaporation thermique. Cependant cette technique est trop énergétique pour le dépôt de molécules fragiles. L’étude des propriétés de molécules adsorbées nécessite donc la mise au point de procédés de dépôt moins destructifs. L’ionisation par électrospray (ESI) est une méthode douce d’ionisation développée pour l’étude des protéines. L’appareil commercial utilisé pour notre étude est un spectromètre de masse Finnigan triple quadrupôle TSQ700. Il doit être couplé à un équipement multi-chambres, sous ultra haut vide (UHV), appelé DUF (« Dinamo » UHV Factory). [1]Afin de transformer le TSQ700 en source d’ions basse énergie, nous avons simulé le dernier quadrupôle à l’aide du logiciel SIMION. L’étude de l’énergie des ions a montré une trainée à haute énergie des ions : 41% des ions ont une énergie supérieure à 40eV (Fig 1b Courbes bleues). Cette dispersion à haute énergie est incompatible avec un dépôt non destructif en soft landing (énergie des ions inférieure à 5eV [2]).Pour trier les ions en énergie, nous avons ajouté un triplet de lentilles électrostatiques et un secteur électrostatique (Fig 1a) [3]. La modélisation et l’optimisation de ce dispositif a permis de définir les géométries du triplet de lentilles et du secteur électrostatique et d’optimiser les tensions appliquées sur ces éléments pour supprimer la trainée en énergie et ne garder que les ions arrivant avec une énergie inférieure à 5 eV sur la palette (Fig 1b Courbes rouges). La contrepartie est que seulement 9% des ions entrants arrivent sur la palette. A partir du modèle optimisé du dispositif de filtre, le bureau d’étude du CEMES a conçu les pièces pour les intégrer au TSQ700. Le secteur électrostatique est monté sur un support qui reçoit également le porte-substrat surmonté d’un four permettant de chauffer l’échantillon pour limiter le collage de molécules non ionisées. Sous le secteur électrostatique est installé un détecteur à grilles (Fig 1a) pour mesurer l’énergie des ions afin d’ajuster les polarisations des électrodes du secteur électrostatique avant le dépôt. Un translateur permet de positionner l’ensemble secteur électrostatique-palette-four-détecteur en sortie de triplet de lentilles avec précision pour caractériser les ions ou les déposer. L’ensemble peut aussi être relevé afin d’utiliser le TSQ700 en mode normal de fonctionnement.

[1] http://www.duf.cemes.fr/ [2] S. Rauschenbach, R.Vogelgesang, ACS Nano, (2009), 3 (10), pp 2901–2910.[3] A. Pernot, M. Abignoli, M. Barat, Revue de Physique Appliquée, (1967), tome 2, pp 203-212.

Link: http://www.cemes.fr/


[P83] Analyse lipidomique de foie gras de canard de différents classements commerciaux à l’aide de l’imagerie par spectrométrie de masse TOF-SIMS.

Christopher Cerruti1, Laetitia Théron2, David Touboul1, Thierry Astruc3, Alain Brunelle1

1 1Centre de Recherche de Gif, Institut de Chimie des Substances Naturelles, CNRS, 1 Avenue de la Terrasse, 91190 Gif-sur-Yvette2 2INRA, INPT - ENSAT, INPT - ENVT, UMR 1289 Tissus Animaux, Nutrition, Digestion, Écosystème et Métabolisme, Avenue de l'Agrobiopole, 31326 Castanet Tolosan3 INRA de Clermont Ferrand Theix, UR370 QuaPA, , 63122 St Genès Champanelle

Contact: Christopher Cerruti ([email protected])Keywords: Imaging mass spectrometry

La production de foie gras à partir de palmipèdes est une activité économique et traditionnelle de l’agriculture française depuis cinq siècles. Le foie gras est le résultat d’un processus d’accumulation de lipides pendant la période d’engraissement. Lors du traitement thermique, une partie des lipides accumulés pendant la phase de gavage peut migrer de la structure cellulaire vers la surface du foie : il s'agit du phénomène de fonte qui est exprimé par le rendement de cuisson. Différentes techniques analytiques ont été utilisées pour tenter d’expliquer la capacité d’un foie gras à conserver ou à perdre sa matière grasse pendant la cuisson mais aucune d’entre elles n’a permis d’identifier ce qui prédéfinit un foie à ce phénomène. Les techniques d’imagerie basées sur la spectrométrie de masse, comme la spectrométrie de masse à ionisation secondaire par temps de vol (TOF-SIMS) permettent la cartographie de tout composé présent à la surface d’une coupe de tissu avec une résolution de l’ordre du micromètre [1]. Afin de déterminer la composition en lipide du foie gras, nous avons effectué une analyse lipidomique in situ en nous concentrant sur les gouttelettes lipidiques (remarque : les goutelettes lipidiques sont ici incluses dans les hépatocytes et non les adipocytes) et les membranes plasmiques des cellules hépatiques. L’objectif de notre étude était d’évaluer la composition et la répartition locale des lipides directement sur des coupes de foie de canard afin d’identifier une différence qui puisse expliquer leurs caractéristiques, comme cela fut fait récemment avec des foies humains stéatosiques [2].Les échantillons de foie gras analysés sont différenciables par le rendement post-traitement thermique ou par le classement commercial (extra, sélection ou tout venant). Des coupes de foie gras provenant de différents classements commerciaux ont été analysées à l’aide d’un spectromètre TOF-SIMS IV (Ion-TOF GmbH, Münster, Allemagne) équipé d’une source d’agrégats de bismuth, et comparées aux résultats obtenus avec un foie maigre servant de témoin.L’imagerie TOF-SIMS permet de différencier les foies gras classés parmi les extras et sélections des tout venants. En effet ces derniers présentent des gouttelettes lipidiques moins denses en diacylglycérols que dans les deux autres classes de foie gras. Les vésicules stéatosiques sont majoritairement composées de DAG C32:0 dans les foies gras et le foie maigre. Seule l’imagerie par spectrométrie de masse permet une telle quantification relative localisée. Les changements dans la composition lipidique du foie associés à la suralimentation induisent une augmentation dans la proportion entre le cholestérol membranaire et la phosphatidylcholine.

1. Touboul D, Laprévote O, Brunelle A, Curr. Opin. Chem. Biol. In press, DOI: 10.1016/j.cbpa.2011.04.0172. Debois D, Bralet MP, Le Naour F, Brunelle A, Laprévote O, Anal Chem 2009, 81, 2823-2831.


[P84] Analyse de la dynamique de formation de complexes entre l’anneau de processivité de la réplication bactérienne et des peptides inhibiteurs par spectrométrie de masse native.

Philippe Wolff1, Philippe Dumas3, Gilles Guichard2, Philippe Hammann1, Dominique Y. Burnouf3

1 Plateforme Protéomique Strasbourg-Esplanade, FRC 1589, IBMC, 15 rue René Descartes, 67084 Strasbourg2 Institut Européen de Chimie et Biologie, Université de Bordeaux-CNRS UMR 5248, CBMN, 2, rue Robert Escarpit, 33607 Pessac3 UPR 9002 Architecture et Réactivité de l’ARN, 15 rue René Descartes, 67084 Strasbourg

Contact: Philippe Wolff ([email protected])Keywords: Signaling, interactomics and post-translational modifications

L’anneau de processivité β est un composant essentiel du complexe réplicatif bactérien. Cet homodimère interagit avec de multiples protéines impliquées dans les processus du métabolisme de l’ADN, comme la réplication et la réparation des lésions. Cette interaction est nécessaire afin que les protéines puissent remplir leur fonction physiologique. Des compétiteurs de ces interactions ADN polymérases / anneau β sont aptes à provoquer l’arrêt de la réplication et la mort cellulaire, définissant ainsi l'interface de liaison comme cible moléculaire pour le développement de nouveaux types d’antibiotiques ciblant la réplication bactérienne.

La structure de co-cristaux de l’anneau β avec le peptide de liaison de la DNA polymérase Pol IV d’Escherichia coli (Burnouf et al. 2004) a défini la poche d’interaction. A partir de ces données structurales, nous développons des ligands synthétiques liant cette poche hydrophobe dans le but de développer de nouvelles molécules synthétiques inhibitrices de la réplication bactérienne.

L’analyse de la dynamique de formation des complexes peptides / anneaux a été étudiée par spectrométrie de masse native en fonction de la concentration en peptide. Les données expérimentales se superposent au modèle théorique et les valeurs de Kd mesurées par cette technique sont identiques à celles mesurées indépendamment par ITC et SPR et permettent une double validation de la spectrométrie de masse native pour la détermination de constantes d’affinité.

Link: http://www-ibmc/proteo/accueil_029.htm


[P85] Uncovering the Cell Sialo-proteome Using Metabolic Oligosaccharide Engineering and Mass Spectrometry

Violette Gautier1, Nicolas Delcourt3, Emmanuelle Mouton-Barbosa1, Mathilde Beau1, Jean-Philippe Girard1, Odile Burlet-Schiltz1, Anne Gonzalez de Peredo1, Bernard Monsarrat1

1 Institut de Pharmacologie et de Biologie Structurale/CNRS, UMR5089, 205 route de Narbonne, 31077 Toulouse, France2 Université de Toulouse, 118 route de Narbonne, 31062 Toulouse, France3 Cancer Research Center of Toulouse, INSERM U1037 , 20-24 rue du pont saint-pierre, 31052 Toulouse, France

Contact: Violette Gautier ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Proteins, peptides and small molecules quantification

N-glycosylation is among the most common post-translational modifications in cells and it is prevalent in proteins localized both on the extracellular side of the plasma membrane and in the extracellular space. Most of these glycoproteins contain sialic acid as the monosaccharide located on the non-reducing end of the glycans. Methods for global N-glycopeptides characterization have been described (1, 2), but they are not specific for the enrichment and the global analysis of membrane sialylated proteins. We present a strategy based-on metabolic oligosaccharide engineering (3) in combination with label free quantitative mass spectrometry for the specific detection and quantitation of the cell sialo-proteome dynamics. This method is based-on the metabolic incorporation of N-acetyl mannosamine azido to tag cell surface and secreted glycoproteins. This azido-sugar was further reacted very specifically with a phosphine-biotin probe, via a Staudinger ligation. Biotinylated glycoproteins were then purified and sequentially digested with trypsin and PNGase F. PNGase F digestion was performed in 18-O water, which allowed us to discriminate, thanks to different mass increments, deglycosylation of glycopeptides from spontaneous deamidation. Finally trypsin and PNGase F digested peptides were analyzed on an LTQ-Orbitrap Velos mass spectrometer. This strategy was applied for the in-depth characterization of the sialo-proteome in endothelial cells and to quantify its variation in response to pro-inflammatory treatments. We identified more than four hundred N-glycosylation sites corresponding to 202 sialylated glycoproteins. Using quantitative analyses, we also show that pro-infammatory cytokines leads to the up-regulation of above 50 sialo-proteins involved in various pathophysiological functions such as vascular endothelial cell migration and adhesion.This study shows that proteomic analysis based on metabolic incorporation of azido-N-acetyl-mannosamine coupled with label-free quantitative MS measurements represents a powerful new approach to analyze global cellular sialo-proteome changes.



[P86] Sequencing lys-n proteolytic peptides by esi and maldi tandem mass spectrometry

Mathieu Dupré1, Gaëlle Fromenty1, Sonia Cantel1, Jean Martinez1, Christine Enjalbal1

1 Institut des Biomolécules Max Mousseron (IBMM UMR 5247), Université Montpellier 2, 34095 Montpellier

Contact: Mathieu Dupré ([email protected])Keywords: Organic and inorganic mass spectrometry

In this study, we explored the MS/MS behavior of various synthetic peptides that possess a lysine residue at the N-terminal position. These peptides were designed to mimic peptides produced upon proteolysis by the Lys-N enzyme, a metalloendopeptidase issued from a Japanese fungus Grifola Frondosa[1] that was recently investigated in proteomic studies[2] as an alternative to trypsin digestion since a specific cleavage at the amide X-Lys chain is obtained providing N-terminal lysine peptide fragments. In contrast to tryptic peptides exhibiting a lysine or arginine residues solely at the C-terminal position [3], [4], and thus devoid of such basic amino acids within the sequence, these Lys-N proteolytic peptides can contain the highly basic arginine residue anywhere within the peptide chain. The fragmentation patterns of such sequences with ESI-QqTof and MALDI-Tof/Tof mass spectrometers commonly used in proteomic bottom-up experiments were investigated [5].

[1] Nonaka, T.; Hashimoto, Y.; Takio, K., J. Biochem. 1998, 124, 157-162. [2] Coussot G, Hawke DH et al,. Anal Biochem. 2007; 361(2):302-304. [3] Boersema, P. J.; Taouatas et al., Moll. Cell. proteom. 2009, 8, 650-660. [4] Carabetta, V. J.; Li, T.; Shakya, A.; Todd, M. G., Cristea, I. M., J. Am. Soc. Mass Spectrom. 2010, 21, 1050-60.[5] Dupré, M.; Cantel S.; Verdié P.; Martinez J.; Enjalbal C., J. Am. Soc. Mass Spectrom. 2011, 22, 265-279


[P87] Etude protéomique du secrétome chez Clostridium difficile

Céline Viala1, Séverine Péchiné1, Anne Collignon1, Céline Boursier2

1 EA 4043, USC INRA, Faculté de Pharmacie, Université Paris-Sud 11, 5 rue JB Clément, 92296 Châtenay-Malabry , France2 Plate-Forme TransProt Activité Protéomique, IFR141-IPSIT, Faculté de Pharmacie, Université Paris-Sud 11, 5 rue JB Clément, 92296 Châtenay-Malabry , France

Contact: Céline Boursier ([email protected])Keywords: Clinical proteomics

Clostridium difficile est un pathogène responsable de diarrhées et de colites pseudomembraneuses, survenant le plus souvent après un traitement antibiotique. Les facteurs de virulence majeurs de Clostridium difficile sont les toxines A et B. Cependant, la colonisation du tube digestif, considérée comme la première étape de la pathogénèse, implique d’autres protéines de virulence dont certaines ont déjà été caractérisées. L'objectif de cette étude est de mettre en évidence de nouvelles protéines qui pourraient être impliquées dans cette étape de colonisation. Par une approche protéomique combinant l'électrophorèse bidimensionnelle (2DE) et la spectrométrie de masse, nous avons étudié le secrétome de C. difficile sur une cinétique de croissance in vitro sur une souche virulente de C. difficile. Les 2DE ont été réalisées à partir d'extraits de protéines secrétées prélevées dans le surnageant de culture à différents temps et précipitées. Après analyse d'images comparative des gels, 202 spots protéiques différentiels ont été mis en évidence. Les premières analyses par nanoLC-MS/MS permettent d'identifier les principales protéines sécrétées.

Link: http://ifr141.cep.u-psud.fr/transcriptome-proteome/index.html


[P88] Analysis of chlorinated compounds in tap water using PTR-ToF Mass Spectrometry: H3O+ versus O2+ chemical ionisation

Xaviéra Pennanec1, Etienne Sémon1, Noëlle Béno1, Thierry Thomas-Danguin1, Jean-Luc Le Quéré1

1 Centre des Sciences du Goût et de l'Alimentation, UMR6265 CNRS, UMR1324 INRA, Université de Bourgogne, Agrosup Dijon, 17 rue Sully, 21000 Dijon

Contact: Xaviéra Pennanec ([email protected])Keywords: Instrumentation, Organic and inorganic mass spectrometry

For a safe human consumption, tap water needs to go through chemical, physical and biological treatments.Amongst the chemical treatments, chlorination is often used to minimize bacteriological contamination risks. However many consumers complain about bad taste or off-flavour in tap water which could be potentially induced by the chlorination process. Hypochlorous acid (HOCl) and chloramines are possible candidates for a «chlorine» off-odour. Chloramines may be by-products from the reaction of chlorine with nitrogenous compounds that can be present all over the distribution network of tap water.The aim of this study was to detect the potential presence of chloramines and/or HOCl in tap water headspace using Proton Transfer Reaction Time of Flight Mass Spectrometry (PTR-ToF-MS) and to compare the classical chemical ionisation with H3O+ to the chemical ionisation using O2+ using a switchable reagent ions (SRI) source to track these chlorinated compounds. In most of the PTR experiments, analyses are achieved using H3O+ as precursor ion, mainly leading to [MH]+ protonated ions. Ionisation is only possible for molecules with a proton affinity (PA) superior to that of water (PAWater = 691 kJ/mol). The molecules with a lower proton affinity than water can therefore not be ionized via proton transfer. The switchable seagent ions (SRI) system on the PTR-MS source (Ionicon Analytik, Innsbruck) enables to switch to another reactant ion than H3O+ like O2+. Charge transfer ionisation is thus possible with molecules with a lower ionisation potential than that of O2 (IPO2 = 12.06 eV), thus increasing the range of molecules which can be analysed.Headspace analyses were conducted using H3O+ and O2+ (to compare these two reagent ions). Ionisation parameters optimisation was especially focussed on H2O or O2 flows, pressure into the drift tube and E/N ratio (where E: electric field strength in the drift tube; N: buffer gas number density in the drift tube).The detected compounds were mainly hypochlorous acid (HOCl) and mono-, di- and trichloramines (ClNH2, Cl2NH and Cl3N respectively). The Time of Flight (ToF) mass analyser allowed the determination of exact mass of the different ions and thus the identification of analytes with certainty. Sensitivity of hypochlorous acid was greater towards O2+ reagent ion than H3O+. Dichloramine could not be identified by H3O+ chemical ionisation because of the presence of an intense mass peak of an unidentified contaminant (m/z = 85.93) close to the m/z of the dichloramine. On the other hand, dichloramine could be unambiguously detected using O2+ as the precursor ion thanks to its selectivity.


[P89] Utilisation de la source APCI en introduction directe pour l’analyse en matrices complexes

Florian Albrieux1, Christian Duchamp1, Natali Henriques1

1 Institut de Chimie Biochimie Moléculaire et Supramoléculaires UMR5246, Centre Commun de Spectrométrie de Masse, Bât. CPE, aile Curien, Campus de la Doua, 43 Bd du 11 nov. 1918, 69622 Villeurabanne CEDEX

Contact: Florian Albrieux ([email protected])Keywords: Instrumentation, Organic and inorganic mass spectrometry

Cette étude présente des exemples d’analyses de composés présents dans des matrices complexes en utilisant l’ionisation chimique à pression atmosphérique en introduction directe. Les analyses sont réalisées sans aucune préparation d’échantillon. Nous présenterons des exemples d’analyse de composés présents dans des urines ainsi que dans des milieux réactionnels comportant des solvants peu compatible avec l’ionisation electrospray (DMSO et THF).


[P90] Etude différentielle des protéomes de branchies de dreissènes (moules d’eau douce) récoltées sur des sites pollués ou non.

Bertrand NAUDIN2, Philippe CHAN TCHI SONG 3, Pascal COSETTE 2, Thierry JOUENNE 2, Marc PARANT 1, Sandrine PAIN-DEVIN 1

1 CNRS UMR 7146 Laboratoire Liebe (Interactions Ecotoxicologie, Biodiversité, Ecosystèmes) , Université Paul Verlaine - rue du Général Délestraint, 57070 Metz2 CNRS UMR 6270 Laboratoire PBS (Polymères, Biopolymères, Surfaces), Université de ROUEN - Bd Maurice de Broglie, 76820 Mont Saint Aignan3 INSERM U 982 Laboratoire Différenciation et Communication Neuronale et Neuroendocrine, Université de ROUEN - Place Emile Blondel, 76820 Mont Saint Aignan

Contact: Bertrand NAUDIN ([email protected])Keywords: Proteins, peptides and small molecules quantification

Des dreissènes ont été récoltées dans huit sites de différentes rivières de France présentant des degrés de pollution variés. Leurs branchies ont été disséquées puis une extraction des protéines a été effectuée afin d’étudier le protéome de ces organes qui filtrent l’eau en permanence et qui pourraient servir de marqueurs de susceptibilité aux stress anthropiques.Les protéines ont été séparées par électrophorèse 2-D. Pour chaque site, quatre échantillons différents de dreissènes ont été traités, soit quatre gels par site. Les 32 gels obtenus ont été numérisés puis une analyse différentielle a été entreprise en utilisant le logiciel SameSpots (Nonlinear Dynamics).L’analyse en composante principale a fait ressortir deux groupes d’échantillons dont les spots d’intérêt sont exprimés différemment. Le premier groupe rassemble les gels d’échantillons de dreissènes issues des quatre sites qui sont parmi les plus pollués, tandis que le second rassemble les échantillons issus des autres sites, peu ou pas pollués. En vue de leur identification, ces spots ont été découpés et digérés par la trypsine afin de les soumettre à une spectrométrie de masse de type ESI-Quad-Tof. Les spectres obtenus ont été traités par le logiciel Mass Hunter (Agilent). Pour l’identification des protéines, nous avons utilisé MASCOT (à partir de la base de données NCBI ; taxonomy : other Metazoa), ainsi que des outils de recherches de séquençage de novo avec MSBlast et PEAKS/SPIDER (Bioinformatics Solutions). Parmi les protéines sous-exprimées en milieux pollués, on peut citer : proteasome 26S ATPase subunit, annexin, GADPH, triophosphate isomerase, histone H2B. Ces expressions différentielles de protéines représentent sans doute chez les organismes qui les expriment des mécanismes de défense qui leur permettent de résister à la présence et à l’impact toxique des polluants d'origine anthropique.Cette étude a été faite dans le cadre du Programme SYDEPOP : INSU-SIC-EC2CO-Cytrix.


[P91] Etude de la voie de sécrétion SecA2-dépendante chez Listeria monocytogenes par l’analyse de l’exoprotéome.

Sandra RENIER1, Ingrid CHAFSEY1, Christophe CHAMBON2, Michel HEBRAUD1, Mickaël DESVAUX1

1 UR454 Microbiologie, Equipe QuaSA, INRA de Clermont-Ferrand, site de Theix, 63122 Saint-Genès Champanelle2 Plate-Forme d'Exploration du Métabolisme, composante protéomique, INRA de Clermont-Ferrand, site de Theix, 63122 Saint-Genès Champanelle

Contact: Michel HEBRAUD ([email protected])Keywords: Systems biology

Listeria monocytogenes est l’agent étiologique de la listériose, une infection grave d’origine alimentaire. Ce pathogène possède la capacité de survivre dans divers environnements comme le sol, les matrices alimentaires ou encore le cytosol des cellules eucaryotes. Les facteurs de virulence sécrétés, localisés dans l’enveloppe cellulaire ou relargués dans le milieu extracellulaire, sont régulés par la température et sont essentiellement exprimés à 37°C. Une large majorité des exoprotéines sont prédites comme étant sécrétées par la voie Sec. Le translocon Sec est composé d’un hétérodimère SecYEG formant un canal à travers la membrane cytoplasmique, et de l’ATPase SecA. Plusieurs bactéries à Gram positif, dont L. monocytogenes, présentent un paralogue de SecA, nommé SecA2. Contrairement à la protéine SecA qui est essentielle, l’absence de SecA2 entraîne uniquement un défaut au niveau de la morphologie de la bactérie. Des analyses préliminaires ont révélé l’absence ou la réduction significative d’exoprotéines chez le mutant dépourvu du gène secA2. De plus, certaines d’entre elles sont dépourvues de peptides signal et par conséquent ne peuvent pas être prédites comme étant sécrétées par le système Sec. Le but de notre étude est de caractériser l’exoprotéome du mutant ΔsecA2 chez L. monocytogenes. Les protéines présentes dans le milieu extracellulaire ont été isolées et résolues en électrophorèse bidimensionnelle Suite à leur identification en spectrométrie de masse MALDI-TOF, le sous-ensemble de protéines extracellulaires sécrétées d'une manière SecA2-dépendante a pu être établi chez L. monocytogenes à la fois à 20°C et à 37°C. Parallèlement, une approche protéomique hors-gel par LC-MS/MS (LTQ Velos) a été effectuée sur la souche sauvage. Outre l'expression différentielle des protéines, la fonction des exoprotéines SecA2-dépendantes possédant ou non un peptide signal sera discutée.


[P92] Structural analysis of synthetic polymers using MALDI SpiralTOF-TOF with high-energy CID

Takaya Satoh1, Ayumi Kubo1, Yoshiyuki Ito1, Masahiro Hashimoto1, Masaaki Ubukata2, Takafumi Sato1, Jun Tamura1, Akihiko Kusai3

1 JEOL Ltd., 1-2, Musashino 3-Chome Akishima, 196-8558 Tokyo, Japan2 JEOL USA, Inc., 11 Dearborn Rd., 01960 Peabody, MA USA3 JEOL (EUROPE) SAS, Espace Claude Monet - 1, Allée de Giverny, 78290 Croissy-sur-Seine, France

Contact: Akihiko Kusai ([email protected])Keywords: High mass and high resolution mass Spectrometry, Organic and inorganic mass spectrometry, Instrumentation

Recently, a tandem time-of-flight mass spectrometer (TOF-TOF) with matrix-assisted laser desorption/ionization (MALDI) is used for structural analysis of synthetic polymer. A high-energy collision-induced dissociation (HE-CID) is mostly used method to make a fragmentation. There are two factors which make interpretation of a HE-CID product ion spectrum difficult: i) overlap of fragment pathways of HE-CID and post-source decay (PSD) on a product ion spectrum, ii) insufficient separation of fragment peaks caused by low precursor ion selectivity and low mass resolution. The MALDI TOF-TOF combined a SpiralTOF [1] and an offset parabolic reflectron for first and second TOFMS, respectively has been developed. The SpiralTOF, which has 17 m flight path, can select a monoisotopic ion so that each fragment pathway is observed as single peak on product ion spectrum. Furthermore, PSD ions are eliminated by electrostatic sectors inside the SpiralTOF. As a result, fragment pathways using HE-CID are preferentially observed on product ion spectrum. In this study, some synthetic polymers were investigated for structural analysis using HE-CID spectrum acquired by MALDI SpiralTOF-TOF. A repeat structure of synthetic polymer was clearly observed on a product ion spectrum of selected monoisotopic precursor ion of [M+Na]+. At the same time, a fragment pathway related to near end-group was observed as single peaks in a low m/z region.

[1] Satoh, T.; Sato, T.; Tamura, J. J. Am. Soc. Mass Spectrom. 2007, 18, 1318.

Link: www.jeol.com


[P93] Ciblage par MALDI-TOF-MS de nouveaux composés inhibiteurs des protéines phosphatases CDC25s

Estelle Sibille1, Emilie Bana2, Denyse Bagrel2, Gilbert Kirsch2, Patrick Chaimbault2

1 Laboratoire de Spectrométrie de Masse et Chimie Laser, ICPM 1, bd Arago, 57078 Metz Cedex 03, France2 Laboratoire d'Ingénierie Moléculaire et Biologie Pharmacologique, ICPM 1, bd Arago, 57078 Metz Cedex 03, France

Contact: Estelle Sibille ([email protected])Keywords: High mass and high resolution mass Spectrometry, Organic and inorganic mass spectrometry

Les phosphatases CDC25s, qui comportent trois isoformes A, B et C, jouent un rôle majeur dans le processus cancéreux à plusieurs niveaux du cycle cellulaire. Actuellement, les recherches se focalisent sur l’inhibition de ces protéines grâce à des molécules naturelles ou synthétiques. Ces molécules inhibent l’action de ces protéines en bloquant réversiblement (ex : indolylhydroxyquinones [1]) ou irréversiblement (BN82002 [2]) leur site actif, empêchant ainsi le bon déroulement du cycle.Le travail a consisté à développer un protocole permettant de cribler des inhibiteurs de CDC25s. Ce protocole évolue selon la réversibilité ou l’irréversibilité de la liaison « inhibiteur-site catalytique » de la protéine. La technique de criblage mise au point précédemment au laboratoire [3] permet déjà de détecter par MALDI-TOFMS le signal d’un inhibiteur non covalent (réversible). Cependant, il ne peut s’appliquer au criblage d’inhibiteurs covalents (irréversibles). Afin de pouvoir cribler ces derniers, nous avons complété le protocole par une approche «Peptide Mass Fingerprinting» permettant la détection systématique du site actif des CDC25s. Les spectres de masse obtenus par MALDI-TOF (ou MALDI-FTICR) sont soumis à la banque de données MASCOT® afin d’identifier les peptides issus de la digestion trypsique. Cette approche est appliquée aux CDC25s humaines (produites et purifiées au laboratoire) seules et mises en contact avec les candidats inhibiteurs. Les différences entre protéines inhibées ou non correspondent à la détection d’un pic correspondant au site actif de la protéine décalé de la masse de l’inhibiteur et/ou à la disparition du pic correspondant à leur site catalytique. Par exemple, après digestion, le site catalytique des CDC25s n’est systématiquement plus identifié par MASCOT® lorsque le BN82002 est soumis à ce test.Ce test permet donc de différencier pour les CDC25s, les inhibiteurs covalents des inhibiteurs non covalents. Ce protocole permet de sélectionner avec discernement les molécules candidates aux futurs tests in cellulo avec les CDC25s. Le caractère covalent de la liaison révélé par ce protocole permet de sélectionner plus finement les composés d’intérêt car les inhibiteurs irréversibles permettent de bloquer définitivement leur site actif.

Références :[1] J. Sohn et al. Inhibition of Cdc25 Phosphatases by Indolyldihydroxyquinones, J. Med. Chem. 46 (2003) 2580-2588.[2] M.C. Brezak et al. A Novel Synthetic Inhibitor of CDC25 Phosphatases : BN82002, Cancer Res. 64 (2004) 3320-3325.[3] P. Hannewald et al. Tubulin-Binding Drug Screening by MALDI-TOFMS, Anal. Chem. 78 (2006) 4390-4397.


[P94] Mise au point d’une méthode de détection et de quantification multiplexe par MRM des peptides amyloïdes dans le LCR humain

Pauline Poinot1, Christophe Hirtz2, Audrey Gabelle3, Laurent Tiers2, Christophe Junot1, Sylvain Lehmann1, François Becher1

1 CEA, iBiTec-S, Service de Pharmacologie et d’Immunoanalyse, Saclay, 91191 Gif-sur-Yvette, France2 CHRU de Montpellier, Biochimie - Protéomique Clinique, IRB-Hôpital St Eloi, 80 av A. Fliche, 34295 Montpellier, France3 CHRU de Montpellier, Service de Neurologie, Hôpital Gui de Chauliac, 80 av A. Fliche, 34295 Montpellier, France

Contact: François Becher ([email protected])Keywords: Proteins, peptides and small molecules quantification , Separative analysis methods

Comptant plus de 860000 personnes atteintes en France, la maladie d’Alzheimer est devenue aujourd’hui un véritable problème de santé publique. A ce jour, le diagnostic de la maladie repose essentiellement sur un examen clinique, de l’imagerie, et des tests neuro-psychologiques. Afin de compléter ce diagnostic, une nouvelle approche, l’identification de protéines marqueurs dans les biofluides, a émergé.

Les peptides amyloïdes, ainsi que la protéine Tau, constituent des marqueurs d’intérêt pour le diagnostic de la maladie. Chez les sujets atteints, leur agrégation entraîne la formation de plaques séniles extracellulaires contribuant à une dysfonction et une dégénération des neurones. Parmi ceux-ci, les peptides Aβ 40 et 42 semblent être des marqueurs potentiels de la maladie d’Alzheimer (Graff-Radford et al., 2007). En outre, d’autres formes ont été identifiées dans le LCR, et pourraient également être liées à l’évolution de la maladie (Portelius et al., 2009).Jusqu’à présent, ces marqueurs ont essentiellement été détectés et validés au travers des techniques immunologiques. Or, le coût et le temps nécessaires à l’obtention d’anticorps spécifiques, de même que la difficulté de multiplexer ces méthodes n’en font pas toujours des techniques de choix, notamment en vue d’une application clinique. La spectrométrie de masse semble être aujourd’hui une bonne alternative (Portelius et al., 2007).

Au cours de cette étude, nous avons mis eu point une méthode de ciblage et de dosage multiplex de peptides Aβ par spectrométrie de masse en tandem. Différents LCR de patients ont été analysés par LC/MSMS en mode MRM. Pour chacun des peptides ciblés, 4 à 6 transitions ont été déterminées. La quantification absolue des peptides Aβ 40 et 42 a été réalisée via l’utilisation de standards marqués.

Les résultats obtenus révèlent qu’une analyse LC/MSMS permet de détecter de façon sensible l’ensemble des peptides Aβ ciblés. De plus, cette approche à haut débit d’analyse permet l’analyse d’échantillons issus de larges cohortes de patients. Après validation clinique, elle pourrait à l’avenir être utilisée pour le diagnostic de la maladie d’Alzheimer.

- Graff-Radford NR, Crook JE, Lucas J, Boeve BF, Knopman DS, Ivnik RJ, Smith GE, Younkin LH, Petersen RC, Younkin SG (2007). Arch Neurol 64(3), 354-62.- Portelius E, Brinkmalm G, Tran AJ, Zetterberg H, Westman-Brinkmalm A, Blennow K. (2009). Neurodegener Dis. 6(3):87-94. - Portelius E, Tran AJ, Andreasson U, Persson R, Brinkmalm G, Zetterberg H, Blennow K, Westman-Brinkmalm A. (2007). J Proteome Res. 6(11):4433-9.


[P95] Synthèse et évaluation de deux sondes chimiques spécifiques pour le marquage et l’analyse protéomique des glycoprotéines des cellules endothéliales humaines au cours de la réponse inflammatoire

Violette Gautier1, Mathilde Beau1, Michel Azoulay2, Laura Lanoë2, Nicolas Delcourt1, Anne Gonzalez de Peredo1, Jean-Claude Florent2, Odile Burlet-Schiltz1, Bernard Monsarrat1

1 Institut de Pharmacologie et de Biologie Structurale, CNRS UMR5089, 205 route de Narbonne, 31077 Toulouse 2 Institut Curie (Conception, synthèse et vectorisation de biomolécules) UMR 176, 26 rue d’ULM, 75248 Paris cedex 05

Contact: Violette Gautier ([email protected])Keywords: Organic and inorganic mass spectrometry, Proteins, peptides and small molecules quantification

Le glycoprotéome de la surface cellulaire est impliqué dans des processus biologiques fondamentaux tels que la transduction du signal, le transport de molécules, le trafic membranaire, la migration des cellules et les interactions intercellulaires. Cependant, il est également l’un des plus difficile à analyser, car les protéines impliquées sont très hydrophobes, difficiles à solubiliser, à purifier, et ne représentent qu’une fraction mineure du contenu protéique total de la cellule.Actuellement, l’une des approches utilisées pour l’identification des glycoprotéines de surface repose sur une stratégie de marquage bioorthogonale1,2. Cette méthode est réalisée en deux étapes : incorporation métabolique et marquage chimique. Dans un premier temps, une fonction reportrice de type azoture est introduite au niveau des glycannes via la machinerie cellulaire, par ajout dans le milieu de culture d’un précurseur monosaccharidique modifié. Dans un second temps, cette fonction reportrice se lie de façon covalente à une sonde exogène grâce à une fonction complémentaire de type triarylphosphine ou alcyne. Dans la littérature, seules les réactions de Staudinger2 et de « click chemistry » sans cuivre3 permettent in vivo le marquage chimique des azido-glycoprotéines intermédiaires.Cette étude présente d’une part la synthèse chimique de deux sondes possédant une biotine liée à un groupement triarylphosphine4 ou monofluorocyclooctyne5, et d’autre part l’évaluation comparée des performances de ces deux sondes pour le marquage et l’analyse protéomique des glycoprotéines. Les résultats obtenus indiquent que la phosphine-biotine, bien qu’extrêmement spécifique, présente une moindre efficacité de marquage et s’oxyde rapidement. La fluoro-cyclooctyne testée présente en revanche une vitesse de réaction bien supérieure à celle de la phosphine, permettant d’envisager le suivi de processus cellulaires rapides. Cette stratégie, combinée à une analyse protéomique quantitative sans marquage grâce au logiciel MFPaQ, a ainsi permis de réaliser une étude cinétique de la dynamique du sialo-glycoprotéome des cellules endothéliales humaines au cours de la réponse inflammatoire.

Link: http://www.ipbs.fr/


[P96] Comparison of different liquid chromatography systems for the detection of low-level biomarkers in biological fluids by Selected Reaction Monitoring

Florence Roux-Dalvai1, Violette Gautier1, Alexandre Stella1, Jérôme Lemoine2, Anne Gonzalez de Peredo1, Bernard Monsarrat1, Odile Burlet-Schiltz1

1 Institut de Pharmacologie et de Biologie Structurale, CNRS UMR5089, Université de Toulouse, 205, route de Narbonne, 31077 Toulouse, France2 Institut des Sciences Analytiques, UMR 5280 CNRS, Université de Lyon, -, 69622 Villeurbanne, France

Contact: Florence Roux-Dalvai ([email protected])Keywords: Proteins, peptides and small molecules quantification , Clinical proteomics, Separative analysis methods

Detection of low-abundant proteins in biological samples is usually hampered by limited sensitivity and dynamic range of mass spectrometers. In the Selected Reaction Monitoring (SRM) mode, the dynamic range problem is alleviated, as target parent and fragment ions are respectively selected in a narrow mass range window by the two quadrupole analyzers, filtering out other highly abundant peptide ions that otherwise would lead to signal suppression in a full MS scan. Nonetheless, SRM analysis of weakly concentrated molecule results in low ion currents in the mass spectrometer, and intrinsic sensitivity of the instrument may then become the limiting factor of the analysis. Injecting higher amounts of analyte in the mass spectrometer could thus in this case help to improve the detection of species present at very low level in a complex matrix.Here, we tested different sample processing methods and LC-MS instrumental settings to optimize the detection of biomarker candidates in two biological fluids. Increasing amounts of sample were loaded either on a 75µm I.D. capillary column coupled to a nanospray source, or on a 2mm I.D. column coupled to an ESI source. In each case, several proteins were monitored by SRM on a 5500QTrapTM mass spectrometer (ABSciex), in order to determine the optimal loading capacity of the chromatographic system. In the case of the nanoLC setting, samples were loaded on C18 precolumns with different loading capacity, and gradients of different lengths were tested in order to increase the amount of material loaded on the system without affecting the linearity of the MS response. For each experimental setting, the limit of detection by SRM of candidate biomarkers, spiked at different concentrations in plasma or cerebrospinal fluid, was determined. Our results indicate that the loss of sensitivity of conventional HPLC compared to nanoLC is balanced by the higher amount of sample that can be injected in the instrument, making this instrumental configuration an interesting alternative for the detection of low-abundant species, as long as the absolute quantity of starting material does not represent a limiting factor.



[P97] Silver interaction in the prion octarepeat domain

Bruno Bellina1, Isabelle Compagnon1, Rodolphe Antoine1, Michel Broyer1, Philippe Dugourd1, Alexander Kulesza2, Roland Mitric2, Vlasta Bonačić-Koutecký2

1 Laboratoire de spéctrométrie ionique et moléculaire, CNRS LYON1, 43, Boulevard du 11 Novembre 1918, 69622 VILLEURBANNE , FRANCE2 Department of Chemistry Humboldt-Universität zu Berlin, Brook-Taylor-Str. 2, D-12489 BERLIN, ALLEMAGNE

Contact: Philippe Dugourd ([email protected])Keywords: Systems biology

PRION, proteinaceous infectious particle, is an infectious agent composed of protein in a misfolded form. This new structure, which is influenced by metal binding, becomes pathological and is involved in many diseases such as Creutzfeldt-Jakob.

The prion protein is known to binds metal in its N-terminal octarepeat domain. This domain is composed of tandem repeats of the sequence PHGGGWGQ. Recent work showed that each HGGGW (Histidine, Glycine and Tryptophan) segment may accommodate on metal ion. We aim at investigating the coordination of silver in this amino acid sequence and his influence on the peptide conformation.

Using a mass spectrometer coupled with OPO lasers in the UV and IR regions, we measured the optical and vibrational spectra of the [HGGGW+Ag]+ complex and of several other sequences. Optical properties, binding site and peptide confirmation will be discussed. We will also report ion mobility spectroscopy and theoretical results.


[P98] Etude lipidomique de coupes de cerveaux post-mortem issus de patients atteints de la maladie d’Alzheimer : apport des approches globales et semi-globales.

Mathieu Gaudin1, Maï Panchal4, Sophie Ayciriex1, Mélaine Courcoul1, Erwan Werner3, David Touboul2, Nicolas Auzeil1, Alain Brunelle2, Charles Duyckaerts4, Olivier Laprévote1

1 Laboratoire de Chimie-Toxicologie Analytique et Cellulaire, Faculté des Sciences Pharmaceutiques et Biologiques, Université Paris Descartes, 4 avenue de l'Observatoire, 75270 Paris Cedex 062 Centre de recherche de Gif, Institut de Chimie des Substances Naturelles, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette Cedex3 Division Métabolisme, Technologie Servier, 25/27 rue Eugène Vignat, BP 1749, 45007 Orléans Cedex 14 Laboratoire de Neuropathologie Escourolle, Hôpital de la Pitié-Salpêtrière, 47/83 boulevard de l'hôpital, 75013 Paris5 Centre de recherche de l'ICM, 47/83 boulevard de l'hôpital, 75013 Paris

Contact: Mathieu Gaudin ([email protected])Keywords: Proteins, peptides and small molecules quantification , Separative analysis methods

La maladie d’Alzheimer (MA) se caractérise par la présence de deux lésions cérébrales, les plaques séniles et les dégénérescences neurofibrillaires. Les mécanismes physiopathologiques qui aboutissent à leur constitution restent mal compris. A l’heure actuelle, l’allèle epsilon-4 du gène codant l’apolipoprotéine E (ApoE), un transporteur des lipides, est considéré comme l’un des facteurs de risque le plus important de la maladie. D’autre part, l’ApoE a été identifiée dans les plaques séniles. Ces données suggèrent que des modifications dans le transport et dans le métabolisme des lipides jouent un rôle dans la pathogénèse de la MA.

Afin d’établir le profil lipidique cérébral post-mortem de patients atteints de la MA, nous présentons une stratégie d’analyse comprenant l’extraction des lipides totaux à partir de coupes de cerveau et leur identification par couplages chromatographie liquide - spectrométrie de masse suivant deux approches présentant des degrés de sélectivité croissants.

Une approche dite globale utilise le couplage de la chromatographie liquide à polarité de phase inversée afin de séparer les lipides par leur hydrophobicité. Leur détection est assurée par spectrométrie de masse haute résolution à temps de vol (Synapt G2 HDMS) permettant la détermination des compositions élémentaires.

Afin d’observer des modifications plus fines du lipidome, une approche semi-globale a été développée et appliquée à l’identification de six classes de phospholipides et de sphingolipides. Après séparation par chromatographie liquide à polarité de phase inversée, les lipides sont sélectionnés par balayages spécifiques, ions précurseurs et pertes de neutres, à l’aide d’un spectromètre de masse de type triple quadripôle, afin de détecter sélectivement les lipides appartenant à une classe déterminée.

Une analyse statistique multivariée, réalisée à partir de profils lipidiques précédents, a mis en évidence une différence de concentration dans certaines familles de lipides entre les patients atteints de la maladie d’Alzheimer et des sujets non atteints.

L’approche globale indique notamment une augmentation des céramides dans l’ensemble du cortex temporal. Elle est confirmée par une analyse semi-globale ciblant les céramides et pourrait être due à une hydrolyse des sulfatides. Nous avons également observé une augmentation des sphingomyélines mais uniquement dans la substance blanche. Sachant que par ailleurs Grimm et al [Nature Cell Bio, 2005] ont montré une augmentation de l’activité de la sphingomyélinase dans les cultures de neurones exposées au peptide β-amyloïde 1-42, notre résultat semble suggérer l’existence d’un mécanisme différent dans les fibres de myéline et dans les corps cellulaires des neurones.


[P99] Towards quantitative analysis of sweat proteome

Anne-Marie Hesse1, Alexandra Kraut1, Damien Barthe1, Jean-Claude Launay2, Gustave Savourey2, Christophe Bruley1, Yohann Couté1

1 Biologie à Grande Echelle, CEA / INSERM 1038 / UJF, 17 rue des Martyrs, 38054 Grenoble cedex 9, France2 Pôle Tolérance Climatique et Vêtement CRSSA / DFH, , 24 Avenue des Maquis du Grésivaudan, 38702 La Tronche cedex, France

Contact: Anne-Marie Hesse ([email protected])Keywords: Proteins, peptides and small molecules quantification , Bioinformatics et biostatistics dedicated to proteomics

During interventions, emergency workers or servicemen must face extreme situations that may deeply impact their physiological behaviour. Real-time monitoring of biomarkers reflecting subject state would allow to prevent any medical accident by anticipating their pullback from the danger zone. In this context, sweat represents a biological fluid of choice for non-invasive detection of that kind of markers. We therefore undertook a proteomic analysis of human sweat obtained from donors submitted to various environmental constraints. We first explored the preparation of sweat proteins to bring them to liquid chromatography coupled to mass spectrometry analyses. Our results indicate that ultrafiltration combined with SDS-PAGE gave the best results in terms of protein recovery and number of identifications. To date, more than 300 proteins have been identified with high confidence in this biological fluid, which represents the biggest contribution to the establishment of a repertoire of human sweat proteins.In order to compare sweat proteome from subjects submitted to different constraints, isobaric tagging was chosen as the quantitative proteomics strategy. Several tests were conducted in terms of chemical label (TMT versus iTRAQ) or fragmentation mode (PQD versus HCD). Finally iTRAQ labelling was selected and adapted to in-gel protein digestion; labelled peptides were submitted to HCD which gave the more accurate results A great effort was consented to integrate the quantification data in the automated pipeline of identification validations and comparisons developed in-house (validated with IRMa, structured within Mass Spectrometry Identification databases – MSIdb – and analysed with hEIDI).The chosen strategy is currently applied on sweat samples collected from a cohort of 20 subjects submitted to 3 different environmental constraints: at rest in a hot area, at rest in a warm and humid atmosphere and with physical exercise in a warm and humid atmosphere .


[P100] Effets de l’acétylation des peptides de la peau de la rainette Pachymedusa dacnicolor pour un séquençage de Novo par MALDI-TOF/TOF.

Claire Lacombe1, Constance Auvynet3, Germain Tong1, Gérard Bolbach1, Emmanuelle sachon1

1 Universite» P. et M. Curie Paris 6, UMR 7203 CNRS-UPMC-ENS, 4, place Jussieu, 75005 Paris, France2 Plateforme de spectrométrie de masse et protéomique, IFR83, 7-9, quai saint Bernard, 75005 Paris, France3 Pitié salpêtrière, 91, Bd de l'hôpital, 75013 Paris, France

Contact: Emmanuelle sachon ([email protected])Keywords: Clinical proteomics

Les grenouilles d’Amérique latine synthétisent et sécrètent au niveau de leur peau, des peptides biologiquement actifs. Dans cette étude, nous nous intéressons aux peptides issus de la peau de la rainette, Pachymedusa dacnicolor, afin d’isoler et caractériser de nouveaux peptides d’intérêt thérapeutique. Pour ce faire, nous travaillons sur des exsudats de peau. Les peptides contenus dans ces exsudats sont séparés par tamis moléculaire suivi d’HPLC. Les fractions obtenues sont testées pour leur activité biologique puis 4 fractions actives ont été analysées par spectrométrie de masse. Dans ces fractions, 6 peptides ont été identifiés et fragmentés par MALDI-TOF/TOF (séquençage de Novo). Deux d’entre eux avaient déjà été publiés (DMS-DA5 et DMS-DA8). Le troisième correspond au peptide DMS-DA6 de la même étude mais dont l’extrémité C-terminale est sous forme acide carboxylique (GVWGIAKIAKIAGKVLGNILPHVFSSNQS-COOH). Les trois autres peptides coexistent dans la quatrième fraction et possèdent une structure primaire N-terminale identique (résidus 1 à 29). Cette séquence commune, qui avait été déduite à partir de l'ADN de grenouille en 1998 est la suivante : ALWKTLLKKVGKVAGKAVLNAVTNMANQN-COOH. Les deux autres peptides de cette fraction possèdent ces 29 résidus +E et +EQ en C-terminal. Le peptide DMS-DA6 a été synthétisé sous forme amidée ou non en C-terminal. L’activité antimicrobienne des deux peptides a été testée sur deux souches de bactéries (Gram+ et -) et leur structure secondaire déterminée par dichroïsme circulaire.Tous ces peptides de peau de grenouille contiennent généralement une grande quantité de résidus K, il a donc été nécessaire de recourir à une réaction d’acétylation afin de lever l’ambigüité Q/K qui existe du fait de la limitation dans la précision de mesure de masse de l’instrumentation MALDI-TOF (≥20 ppm pour les peptides). L’acétylation des 4 fractions HPLC nous a permis de lever les ambiguïtés K/Q et nous a montré que cette réaction peut avoir lieu sur les fonctions amine primaires (N-terminal et résidus K) mais aussi, dans une moindre mesure, sur la fonction amine secondaire des résidus H. L’acétylation complète des peptides conduit à la disparition des sites protonables (si aucun résidu R dans la séquence). Ceci entraine la disparition de la molécule monoprotonée [M+H]+ au profit des espèces [M+Na]+ et [M+K]+. Dans le cas de la présence d’un résidu P dans la séquence de ces peptides, on observe une fragmentation source, préférentielle en N-terminal du résidu P. Ces peptides acétylés constituent de bons modèles pour aborder le phénomène d’ionisation en MALDI.

Link: http://www.chimie.ens.fr/LBM/


[P101] Differential proteomic analysis: iTRAQ vs zoomed 2D gel. Illustration by the study of Pseudomonas aeruginosa biofilms grown on glass wool.

Anne Marie Lomenech1, Delphine Lapaillerie1, Jean William Dupuy1, Stephane Claverol1, Michel Perrot1, Marc Bonneu1, Sébastien Vilain1

1 Plateforme Protéome Centre de Génomique Fonctionnelle Bordeaux, 146 rue Léo Saignat, 33076 BORDEAUX Cedex

Contact: Sébastien Vilain ([email protected])Keywords: Proteins, peptides and small molecules quantification

Bacterial biofilms are communities of bacteria attached to a support and embedded in a matrix of exopolymers. In this form of life, immobilized bacteria become hyper-resistant to all environmental stresses, particularly to antibiotics. Biofilms are therefore a major public health problem. Research conducted in many areas where these biofilms are found are intended to identify key genes involved in the establishment or maintenance of biofilms and / or resistance to antibiotics. As part of this research, we compared the protein content of P. aeruginosa grown as biofilm or suspended via two techniques of proteomic analysis: An off-gel approach, iTRAQ and an in-gel approach, zoomed 2D electrophoresis. We present here a quantitative and qualitative comparison of results obtained with these two techniques by highlighting the similarities and differences.


[P102] ICM-MS analysis to display specific protein interactions between cells (spermatozoa) and biologic fluid (seminal plasma)

Ana-Paula Teixeira-Gomes1, Laure Dewaele1, Guillaume Tsikis3, Nadine Gérard3, Xavier Druart3, Valérie Labas1

1 INRA, Plate-forme d’Analyse Intégrative des Biomarqueurs, Centre de Recherches INRA de Tours, 37380 Nouzilly2 INRA, UR1282, Infectiologie Animale et Santé Publique, Centre de Recherches INRA de Tours, 37380 Nouzilly3 INRA, UMR 85, Physiologie de la Reproduction et des Comportements– UMR CNRS 6175 – Université de Tours -Institut Français du Cheval et de l’Equitation, Centre de Recherches INRA de Tours, 37380 Nouzilly

Contact: Ana-Paula Teixeira-Gomes ([email protected])Keywords: Systems biology

Spermatozoa are produced by the testis. They need to transit through the epididymis to achieve their maturation and acquire functional and physiological competence to fertilize the oocyte.Intact cell matrix-assisted laser desorption/ionization mass spectrometry (ICM-MS) is a well established method to detect low molecular weight (<30kDa) compounds (peptidomic/proteomic). This fast and reliable method has been used first for identification of bacteria by comparison of MS «fingerprints». It has recently been extended to the analysis of eukaryotic cells to display biomarkers. The spectra from whole cells reflect only a small part of the cellular protein. Indeed, ICM-MS promotes the desorption/ionization of the protein membrane or protein linked to the surface cell and becomes an original approach to study interaction between a fluid and the cells.In the present study, ICM-MS was used to visualize changes in spermatozoa protein patterns during their epididymal maturation. The goal was to discriminate seminal plasma proteins (originating from several glands) which could be involved in the final maturation of gametes, and may be linked to fertility. Epididymal (EPI) and ejaculated (EJAC) spermatozoa, as well as seminal plasma (SP), were collected from boars. Some EPI spermatozoa were incubated in the presence of saline or SP for 10 min at 37°C. Then, EPI, EJAC and EPI+SP spermatozoa were mixed in a sinapinic acid matrix solution prior to generate MALDI-TOF profiles in the 2-20 kDa mass range. Differentially expressed peptides or proteins were found according to a probability value < 0.01 with the Progenesis MALDITM software (Nonlinear Dynamics).The comparison of the ICM-MS profiles of the three populations (EPI, EPI + SP, EJAC) showed protein modifications linked to interactions between the fluid and the cells. Among the 229 peaks detected, 11 were less intense in EPI+SP and EJAC groups, whereas 32 were detected with a larger intensity in EPI+SP and EJAC groups. Some of them may correspond to spermadhesins that are present in large amounts in seminal plasma. Of note is the fact that most modifications are still unknown.In conclusion, we demonstrated for the first time the suitability of the ICM-MS to study interactions of proteins from a biologic fluid (seminal plasma) with eukaryotic cells (spermatozoa). This approach may be adapted to identify newly molecular species involved in male fertility.


[P103] Etude de la conformation de peptides lasso par mobilité ionique et simulations REMD

Fabien Chirot1, Séverine Zirah3, Carlos Afonso4, Sylvie Rebuffat3, Philippe Dugourd2, Jean-Claude Tabet4

1 Institut des Sciences Analytiques, UMR 5280 CNRS-Université Claude Bernard-Lyon1, 43 Boulevard du 11 Novembre 1918 , 69622 Villeurbanne, France2 Laboratoire de Spectroscopie Ionique et Moléculaire, UMR 5579 CNRS-Université Claude Bernard-Lyon1, 43 Boulevard du 11 Novembre 1918 , 69622 Villeurbanne, France3 Molécules de Communication et Adaptation des Microorganismes, UMR 7245 CNRS-Muséum National d’Histoire Naturelle, 57 rue Cuvier, 75005 Paris, France4 Institut Parisien de Chimie Moléculaire, UMR 7201 CNRS-Université Pierre et Marie Curie-Paris6, 4 place Jussieu, 75252 Paris, France

Contact: Fabien Chirot ([email protected])Keywords: Ionic mobility

Les peptides lasso se caractérisent par une structure primaire particulière mettant en jeu une liaison covalente entre le groupement amine N-terminal et la chaîne latérale d’un acide aspartique ou glutamique en position 8 ou 9. Leur structure secondaire forme un « lasso » où la chaîne principale passe à travers la boucle ainsi créée pour former un nœud. En raison de leurs propriétés intéressantes, notamment antimicrobiennes, liées à leur structure en lasso, de nombreux efforts on été mis en œuvre pour réussir à synthétiser de tels peptides initialement produits par des bactéries. Leur structure particulière, extrêmement contrainte, est de plus relativement unique dans le domaine des biomolécules.Afin de mieux comprendre les facteurs qui stabilisent cette structure en lasso, et notamment l’influence des interactions intramoléculaires, nous avons étudié par mobilité ionique une série de peptides modèles dérivés de la capistruine, peptide lasso de 19 acides aminés produit par Bhurkholderia thailandensis E264. A travers la mesure de sections efficaces de diffusion d’ions dans un gaz, cette technique permet d’une part de mettre en évidence l’éventuelle coexistence de différents conformères, et d’autre part, via la comparaison avec des simulations, d’obtenir des informations structurales. Nous avons donc réalisé des simulations de dynamique moléculaire par échange de répliques (REMD) basées sur le champ de forces AMBER99 afin d’explorer de manière efficace le paysage conformationnel complexe de ces peptides, et d’aider à l’interprétation des données expérimentales.Nous présenterons les résultats obtenus pour trois peptides modèles ayant une séquence identique mais une forme différente : la forme lasso (L), une forme comportant une boucle, mais pas de nœud (S), et une forme linéaire (C). Les résultats expérimentaux montrent que, de manière assez surprenante, les trois formes présentent des sections efficaces de diffusion voisines. De plus, les profils de mobilité mesurés révèlent la coexistence de plusieurs conformations pour les trois formes, y compris pour la forme L pourtant très contrainte. Les simulations peinent à reproduire quantitativement l’expérience en raison de la taille des peptides, qui atteint les limites de l’outil théorique. Cependant ces résultats suggèrent que l’existence de ponts salins pourrait être à l’origine de la compacité des structures observées pour la forme linéaire en ajoutant une contrainte structurale similaire à celle causée par l’existence d’une boucle.


[P104] Couplage laser/mobilité ionique – fragmentation résolue en conformation

Lise Morlet1, Luke MacAleese2, Fabien Chirot1, Jérôme Lemoine1, Philippe Dugourd2

1 Institut des Sciences Analytiques, UMR 5280 CNRS-Université Claude Bernard-Lyon1, 43 Boulevard du 11 Novembre 1918 , 69622 Villeurbanne, France2 Laboratoire de Spectroscopie Ionique et Moléculaire, UMR 5579 CNRS-Université Claude Bernard-Lyon1, 43 Boulevard du 11 Novembre 1918 , 69622 Villeurbanne, France

Contact: Fabien Chirot ([email protected])Keywords: Instrumentation, Ionic mobility

La détermination de la structure de systèmes moléculaires complexes tels que les protéines ou les complexes protéiques représente un enjeu important aussi bien pour la compréhension du fonctionnement de ces édifices au niveau moléculaire que pour le développement de stratégies d’identification ou de diagnostic. Avec la taille croissante des systèmes d’intérêt, les techniques disponibles atteignent leur limite et la mise au point de méthodes alternatives devient nécessaire. Une démarche efficace consiste à combiner des techniques différentes donnant des informations complémentaires et orthogonales sur les molécules étudiées.C’est dans cet esprit que nous avons développé un nouveau dispositif expérimental qui permet de coupler un laser à un spectromètre par mobilité ionique. La spectrométrie par mobilité ionique consiste à séparer des ions selon leur vitesse de diffusion dans un gaz sous l’influence d’un champ électrique. A travers la mesure d’une section efficace de collision avec le gaz, cette technique constitue une sonde globale de la conformation en phase gazeuse des ions étudiés. Dans notre dispositif, le pouvoir de séparation de la mobilité ionique est utilisé pour sélectionner les molécules en conformation avant de provoquer leur fragmentation par absorption d’un ou plusieurs photons. L’objectif de ces expériences de fragmentation résolue en conformation est d’une part de comprendre l’influence de la conformation sur les canaux de fragmentation et d’autre part d’utiliser la sensibilité des sondes optiques à l’arrangement local des molécules pour remonter à une information structurale. La combinaison de sondes locale et globale de la conformation de biomolécules ouvre de nombreuses possibilités pour l’étude d’édifices moléculaires complexes en permettant avec un même instrument d’accéder à différents niveaux de structuration.Nous présenterons les premiers résultats obtenus sur des sucres et des peptides modifiés par greffage de chromophores. Ces systèmes modèles serviront de base à l’application de cette technique à des protéines entières et à des complexes protéine-ligand.


[P105] Outils statistiques pour la spectroscopie par mobilité ionique

Fabien Chirot1, Florent Calvo2, Florian Albrieux2, Yury Tsibyn3, Jérôme Lemoine1, Philippe Dugourd2

1 Institut des Sciences Analytiques, UMR 5280 CNRS-Université Claude Bernard-Lyon1, 43 Boulevard du 11 Novembre 1918 , 69622 Villeurbanne, France2 Laboratoire de Spectroscopie Ionique et Moléculaire, UMR 5579 CNRS-Université Claude Bernard-Lyon1, 43 Boulevard du 11 Novembre 1918 , 69622 Villeurbanne, France3 Biomolecular Mass Spectrometry Laboratory, Ecole polytechnique fédérale de Lausanne, EPFL SB ISIC LSMB BCH 4307 (Bât. BCH), 1015 Lausanne, Suisse

Contact: Fabien Chirot ([email protected])Keywords: Ionic mobility

L’interprétation des expériences de mobilité ionique, et plus particulièrement la détermination de la structure des systèmes étudiés, requièrent la mise en œuvre d’outils théoriques appropriés. Une des principales difficultés dans cette tâche est de réaliser une exploration efficace du paysage conformationnel des molécules d’intérêt, ce qui est d’autant plus difficile que ces molécules sont complexes. Dans le cas des peptides ou des protéines, une telle exploration n’est ainsi réalisable, en pratique, que pour des entités de taille relativement modeste (une dizaine d’acides aminés). Parmi les outils théoriques disponibles, l’utilisation de champs de forces dans le cadre d’algorithmes de dynamique moléculaire par échange de répliques (REMD) est particulièrement bien adaptée pour traiter type de problèmes. Nous montrerons que, au-delà de son efficacité en termes d’exploration conformationnelle, la REMD peut être utilisée pour obtenir des informations supplémentaires sur les systèmes étudiés. En effet, l’utilisation de la méthode des historammes pondérés (WHAM) permet une exploitation plus fine des calculs REMD, en donnant accès à des paramètres d’ordre autres que la section efficace de diffusion mesurée en mobilité ionique. A travers l’exemple de polyalanines (11 acides aminés), nous illustrerons le fait que l’observation d’un seul pic de mobilité ionique peut être compatible avec la coexistence de différents conformères mis en évidence via une analyse par WHAM.Nous aborderons d’autre part l’étude de systèmes plus complexes pour lesquels les simulations REMD ne parviennent pas à reproduire des comportements tels que la bistabilité, pourtant observés expérimentalement. Dans ce cas, nous montrons l’intérêt d’introduire un biais dans le champ de force utilisé afin de guider l’exploration conformationnelle vers les zones correspondant aux observations expérimentales. Nous donnerons l’exemple d’un variant d’une sous unité de la protéine M2 du virus de la grippe A (25 acides aminés) pour lequel les données expérimentales montrent la coexistence de deux structures alors que les simulations REMD n’en rendent pas compte. La réalisation de simulations biaisées permet d’obtenir des conformations non-seulement compatibles avec l’expérience, mais ayant de plus, pour certaines d’entre elles, une énergie plus basse que celles ressortant de l’exploration non biaisée.


[P106] Development of a novel method for sterol analysis by UPLC-ESI-MS: Application on a neurodegeneration model

Sophie Ayciriex1, Mathieu Gaudin1, Fathia Djelti3, Mélaine Courcoul1, Anne Régazetti1, Patrick Aubourg3, Nathalie Cartier3, Nicolas Auzeil1, Olivier Laprévote1

1 Laboratoire de Chimie-Toxicologie Analytique et Cellulaire EA4463, Université Paris Descartes, Faculté des Sciences Pharmaceutiques et Biologiques , 4, avenue de l'observatoire - case 47, 75006 Paris, France2 Institut de chimie des substances naturelles, Centre de recherche de Gif, CNRS, 2, avenue de la terrasse, 91198 Gif-sur-Yvette cedex, france3 INSERM UMR U745, Génétique et biothérapies des maladies dégénératives et prolifératives du système nerveux, Université Paris Descartes, 4, avenue de l'observatoire, 75006 Paris, France4 Laboratoire de Toxicologie Biologique - Hôpital Lariboisière, 2, rue Ambroise Paré, 75975 Paris cedex 10, France

Contact: Sophie Ayciriex ([email protected])Keywords: Separative analysis methods, High mass and high resolution mass Spectrometry, Organic and inorganic mass spectrometry

Alzheimer’s disease (AD) is a progressive neurodegenerative disorder which conduces to dementia. The pathological hallmarks of AD include formation of extracellular neurotoxic β-amyloid plaques in the brain, dystrophic neurites associated with plaques and neurofibrillary tangles within nerve cell bodies. Cerebral cholesterol represents about 25% of the entire body cholesterol. It is mainly located in neuronal cell membranes and influences membrane stability and fluidity. Brain cholesterol is synthesized in situ. The excess of cholesterol is converted into 24S-hydroxycholesterol by neuronal cholesterol 24-hydroxylase (enzyme encoded by CYP46A1 gene) for elimination across the blood-brain barrier in the circulation. Some studies have revealed that disruption in cholesterol homeostasis could be involved in the pathogenesis of AD. Indeed, concentration modifications of cholesterol, 24S-hydroxycholesterol and other oxysterols, especially 7-ketocholesterol and 7-β-hydroxycholesterol are found in AD patients. These compounds seem to be key actors in this particular neurodegenerative disease. In order to quantify the cholesterol and his toxic metabolites in AD brain, we have developed a liquid chromatography method combined with high resolution mass spectrometry for the identification of oxysterols contained in brain of transgenic mouse models. The methodology includes a simple oxysterol derivatization step to add selectivity and enhance their ionization rates. This methodology was applied on a C57BL/6 mice model which underwent intra-cerebral injection of AAV5 vector encoding sh-CYP46A1 (RNA interference strategy) in hippocampus area. The effects of CYP46A1 gene down-regulation induce a neurodegeneration process due to the presence of toxic cholesterol metabolites.


[P107] Etude du métabolome du sélénium dans les levures par chromatographie liquide bimodale RPLC/HILIC couplée à la spectrométrie de masse haute résolution (MSn Orbitrap)

Carine Arnaudguilhem1, Hugues Preud'homme1, Katarzyna Bierla1, Laurent Ouerdane1, Ryszard Lobinski1

1 Laboratoire de Chimie Analytique Bio-inorganique et Environnement IPREM UMR5254, 2 Avenue Pr. Angot, 64053 Pau, France

Contact: Carine Arnaudguilhem ([email protected])Keywords: Separative analysis methods, Organic and inorganic mass spectrometry

Le sélénium est un oligoélément essentiel connu pour ses propriétés anti-oxydantes, antitoxiques vis à vis des métaux, et son rôle dans la prévention des cancers et des affections cardiovasculaires. Les levures enrichies en sélénium constituent le complémentaire alimentaire le plus répandu pour compenser les carences alimentaires, car elles sont capables d'accumuler jusqu'à 3000mg Se/kg et sont peu onéreuses.Le métabolisme du sélénium dépend fortement de sa forme chimique (spéciation) et il établi que seules les formes organiques sont assimilables. Ainsi, la détermination du profil métabolique du sélénium, véritable empreinte de la levure et du processus de fermentation, est essentielle pour connaître la biodisponibilité du sélénium.

Cette étude a pour objectif de développer une méthode d'analyse du métabolome sélénié dans la fraction aqueuse de la levure. De nombreux travaux sont reportés dans la littérature. Ils mettent généralement en jeu des séparations par chromatographie en phase liquide en mode inverse, normal ou d'échange d'ions. Ces méthodes ont permis d'identifier de nombreux métabolites, mais elles sont spécifiques à des molécules de même propriétés chimiques (apolaires, polaires ou ioniques). Dans cette étude, nous avons développé une nouvelle méthode d'analyse par chromatographie liquide bimodale RPLC/HILIC couplée à la spectrométrie de masse haute résolution MSn Orbitrap, permettant d'analyser simultanément les composés apolaires et polaires sur une même colonne. Après fractionnement par chromatographie d'exclusion stérique / ICP-MS, les métabolites sont séparés sur une colonne Hypercarb avec un gradient Eau 0,1% d'acide formique/acétonitrile pour le mode RPLC et acétonitrile/Eau 0,1% acide formique pour le mode HILIC. Cette colonne, constituée d'une phase inverse PGC (Porous Graphitic Carbon), présente l'avantage de retenir également les composés polaires et ioniques par des interactions électrostatiques avec le carbone. Nous avons exploité cette propriété et utilisé la colonne dans les 2 modes de fonctionnement, mode inverse et mode HILIC. Ce mode de séparation nous a permis de détecter une quarantaine de composés séléniés dont 7 en mode HILIC. Le couplage avec la spectrométrie de masse haute résolution Orbitrap en mode MSn permet de caractériser et d'identifier les métabolites avec une précision de masse inférieure à 2ppm.

Link: www.lcabie.com


[P108] How proteomics shed light in understanding host-parasite interplay and clinical consequences during trypanosome infectious process.

Philippe Holzmuller1, Pascal Grébaut1, Nereida Parra Gimenez2, Jean-Paul Brizard3, Edith Demettre4, Martial Séveno4, Mary Ysabel Gonzatti2, Gérard Cuny1

1 UMR InterTryp, CIRAD-IRD, Campus International de Baillarguet, 34398 Montpellier, France2 Departamento de Biología Celular, Universidad Simón Bolívar, Carretera Hoyo de la Puerta-Baruta, 1080 Caracas, Venezuela3 Plate-forme 2D-DIGE, Pôle Protéomique de Montpellier (UMR5096), IRD, 911, avenue Agropolis, 34394 Montpellier, France4 Plate-forme de Protéomique Fonctionnelle (FPP), BioCampus Montpellier (UMS3426), 141, rue de la Cardonille, 34094 Montpellier, France

Contact: Edith Demettre ([email protected])Keywords: Systems biology, Clinical proteomics, Bioinformatics et biostatistics dedicated to proteomics

Animal trypanosomosis is one of the most severe constraints to agricultural development in Sub-Saharan Africa and is also an important disease of livestock in Latin America and Asia. The causative agents are various species of protozoan parasites belonging to the genus Trypanosoma, among which T. congolense and T. evansi are the major pathogenic species. The extracellular position of the trypanosomes in the host’s biological fluids implies to consider both the parasite and its excreted-secreted factors in the infectious process and its physiopathological consequences. Despite decades of research, the molecular keys inducing clinical diversity are still poorly understood. The postgenomic era have stimulated the development of new techniques and bioinformatics tools to identify the locations, functions and interactions of the gene products in tissues and/or cells of living organisms. Among these advances, we used two-dimensional Differential In Gel Electrophoresis (2-DIGE) coupled to Mass Spectrometry (MS), a well-proven technology to propose for the first time a comparative approach of the secretome (i.e. naturally excreted-secreted molecules) of T. congolense and T. evansi clones exhibiting marked differences in their virulence and pathogenicity profiles. Surprisingly, the 2D-DIGE/MS analytical filter highlighted few differentially expressed molecules, some of which were moreover identified as Putative Uncharacterised Protein. Nevertheless and interestingly, bioinformatics allowed us to directly link several proteins to the clinical disorders observed in trypanosome-infected animals in the field. As illustrated by four biomarkers, it shows how proteomics is powerful in the molecular identification of differentially expressed trypanosomes molecules correlated with either the virulence process or exhibiting potential properties to induce pathogenic dysregulation of physiological functions. Moreover, deciphering of the molecular dialogues and conflicts that govern host-parasite interplay is promising to define new molecular targets for improved field diagnosis and new strategies of interference with the infectious process to fight against animal trypanosomosis.


[P109] Troglitazone metabolism in a chimeric mouse model with humanized livers determined by high mass accuracy MSn analysis

Alan BARNES1, Neil LOFTUS1, Chris TITMAN1, Ian D. WILSON2, Filippos MICHOPOULOS2, Timothy SCHULZ-UTERMOEHL2, Yoshio MORIKAWA3, Stéphane MOREAU4

1 SHIMADZU ISS, Trafford Wharf Road, M17 1GP MANCHESTER (UK)2 ASTRA ZENECA, Alderley Park, Macclesfield , SK10 4TG Cheshire (UK)3 PhoenixBio Co. Ltd, 3-4-1, Kagamiyama, 739-0046 Higashi-Hiroshima City (Japan)4 SHIMADZU France, 65 Avenue du General De Gaulle, 77420 CHAMPS/MARNE (France)

Contact: Stéphane MOREAU ([email protected])Keywords: High mass and high resolution mass Spectrometry

IntroductionThe chimeric PXB mouse model has a high percentage of the liver repopulated by human hepatocytes and has been proposed as a tool for the prediction of human disposition and hepatic effects. To assess the PXB model, a known human selective hepatotoxin, troglitazone, was dosed to wild type (SCID) and PXB mice (n=3 or 4 per group and dose level). This paper describes the metabolite changes between SCID and PXB mice following a single daily oral administration for 7 days of either vehicle or 300 or 600mg/kg/day of troglitazone using high mass accuracy MSn analysis.Method　　Liver extracts from SCID and PXB mice were analysed using a high resolution LC/MSn system (Nexera LC coupled with a LCMS-IT-TOF; Shimadzu Corporation). Both aqueous and organic extracts were analysed using a Phenomenex Kinetex C18 1.7um (2.1x100mm) held at 60C; components were separated with a gradient elution (mobile phase was A - water + 0.1% formic acid and B - methanol:propan-2-ol (85:15) + 0.1% formic acid) at a flow rate of 0.6ml/min. The LCMS-IT-TOF acquired MS and MS2 data in both positive and negative ionisation using a polarity switching speed of 100msecs with a scan range of m/z 150-1250. Profiling Solution software (Shimadzu, Japan) was applied to metabolite profiling analysis to assess the impact of changes in lipid profiles. ResultsTroglitazone (CS-045) is an oral antidiabetic agent with hypoglycemic activity in non-insulin-dependent diabetes mellitus in animals and humans. The pharmacodynamics of troglitazone in man are characterized by metabolism in the liver, CLtot essentially reflects hepatic metabolism. Glucuronidation and sulfation are the major pathways of metabolism, along with a minor degree of oxidation to the quinone form. SCID wild type mice showed liver metabolite profiles which are consistent with previously published data but differ from human metabolite profiles. PXB mice metabolite profiles differ markedly from the wild type. Although sulfate metabolite dominates the metabolism pathway in PXB mice, the glucuronide and sulfate metabolites are minor metabolites in comparison to the SCID wild type mouse. A finding which is consistent with published data in man. In conclusion, the PXB mouse model can provide a first insight into human in vivo metabolism.



[P110] Non Card Dried Biofluid Spot Format for the Analysis of Protease Inhibitors using High resolution Liquid chromatography with Fast Tandem Mass Spectrometric Detection.

Michel WAGNER1, Neil LOFTUS2, Alan BARNES2, Chris TITMAN2, Emmanuel VARESIO1, Gérard HOPFGARTNER1, Stéphane MOREAU3

1 UNIVERSITY OF GENEVA, Quai Ernest-Ansermet 30, CH-1211 GENEVA 4 (Suisse)2 SHIMADZU , Mill Court, Featherstone Road, Wolverton Mill South,, MK12 5RD MILTON KEYNES (UK)3 SHIMADZU France, 65 Avenue du Général De Gaulle, 77420 CHAMPS/MARNE (France)

Contact: Stéphane MOREAU ([email protected])Keywords: Proteins, peptides and small molecules quantification

Introduction The use of dried biofluid spot (DBS) on filter paper is rapidly becoming the method of choice for the analysis of pharmaceuticals and their metabolites by HPLC coupled to MS detection. The assay typically uses a punched disk taken from the DBS sample, followed by solvent-liquid extraction and analysis by reversed phase HPLC separation, combined with multiple reaction monitoring mass spectrometric detection. Unfortunately, SLE is not very selective and can lead to possible ionization matrix effects. We present a novel, tube based format for DBS, which allows sample collection on paper and analyte extraction, in a single device. This eliminates the need of the punching step and allows novel approaches in sample storage and analyte extraction. In this paper we describe sample preparation strategies followed by fast chromatographic separation on a triple quadrupole instrument in the SRM mode with very short duty cycle and fast polarity switching.

Methods DBS extracts were analyzed on a Nexera UHPLC system equipped with a fast injector (SIL30AC-MP) hyphenated to a LCMS-8030 triple quadrupole mass spectrometer (Shimadzu). Mobile phases were: A) 0.1% acetic acid (AA) in water and, B) 0.1% AA in acetonitrile. The flowrate was set at 600 μl/min. The binary gradient was linear from 30%to 80% in 3 min. for protease inhibitors assays and from 30% to 70% B in 2.5 min. forbosentan assay. In both cases the column was a Kinetex XB-C18 (2.1 x 100 mm, 1.7 μm,Phenomenex) and was thermostated at 50°C. The injection was of 5 μl.The total MS duty cycle was of 184ms including eight 20ms SRM transitions for the PI assay (electrospray ionisation in positive polarity). For the bosentan assay the total MSduty cycle was of 318ms for eight 20ms and eight 10ms SRM transitions with electrospray alternating from positive to negative polarity.

ResultsA key advantage of this technique is that DBS tube-based format allows sample collection on paper and analyte extraction in a single device. Using typical sample volumes of 15 μl allows LOQ down to the low ng/ml range to be achieved. Variable filter thicknesses can be used from 5-25 μl to meet the needs of the individual assay.This approach can be used not only to whole blood but to all other biofluids using a generic SLE sample preparation method which could be a considerable advantage in clinical analysis. To achieve short analysis time and high separation efficiencies, 2 mm i.d. core-shell silica based columns where used at a ¬flow rate of 0.6 mL/min and pressures of about 600 bars at a temperature of 50 °C (shorter analysis time could be achieved by even increasing further the flow rate). Optimizing response of the MS used a high speed data acquisition and fast polarity switching (15msecs). Using a 15μL blood or plasma aliquot adequate sensitivity, precision and accuracy could be achieved for the determination of seven protease inhibitors using only one internal standard.


[P111] Étude de complexes biologiques non-covalentS de hauts poids moléculaires par MALDI-TOF-MS après pontage chimique.

Reynald Hélye1, Mélanie Lebreton1, Matthieux Bruneaux2, Franck Zal2, Noelle Potier1, Emmanuelle Leize1

1 LDSM2, Institut de Chimie, UDS/CNRS UMR 7177, 1 rue Blaise Pascal, 67000 Strasbourg, France2 Équipe d'Écophysiologie, UPMC/CNRS 7144, Station Biologique, 29682 Roscoff, France

Contact: Reynald Hélye ([email protected])Keywords: High mass and high resolution mass Spectrometry, Systems biology

Depuis quelques années, la spectrométrie de masse (MS) s’est imposée comme une alternative fiable pour l’étude des complexes non covalents et des méthodologies ont été développées pour démontrer l’existence d’un complexe ou en déterminer la stœchiométrie. Les possibilités de la MS ont régulièrement progressé au fil des années, s’attaquant à des complexes toujours plus lourds ou labiles. Toutefois, la technique se heurte à certaines difficultés. En effet, la grande majorité des études biologiques sont effectuées par ionisation électrospray (ESI-MS). Néanmoins, cette source est très sensible à la présence de sels non volatils ce qui nécessite des étapes de dessalage souvent longues et parfois critiques pour la stabilité du complexe en solution. D’autre part, l’étude de complexes transitoires ou de durée de vie courte ne peut être abordée par cette approche.C’est pourquoi nous nous sommes intéressés à une stratégie permettant de stabiliser le complexe de façon irréversible : le pontage chimique (ou « cross-linking »). Une fois le pontage réalisé entre les différents partenaires, nous pouvons nous affranchir de l’étape de dialyse dans un tampon de sels d’ammonium et préparer l’échantillon avec d’avantage de liberté pour en déterminer la stœchiométrie d’interaction par MALDI-MS. Dans cette optique, deux kits de pontage fournis par la société CovalX (K100 et K200 ; Zurich, Suisse) ont été testés. Les conditions expérimentales de pontage chimique ont été optimisées sur des complexes de stœchiométries connues : le récepteur de l’acide rétinoïque (RAR) et l’alcool déshydrogénase de levure (yADH). L’influence de plusieurs paramètres sur le rendement de pontage mais également sur la spécificité d’interaction a été évaluée : le ratio entre l’agent pontant et le complexe, sa réactivité, la température et le temps de réaction notamment.Cette stratégie a ensuite été appliquée à l’étude de complexes plus lourds, tels que les hémocyanines du crabe Carcinus maenas (~900 kDa). Les résultats obtenus sont encourageants même si des expériences strictes de contrôle doivent être effectuées afin de vérifier que les spectres de masse obtenus reflètent les abondances des espèces présentes en solution.


[P112] Étude par analyse protéomique de biomarqueurs d’exposition à des cancérigènes.

Marianne Ibrahim1, Lauriane Kuhn2, Philippe Hammann2, Zeina Dagher3, Emmanuelle Leize1

1 LDSM2, Institut de Chimie, UDS/CNRS UMR 7177, 1 rue Blaise Pascal, 67000 Strasbourg, France2 Plateforme Protéomique (IBMC), 15 rue R. Descartes, 67000 Strasbourg, France3 Département de Biologie, Faculté des Sciences, Université Libanaise, B.P. 90656 Fanar, Liban

Contact: Emmanuelle Leize ([email protected])Keywords: Organic and inorganic mass spectrometry, Systems biology

Les hydrocarbures aromatiques polycycliques (HAP) sont des polluants ubiquitaires de l’environnement montrant une forte toxicité ; certains d’entre eux sont suspectés d’être cancérigènes pour l’homme. Dans cette étude, nous avons effectué des analyses protéomiques sur un modèle de cellules hépatiques (HepG2) exposées au Benzo(a)pyrène (BaP), un cancérigène pour l’Homme (classé groupe 1 selon le Centre International de la Recherche sur le Cancer). Notre approche in vitro vise à identifier et à quantifier, par spectrométrie de masse, de nouveaux biomarqueurs dans ces cellules exposées au BaP à 1µM. Le test de viabilité cellulaire n’a montré aucun effet cytotoxique du BaP à cette concentration. Les analyses protéomiques utilisant l’électrophorèse bidimensionnelle ont montré des spots d’intérêt qui ont été analysés par nano-LC/MSMS. Nous avons identifié deux protéines pouvant être utilisées comme biomarqueurs potentiels précoces applicables dans la recherche sur le cancer : RuvB-like2 et Translationally Controlled Tumor Protein (TCTP). En perspectives, nous souhaitons valider ces biomarqueurs dans les milieux biologiques des populations exposées au HAP, en environnement général et/ou professionnel.


[P113] Spectrométrie de masse MALDI de polymères synthétiques fonctionnalisés par un nitroxyde

Caroline Barrère1, Christophe Chendo2, Valérie Monnier2, Thomas Trimaille3, Trang N.T. Phan3, Didier Gigmes3, Stéphane Viel1, Stéphane Humbel4, Denis Bertin3, Laurence Charles1

1 Laboratoire Chimie Provence, UMR 6264, Equipe Spectrométries Appliquées à la Chimie Structurale, Campus Scientifique de St Jérôme - Av. Escadrille Normandie Niemen, 13397 Cedex 20 Marseille2 Spectropole, Fédération des Sciences Chimiques-CNRS, FR 1739, Campus Scientifique de St Jérôme - Av. Escadrille Normandie Niemen, 13397 Cedex 20 Marseille3 Laboratoire Chimie Provence, UMR 6264, Equipe Chimie Radicalaire, Organique et Polymères de Spécialité, Campus Scientifique de St Jérôme - Av. Escadrille Normandie Niemen, 13397 Cedex 20 Marseille4 Institut des Sciences Moléculaires de Marseille, UMR 6263, Equipe Chimie Théorique et Mécanismes, Campus Scientifique de St Jérôme - Av. Escadrille Normandie Niemen, 13397 Cedex 20 Marseille

Contact: Caroline Barrère ([email protected])Keywords: Organic and inorganic mass spectrometry

La polymérisation radicalaire assistée par nitroxyde (NMP) permet la préparation de copolymères synthétiques de taille contrôlée. Dans cette étude, la synthèse d’un copolymère à bloc poly(oxyde d’éthylène)/polystyrène (POE-b-PS) est réalisée en faisant croître le bloc PS à partir d’un homopolymère POE fonctionnalisé avec le nitroxyde SG1 (N-(2-méthylpropyl)-N-(1-diéthylphosphono-2,2-diméthyl propyl)-N-oxyl). Le contrôle analytique de la fonctionalisation du POE est donc fondamental et consiste typiquement à déterminer la masse des groupements terminaux à partir d’un spectre de masse. Cependant, la fragilité de la liaison C-ON qui lie le groupement SG1 au squelette polymérique, et sur laquelle repose le processus NMP, devient un problème majeur pour l’analyse MALDI car le nitroxyde est systématiquement éliminé sous forme radicalaire lors du processus d’ionisation. Pour produire des adduits oligomériques intacts en phase gazeuse et ainsi assurer la fiabilité de l’analyse des groupements terminaux, les facteurs influant sur la stabilité de la liaison C-ON ont été étudiés. Une étude ab initio a montré une augmentation de l’énergie de dissociation de cette liaison lorsque le groupement tert-butyl porté par l’azote du nitroxide est substitué par un atome d’hydrogène. Un traitement à l’acide trifluoroacétique a donc été développé pour opérer cette substitution, transformant efficacement le groupement SG1 en un groupement SG1’. Les spectres MALDI-MS obtenus pour les homopolymères POE-SG1’ indiquent que le renforcement de la liaison C-ON prédit par les calculs théoriques est suffisant pour permettre la désorption d’adduits intacts du polymère traité.


[P114] Développements méthodologiques en MS/MS pour la production de matériaux bio-ressourcés

Mohamed Major1, Guillaume Moreira2, Catherine Lefay2, Denis Bertin2, Didier Gigmes2, Laurence Charles1

1 Laboratoire Chimie Provence, UMR 6264, Equipe Spectrométries Appliquées à la Chimie Structurale , Aix-Marseille Université I, II et III – CNRS, Campus de St Jérôme, 13397 Marseille2 Laboratoire Chimie Provence, UMR 6264, Equipe Chimie Radicalaire-Organique et Polymères, Aix-Marseille Université I, II et III – CNRS, Campus de St Jérôme, 13397 Marseille

Contact: Mohamed Major ([email protected])Keywords: Organic and inorganic mass spectrometry

L’engouement actuel pour la production de polymères à partir de ressources renouvelables, telles que la cellulose, vise à la fois à minimiser notre dépendance vis-à-vis des dérivés pétroliers et à répondre à des enjeux environnementaux. Puisque les propriétés médiocres des polymères naturels limitent fortement leurs applications, une stratégie prometteuse consiste à élaborer des matériaux résultant de mélanges cellulose/polymères synthétiques. C’est un moyen simple de diminuer la proportion de dérivés pétroliers dans des matériaux d’usage courant tout en améliorant leur bio-dégradabilité. Afin d’assurer la stabilité de ces mélanges, il est nécessaire d’ajouter des composés amphiphiles, miscibles dans chacun des constituants. Pour ce faire, de nombreux travaux explorent la possibilité de modifier la cellulose mais se heurtent à l’extrême complexité structurale et la faible solubilité de ce polymère naturel. Une alternative intéressante consiste à produire des macromolécules hybrides, constituées de chaînes polysaccharides plus courtes et greffées par des segments synthétiques. Le potentiel stabilisant de ces co-polymères étant intimement lié à leurs caractéristiques structurales (taille du polysaccharide, longueur et nombre de greffons synthétiques, …), la mise au point des stratégies de synthèse doit se faire de concert avec le développement des méthodes analytiques. Dans ce cadre, la spectrométrie de masse s’avère une technique de choix, aussi bien pour caractériser la masse des molécules en mode MS que pour localiser les greffons en mode MS/MS.

Cette étude présente les résultats préliminaires obtenus pour des sucres de faible taille, glucose et cellobiose, fonctionnalisés avec des groupements acrylate. En effet, la synthèse des copolymères greffés polysaccharides/polystyrène est basée sur la polymérisation radicalaire contrôlée assistée par nitroxide, pour permettre la croissance du polystyrène à basse température, une condition cruciale au regard de la stabilité thermique des polymères naturels. Une série de molécules comportant un nombre croissant de groupements acrylate greffés sur une même unité glucose ont été synthétisées puis examinées par spectrométrie de masse. L’optimisation des conditions expérimentales est discutée, notamment le mode de polarité des analyses, et les voies de fragmentation de ces molécules sont étudiées en fonction de leur degré de substitution, dans des conditions de dissociation induite par collision.


[P115] Structuration des dépôts MALDI : une étude multidisciplinaire en phase solide

Yannis Major1, Hélène Pizzala1, Fabio Ziarelli2, Christian Dominici3, Trang Phan4, Laurence Charles1

1 Laboratoire Chimie Provence, UMR 6264, Equipe Spectrométries Appliquées à la Chimie Structurale, Aix-Marseille Université I, II et III – CNRS, Campus de St Jérôme., 13397 Marseille, France2 Fédération des Sciences Chimiques – CNRS, FR1739, Spectropole, Aix-Marseille Université I, II et III – CNRS, Campus de St Jérôme., 13397 Marseille, France3 Fédération des Sciences Chimiques – CNRS, FR1739, Centre Pluridisciplinaire de Microscopie Electronique et de Microanalyse, Aix-Marseille Université I, II et III – CNRS, Campus de St Jérôme., 13397 Marseille, France4 Laboratoire Chimie Provence, UMR 6264, Equipe Chimie Radicalaire, Organique et Polymères de Spécialité, Aix-Marseille Université I, II et III – CNRS, Campus de St Jérôme., 13397 Marseille, France

Contact: Yannis Major ([email protected])Keywords: Organic and inorganic mass spectrometry

La technique MALDI s'est rapidement imposée comme la méthode de choix pour l'ionisation des macromolécules d’origine biologique ou synthétique. Elle se prête particulièrement bien à l’ionisation d’échantillons complexes tels que les polymères synthétiques car elle permet la production d’adduits monochargés à partir de chaque oligomère, donnant lieu à des spectres de masse plus simples que ceux obtenus par electrospray. Toutefois, la mauvaise connaissance des processus fondamentaux qui régissent la désorption et l'ionisation des analytes devient un problème majeur qui limite l’application généralisée de la technique MALDI aux polymères synthétiques. Le point-clé de la réussite d'une analyse MALDI-MS réside dans la préparation des échantillons. La matrice et l’agent de cationisation, ainsi que leur concentration relative, doivent être choisis en fonction de la nature et de la taille du polymère mais cette optimisation reste extrêmement empirique car l’impact de chacun de ces paramètres reste méconnu. De plus, le mode de préparation des échantillons MALDI influence également le rendement de l’ionisation et la nature des ions formés.Cette étude propose d’examiner des échantillons MALDI, tant au point de vue morphologique que microstructural, avec des techniques dédiées à l’analyse des solides afin d’établir des relations entre la structure des dépôts MALDI, leur mode de préparation et l’efficacité du processus d’ionisation. Afin de limiter les facteurs associés au mode de préparation, notamment ceux liés à l’utilisation d’un solvant, les échantillons étudiés sont obtenus par broyage au vortex (méthode "solvent-free"). La composition des échantillons a été choisie pour que chaque technique mise en œuvre puisse apporter des informations complémentaires : ils sont constitués de 2,5-DHB (matrice), de CsCl (agent de cationisation) et de poly(oxyde d’éthylène) (analyte). La morphologie, l'organisation et l'homogénéité de l'échantillon ont été explorées par microscopie électronique à balayage (MEB). La calorimétrie différentielle à balayage (DSC) a été utilisée pour mettre en évidence la mobilité des chaînes de polymère. Enfin, les interactions intermoléculaires et la mobilité des différentes espèces ont été sondées par RMN du solide (13C et 133Cs).


[P116] Analyse comparative du sous-protéome cytoplasmique de la Barrière Hémato-Encéphalique: approche « label free » et approche par marquage isotopique stable.

Barbara Deracinois1, Sophie Duban-Deweer1, Johan Hachani1, Roméo Cecchelli1, Christophe Flahaut1, Yannis Karamanos1

1 Université Lille Nord de France, 1bis rue Georges Lefèvre, 59044 Lille2 Université d’Artois, LBHE, Rue jean Souvraz, 62307 Lens3 IMPRT-IFR 114, CHRU de Lille, 59000 Lille

Contact: Christophe Flahaut ([email protected])Keywords: Systems biology, Proteins, peptides and small molecules quantification

95 % des composés thérapeutiques à visée cérébrale sont inefficaces in vivo du fait de la présence de la Barrière Hémato-Encéphalique (BHE) qu’ils sont incapables de franchir. Bien que relativement connu dans son aspect physiologique, le phénotype BHE des cellules endothéliales des capillaires cérébraux (BCECs) reste mal compris au regard des mécanismes moléculaires qui gouvernent son établissement et son maintien. Dans cette optique, à l’aide de modèles différentiels de BHE in vitro (solo-culture de BCECs bovines ou co-culture avec des cellules gliales de rat), nous avons initié deux études protéomiques comparatives afin d’identifier les protéines cytoplasmiques potentiellement impliquées dans l’établissement et le maintien de ce phénotype. Les protéines, extraites au Triton X-100, sont soumises à un fractionnement organique avant analyses par chromatographie liquide « couplée » à la spectrométrie de masse (1D-LC MALDI-MS/MS). L’approche sans marquage, dite « label free », consiste en une simple analyse comparative des protéines identifiées. La seconde approche de type Isotope Coded Protein Label (ICPL), consiste à quantifier les protéines grâce à un marquage isotopique effectué au préalable. L’efficacité et la reproductibilité du fractionnement protéique utilisé sont démontrées par SDS-PAGE, 2D-PAGE et via l’analyse comparée des données de masse obtenues à partir de 3 séries expérimentales. L’approche « label free » des cellules ayant perdu certaines propriétés de barrière (solo-culture de BCECs) ou non (co-culture) a permis l’identification de 440 et 410 protéines respectivement. Comparativement, 11 protéines semblent plus abondamment retrouvées au sein des BCECs co-cultivées, contre 41 protéines dans les BCECs solo-cultivées. L’approche ICPL est quant à elle complémentaire et indique que 15 protéines sont potentiellement sur-exprimées et 43 protéines sous-exprimées dans les BCECs co-cultivées. Les variations quantitatives de deux protéines d’un intérêt particulier dans le domaine de la BHE (la phosphatase alcaline et l’ADP-ribosylation factor 4) ont été évaluées par PCR et western-blot.


[P117] Virus-Like Particles in Parasitoids' Venom: Viral or Cellular Origin?

Emilie Goguet-Surmenian1, Maya Belghazi2, Marc Ravallec3, Christian Rebuf1, Dominique Colinet1, Marylène Poirié1, Jean-Luc Gatti1

1 ESIM, UMR 1301 INRA-CNRS-Université Nice-Sophia Antipolis, 400 route des chappes, 06903 sophia antipolis2 Centre d'Analyses Protéomiques de Marseille (CAPM) IFR Jean Roche Faculté de Médecine - Secteur Nord Université de la Méditerranée , CS80011 Bd Pierre Dramard , 13344 MARSEILLE Cedex 15 3 UMR 1333 Diversité, INRA-Université Montpellier 2, Place Eugène Bataillon, 34 095 Montpellier Cedex 5

Contact: Jean-Luc Gatti ([email protected])Keywords: Systems biology

During egg oviposition, endoparasitoid wasps inject ovarian and venom compounds that will regulate the host physiology and protect the egg from the host immune response. For instance, Leptopilina boulardi strains, parasitoids of Drosophila, inject venom that contains specific toxic proteins and vesicles devoid of DNA or RNA named Virus-Like Particles (VLPs). Some of these VLPs have been demonstrated to participate in suppressing the host immune defense, likely by convoying proteins that destroy or inactivate the cellular host response. Under electron microscopy, we observed that these purified VLP are heterogeneous in form and size between different L. boulardi strains. We have analyzed by a proteomic approach the composition of the VLPs-containing pellet obtained by centrifugation of the content of venom reservoir of L. boulardi strains ISm and ISy. We demonstrate that the major immunosuppressive factor of L. boulardi Ism, a RacGAP protein named LbGAP, is mainly associated with the VLP pellet. None of the major proteins identified in VLPs matched with known viral proteins, which strongly suggests that these vesicles are cellular and not viral products. Then we suggest the name of «venosomes» for the vesicles observed in the venom of these species to avoid confusion with true viral particles found in other parasitoid species. These venosomes may serve as a transport and targeting system for specific venom components that are necessary for parasitism success in this species.


[P118] Influence des interactions de type pont salin lors de la fragmentation de complexes peptides-ADN en phase gazeuse

Bessem BRAHIM1, Sandra ALVES1, Jean-Claude TABET1

1 Laboratoire de Chimie Structurale Organique et Biologique, 4 place Jussieu, 75252 Cedex 05 Paris, FRANCE

Contact: Bessem BRAHIM ([email protected])Keywords: Systems biology

Tous les mécanismes cellulaires des organismes vivants sont issus d’interactions non-covalentes (NCI) au niveau moléculaire que ce soit, entre une protéine et un double brin d’ADN (régulation de l’expression des gènes), entre une protéine et un simple brin d’ARN (étape de traduction) ou encore entre différentes protéines.

Dans cette étude, l’origine des interactions existantes entre protéine et ADN a été examinée en phase gazeuse par ESI sous mode positif et négatif, afin de préserver les interactions ioniques entre les résidus basiques (R/K) et les groupements phosphates de l’ADN et de les mettre en évidence. Cela permettra de démontrer l’existence de formes zwitterioniques en phase gazeuse, notion encore débattue dans le cadre de l’ADN.

Différentes combinaisons (i) de peptides de longueurs et de basicités variables et (ii) d’oligonucléotides de longueurs et d’affinités protoniques variables, ont été testées. Le transfert en phase gazeuses a été réalisé en mode positif et négatif grâce à une source electrospray combinée à spectromètre de masse LTQ-Orbitrap permettant la mise en œuvre d’expériences de MSn dans le piège linéaire (LTQ) par excitation résonante radiale (CID) et/ou par dissociations induites par transfert d’électron (ETD). Les spectres CID des complexes peptides/ADN (simple et double brins) ont été enregistrés à haute résolution grâce à l’Orbitrap (FT-MS) afin de faciliter l’interprétation.

De précédentes études ont montré que la fragmentation des complexes multi-déprotonés est strictement dépendante des propriétés basiques des résidus et des propriétés acides des nucléotides, suggérant la présence de fortes interactions de types pont salin entre les brins d’ADN et les peptides. Des ions fragments abondants conservant ces types d’NCI, provenant de ruptures de liaisons peptidiques et/ou nucléotidiques via libération de nucléobase, ont été détectés et démontrent la force de ces NCI.

La comparaison du comportement des ions, dans les modes d’ionisation positive et négative, a montré des voies de fragmentation similaires du complexe, cohérentes avec la préservation des NCI présentes en solution. Le peptide semble donc être fixé à une position de l’ADN dictée par sa conformation en solution. De plus, du fait des processus de désolvatation, les interactions électrostatiques renforcées en phase gazeuse permettent de bloquer la position du peptide sur l’ADN, ce qui explique que des liaisons covalentes soient rompues sous activation en MS/MS. Il a aussi été noté que l’excès de charges (positive ou négative) et la présence d’NCI orientent les voies de fragmentations vers des ruptures multiples de liaisons nucléotidiques, fournissant un nombre considérable d’informations conformationnelles.

En conclusion, cette étude montre que l’ESI est une méthode suffisamment douce pour conserver les NCI mais aussi une grande partie des conformations préexistantes en solution.


[P119] Composition membranaire et internalisation des peptides vecteurs : Quantification par spectrométrie de masse MALDI-TOF

Chérine Bechara1, Yefim Zaltsman1, Sandrine Sagan1

1 Laboratoire des BioMolécules, 4 Place Jussieu, 75005 Paris

Contact: Chérine Bechara ([email protected])Keywords: Proteins, peptides and small molecules quantification

Les peptides vecteurs sont des petites séquences d’acides aminés basiques et plus ou moins amphiphiles. Ces peptides sont capables de transporter des molécules biologiquement actives, généralement conjuguées de manière covalente à l’intérieur des cellules selon deux grandes voies d’internalisation, l’endocytose et la translocation directe.

La balance entre ces deux voies (endocytose et translocation directe) dépend de plusieurs paramètres, notamment de la séquence du peptide vecteur, de la nature de la cargaison conjuguée, du type cellulaire, de la nature de la liaison entre le peptide vecteur et la molécule conjuguée, de telle sorte que la localisation finale intracellulaire de la molécule cargaison ne peut être prédite. Sur cette base, il est difficile de rationaliser un adressage spécifique vers une activité biologique intracellulaire ciblée avec cette stratégie covalente. Dans ce contexte, nous nous intéressons aux paramètres qui influent sur les voies d’internalisation et donc la localisation intracellulaire des peptides vecteurs et/ou de leurs conjugués.

Les glycoconjugués en surface cellulaire sont les premières molécules interagissant avec un peptide vecteur. Ces carbohydrates pourront être des effecteurs d’endocytose ou important pour la translocation en concentrant localement le peptide afin qu’il puisse interagir avec les lipides membranaires en vue d’internalisation. Nous sommes donc intéressés par l’étude de l’effet de différents carbohydrates sur les voies d’entrée. L’internalisation est suivie par une quantification directe du peptide intracellulaire par spectrométrie de masse. De plus, l’affinité de ces peptides aux différents polysaccharides a été mesurée. Les résultats obtenus feront l’objet de cette présentation.


[P120] Label free quantification of coat proteins of Bacillus cereus affected by sporulation temperature

Stella Planchon1, Céline Henry2, Benoît Valot2, Isabelle Bornard3, Jean-François Maingonnat1, Frédéric Carlin1, Véronique Broussolle1

1 INRA, UMR 408 S�curité et qualité des produits d'origine végétale, Université d'Avignon et des Pays de Vaucluse, 84000 Avignon2 INRA, Plateforme d'Analyse Protéomique Paris Sud Ouest, UMR 1319 MICALIS, Domaine de Vilvert, 78352 Jouy en Josas3 INRA, Unité de Pathologie Végétale, Plateau de microscopie, , 84143 Montfavet

Contact: Céline Henry ([email protected])Keywords: Proteins, peptides and small molecules quantification, High mass and high resolution mass Spectrometry

Sporulation temperature affects significantly B. cereus KBAB4 spore properties such as germination to alanine and resistance to heat, to pulsed light and to chemical treatments (Planchon 2011). Physiological differences could be due to ultra structural differences between spores produced at two sporulation temperatures. Observations of spore cross-sections in transmission electron microscopy showed a thicker outer coat layer in spores produced at low temperature, suggesting variations in coat protein composition. Coat protein-containing fractions of B. cereus KBAB4 spores produced at 10°C and 30°C were analysed by 1D gel. Bands were excised, digested and subjected to LC-MS/MS analysis using the U3000 nano-HPLC system (Dionex, Amsterdam, Netherlands) and the LTQ-Orbitrap (Thermo Scientific, Bremmen, Germany). Subsequently, 1D-gel coupled with identification and label-free quantitation with LTQ-Orbitrap was carried out using spectral counting an integration of peak area. The originality of this label-free quantitation is that we used X!tandem software for identification of proteins coupled with a module of peptide retention time alignment and integration of peak area adapted by the PAPPSO platform : MassChroQ*.Among the 200 identified proteins, 64 proteins varied with the sporulation temperature, including 13 coat proteins, with CotS and CotSA only recovered in spores produced at low temperature. The CotE and CotG proteins are present in higher quantity in spores produced at 10°C and could be involved in the ultrastructural modifications of the outer coat layers. Moreover, 7 proteins are found in lower quantity in spores produced at 10°C, 4 have unknown role in coats while Cotα, CwlJ and SleL are clearly involved either in spore resistance and germination of B. subtilis and B. anthracis. Further investigations are needed to understand the role of the coat proteins affected by the sporulation temperature in B. cereus resistance.

Planchon S. et al. (2011) Spores of Bacillus cereus strain KBAB4 produced at 10°C and 30°C display variations in their properties. Food Microbiology 28(2):291-297.

*http://pappso.inra.fr/bioinfo/


[P121] Simulations de dynamique directe pour étudier la dissociation induite par collisions des biomolécules

Jean-Yves Salpin1, Yannick Jeanvoine1, Marie-Pierre Gaigeot1, Riccardo Spezia1

1 Laboratoire Analyse et Modélisation pour la Biologie et l'Environnement - LAMBE - UMR 8587 - Université d'Evry Val d'Essonne, Boulevard François Mitterrand, 91025 Evry

Contact: Jean-Yves Salpin ([email protected])Keywords: Instrumentation, Organic and inorganic mass spectrometry

La spectrométrie de masse est devenue un outil d’analyse incontournable. Outre son intérêt sur le plan purement analytique (caractérisation et quantification des composés), cette technique permet également d’aborder l’étude de la réactivité en phase gazeuse d’espèces ionisées allant de quelques atomes à des systèmes complexes (biopolymères, polymères de synthèse, agrégats organiques et inorganiques).

La modélisation moléculaire est un outil indispensable pour l’interprétation au niveau moléculaire de ces processus. Les méthodes de la chimie quantique sont utilisées de façon courante pour les interpréter. Il est cependant indispensable, pour une meilleure interprétation des résultats observés, de considérer aussi l’aspect dynamique. Dans ce but, nous avons utilisé une approche de dynamique « directe » qui traite de façon explicite la collision entre l’ion et le projectile de gaz rare au cours de laquelle une certaine quantité d'énergie est transférée à l’ion, conduisant ainsi à sa fragmentation. Grâce aux études de dynamique directe de la fragmentation, il est possible d’avoir accès à différents détails au niveau microscopique sur les ions soumis au processus CID, tels que la structure des fragments obtenus, la section efficace du CID, les mécanismes de fragmentation ou encore la différence de réactivité des isomères.

Le transfert d’énergie et la fragmentation de différents systèmes (urée protonée, complexe [Ca(urée)]2+ ou encore des peptides modèles protonés) ont été étudiés. Nous avons dans ce but utilisé une approche QM/MM où l’interaction projectile/ion est traité par une potentielle analytique, et l’ion par une méthode quantique, au niveau MP2 pour les petits systèmes et sémiempiriques (AM1 et PM3) pour les grandes systèmes.Les simulations ont mis en évidence que deux mécanismes de fragmentation sont possibles: (i) le mécanisme dit «shattering», par lequel les produits sont obtenus juste après une période vibrationnelle du "stretching" de la liaison qui va se casser, et (ii) un mécanisme de «transfert d’énergie» (qui n’est pas un IVR complet) qui donne les produits après plus d’une période de vibration. Les ions fragments observés expérimentalement et correspondant aux processus de plus haute énergie, sont obtenus grâce au mécanisme de shattering. Ceci est un résultat important car il suggère que les approches cinétiques basées sur la limite statistique de la réaction unimoléculaire (RRKM par exemple) peuvent ne pas être correctes pour décrire la fragmentation unimoléculaire.


[P122] Pipeline applicatif pour l’aide a l’analyse de donnees de spectrometrie de masse en proteomique clinique

Valentin Bouquet1, Pierre Naubourg2, Caroline Truntzer3, Isabelle Vergely1

1 ASA - Advanced Solutions Accelerator, 199 rue de l'Oppidum, 34170 Castelnau le Lez, FRANCE2 LE2I - Laboratoire Electronique, Informatique et Image - UMR CNRS 5158, Allée Alain Savary, 21000 Dijon, France3 CLIPP - Clinical and Innovation Proteomic Platform, CGFL - 1 rue du Professeur Marion BP 77980, 21079 Dijon, France

Contact: Valentin Bouquet ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics, Clinical proteomics

L’objectif de la protéomique clinique est d’identifier de nouveaux biomarqueurs protéomiques qui soient diagnostiques ou pronostiques d’une pathologie donnée. Pour augmenter la pertinence des analyses, les données protéomiques peuvent être analysées conjointement aux variables clinico-biologiques classiques. Ces analyses impliquent un volume de données important nécessitant une automatisation et une traçabilité d’un certain nombre de tâches. Dans cette perspective, la plateforme protéomique CLIPP s’est associée avec le laboratoire en informatique LE2I et la société ASA pour concevoir et mettre en place un pipeline applicatif facilitant la gestion et l’analyse des données de spectrométrie de masse depuis la réception des prélèvements de patients jusqu’à la sélection de marqueurs pertinents.La première partie du pipeline a pour objectif de prendre en charge le flux de données clinico-biologiques en provenance des cliniciens collaborant avec la plateforme et des Centre de Ressources Biologiques (CRB). La gestion de ce processus implique la mise en place d’un système de gestion du cycle de vie des échantillons et d’une base de données suffisamment flexible pour accueillir des données cliniques hétérogènes d’une pathologie à l’autre. Le logiciel eClims, développé par Pierre Naubourg (LE2I), prend en charge ces sources de données complexes et assure le suivi des prélèvements de patients dès leur arrivée sur la plateforme tout en normalisant/formatant les informations clinico-biologiques associées. eClims devient la banque de données référençant l’ensemble des informations cliniques associées aux prélèvements disponibles sur la plateforme.La deuxième partie du pipeline assure le suivi des traitements analytiques subis par les prélèvements pour leur analyse en spectrométrie de masse. Le système ePims™, développé par le laboratoire EDyP, a été mis en place sur la plateforme afin de tracer le passage des échantillons sur les instruments, sauvegarder et organiser les acquisitions générées. Un travail d’interfaçage entre eClims et ePims™ garantit un suivi global des prélèvements. Les échantillons enregistrés dans eClims sont automatiquement injectés dans ePims™, évitant par exemple les erreurs de saisie.Enfin, la troisième partie du pipeline se charge de prétraiter les acquisitions stockées dans ePims™ et de mettre à disposition des statisticiens, une interface leur permettant d’extraire les données clinico-biologiques ainsi que les données protéomiques rattachées à un projet particulier pour pouvoir ensuite les analyser. Le logiciel eP-Stat, développé par Valentin Bouquet (ASA), assure ces deux dernières étapes en mettant en place, d’une part, un processus d’exécution automatique (deamon) des scripts R réalisés sur la plateforme et d’autre part un moteur de recherche puissant capable d’extraire les données stockées à la fois dans eClims et dans ePims™.Link: www.asa-sas.com


[P123] Efficient structural characterization of synthetic polymers by activated electron photo-detachment dissociation

Marion Girod1, Claire Brunet1, Rodolphe Antoine1, Jérôme Lemoine3, Philippe Dugourd1, Laurence Charles2

1 Laboratoire de Spectrométrie Ionique et Moléculaire, CNRS et Université Lyon I, 43 Bd du 11 Novembre 1918, 69622 Villeurbanne cedex, France2 Laboratoire Chimie Provence, Spectrométries Appliquées à la Chimie Structurale, Universités Aix-Marseille I, II & III et CNRS, Campus St-Jérôme, 13397 Marseille Cedex 20, France3 Institut des Sciences Analytiques, NRS et Université Lyon I, 43 Bd du 11 Novembre 1918, 69622 Villeurbanne cedex, France

Contact: Marion Girod ([email protected])Keywords: Organic and inorganic mass spectrometry, Instrumentation

Tandem mass spectrometry of poly(styrene sulfonate sodium salt) (PSS) and poly(methacrylic acid) (PMAA) was performed after activated electron photo-detachment dissociation (activated EPD). In this technique, doubly charged oligomers were first produced in negative mode electrospray ionization, then oxidized into radical anions upon electron photo-detachment using a 220 nm laser wavelength, and further activated by collision. In contrast to CID of negatively charged PSS oligomers, which does not provide informative data with regards to the end-groups, activated-EPD is shown here to promote radical-induced dissociation reactions thanks to the oxidation of a sulfonate group upon laser irradiation. Major product ions generated after backbone bond cleavages contained one or the other chain terminations and could be accounted for by four main mechanisms, depending on the location of the oxidized monomer near one or the other chain terminal moieties. As a result, combination of these two fragments allowed a straightforward mass characterization of each end-group.In case of PMAA ions, fragmentation of odd-electron species is first shown to proceed via a radical-induced decarboxylation, followed by reactions which involved backbone bond cleavages and gave rise to product ions containing one or the other oligomer termination, contrasting with conventional collision induced dissociation of negatively charged PMAA, which mainly consists of multiple dehydration steps. Activated EPD spectra displayed quite intense product ions throughout the whole m/z range, allowing unambiguous and straightforward determination of each end-group mass. Experiments performed using PMAA sodium salts allowed us to account for relative intensities of peaks measured within product ion series obtained from PMAA, which would reveal that ion stability is ensured by hydrogen bonds within pairs of MAA units.


[P124] Le Couplage CE-ICP/MS : un outil de choix pour l’Etude des Interactions Protéine-Métal

Agnès Hagège1, Olivier Averseng1, Claude Vidaud1

1 CEA/DSV/SBTN, Laboratoire d’Etude des Protéines Cibles, Site de Marcoule, 30207 Bagnols-sur-Cèze, France2 UMR 6191 CNRS/ Université Aix-Marseille/CEA, Cadarache, 13108 Saint Paul lez Durance, France

Contact: Agnès Hagège ([email protected])Keywords: Organic and inorganic mass spectrometry, Separative analysis methods, Instrumentation

Après internalisation, les métaux non biologiques comme l’uranium peuvent se fixer sur différents composants cellulaires, notamment les protéines et altérer leur fonction.Hormis quelques études récentes[1,2], on connaît cependant encore peu de choses sur les interactions protéine/uranium qui s’établissent et les conséquences de ces interactions sur la toxicité, la majorité des études étant focalisée sur l’albumine et la transferrine.[3-6] La compréhension de ces mécanismes d’interaction est cependant indispensable à l’analyse des risques et au développement d’agents complexants spécifiques afin d’élaborer des stratégies de prévention et de traitement.Dans ce contexte, nous avons mis au point un système de crible, basé sur le couplage entre l’électrophorèse capillaire (CE) et la spectrométrie de masse à ionisation par plasma (ICP/MS). Son intérêt réside dans la possibilité d’étudier les interactions protéine/métal à partir de mélanges complexes et ceci pour plusieurs raisons.D’une part, les complexes résultant sont en effet le fruit de nombreuses réactions de compétition, compte tenu de la présence au sein des divers compartiments biologiques de protéines, de lipides, de petits ligands (carbonate, citrate, ..) mais aussi de métaux physio-essentiels. D’autre part, certaines interactions ne peuvent être simplement décrites par des modèles ne mettant en jeu que deux partenaires.

Dans ce cadre, nous montrerons sur différents mélanges simples de protéines que l’utilisation du couplage CE-ICP/MS se révèle être un outil de choix, permettant une séparation de ces protéines dans des conditions peu dénaturantes alliée à une détection sensible sans ambiguïté de l’uranium mais aussi des métaux endogènes. Grâce à l’optimisation de collisions de haute énergie dans le spectromètre, nous montrerons également la faisabilité d’une détection du soufre par un spectromètre quadripolaire, bénéficiant ainsi d’une détection d’une grande partie des protéines.

1.Dedieu et al., J. Chromatogr. A, 2009, 1216, 5365.2.Vidaud et al., J. Chromatogr. A. 2008, 1185, 233.3.Chevari et al., Med. Radiol.1969, 14, 29.4.Duff Jr et al., Angew. Chem. 2006, 118, 143.5.Ansoborlo et al., Biochimie 2006, 88, 1605.6.Averseng et al., Anal. Chem. 2010, 82, 9797.


[P125] Etude du phosphoprotéome de Pseudomonas aeruginosa

Tassadit Ouidir1, Laurent Coquet1, Adèle Bourmaud2, Philippe Chan2, Pascal Cosette1, Thierry Jouenne1, Julie Hardouin1

1 Laboratoire PBS - UMR CNRS 6270, Université de Rouen, 76821 Mont-Saint-Aignan cedex2 UMR 6270 CNRS - Plate-forme Protéomique de l’IFRMP23, Université de Rouen, 76821 Mont-Saint-Aignan cedex

Contact: Julie Hardouin ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Pseudomonas aeruginosa est un pathogène opportuniste qui émerge ces dernières années comme responsable d’infections nosocomiales sévères chez des sujets immunodéprimés. Cette bactérie pose de réelles difficultés thérapeutiques en raison de sa capacité à former des biofilms. Récemment, il a été montré au sein de l’UMR 6270 CNRS qu’une délétion du gène pA3731 induit une diminution de sa capacité d’adhésion. De nombreux phosphorelais étant impliqués dans les mécanismes d’adhésion, nous nous sommes intéressés à l’impact de la mutation de ce gène sur le changement du profil phosphoprotéique de P. aeruginosa. Les phosphoprotéines sont fortement minoritaires dans le protéome total et leur enrichissement est donc nécessaire. Dans cette étude, nous avons utilisé différentes colonnes d’affinité afin d’enrichir les échantillons en phosphoprotéines ou en phosphopeptides. Les protéines retenues sur ces colonnes ont été visualisées par gel 2D. Après digestion trypsique, les identifications ont été réalisées par spectrométrie de masse. Des phosphoprotéines déjà décrites comme phosphorylées dans la littérature ont été identifiées. Un nouveau site de phosphorylation a également été caractérisé.


[P126] Heparin-like disaccharides: effects of metallic complexation upon fragmentation as characterized by MS/MS and UVPD experiments

Daniel Ortiz1, Quentin Enjalbert2, Jean-Yves Salpin1, Philippe Dugourd2

1 Laboratoire Analyse et Modélisation pour la Biologie et l'Environnement - LAMBE - UMR 8587 - Université d'Evry Val d'Essonne, Boulevard François Mitterrand, 91025 Evry2 Laboratoire de Spectrométrie Ionique et Moléculaire - LASIM - UMR 5579 - Université Claude Bern�rd Lyon 1, Bâtiment A. Kastler - Boulevard du 11 novembre 1918, 69622 Villeurbanne

Contact: Jean-Yves Salpin ([email protected])Keywords: Organic and inorganic mass spectrometry, Instrumentation

Heparin (HP) glycosaminoglycan (GAGs), an anticoagulant drug, is recognized to be a biologically important polysaccharide and is implicated in many biological processes [1]. Given the relevance of GAGs, many efforts were devoted in the last years to the characterization of Heparins by mass spectrometry [2]. In previous works, Dugourd’s group reported the optical spectra and photodissociation patterns of gas-phase deprotonated anions of HP derivatized disaccharides [3-5]. On the other hand, the LAMBE group has already demonstrated that the gas-phase reactivity of metal ions can be particularly helpful in differentiating isomeric saccharides [6-8]. The present work reports the comparison between CID/UVPD modes of three heparin-derived disaccharides complexes. Analytically it is demonstrated the successfully use of metal complexation in order to distinguish all the isomers. Without metal complexation the CID spectra for II-S and III-S are basically the same, but when [M(Hep)-H]- is formed it is observed a significant change in the fragmentation pathway. It is also shown that UVPD leads to different and more informative fragmentation than the CID mode. It is also revealed that there is an unambiguous blue shift effect in the carboxylic group absorption due to the metal complexation. DFT calculations were carried out to in order to account for the observed UV spectra, and to propose different fragmentations pathways for all the mono-sulfated heparins.

References1. J.I. Capila, R.J. linhardt. Angew. Chem. Int. Ed. 41, 391 (2002)2. E.F. Naggar, C. E. Costello, J. Zaia. J. Am. Soc. Mass Spectrom. 15, 1534 (2004)3. A. Racaud, R. Antoine, L. Joly, N. Mesplet, P. Dugourd, J. Lemoine. J. Am. Soc. Mass Spectrom. 20, 1645 (2009).4. A. Racaud, A. R. Allouche, R. Antoine, J. Lemoine and P. Dugourd. J. Mol. Struct. 960, 51 (2010). 5. A. Racaud, R. Antoine, P. Dugourd and J. Lemoine. J. Am. Soc. Mass Spectrom. 21, 2077 (2010). 6. J-Y. Salpin, L. Boutreau, V. Haldys, J. Tortajada. Eur. J. Mass Spectrom. 7, 321 (2001)7. J-Y. Salpin, J. Tortajada. J. Mass Spectrom. 37, 379 (2002).8. A. El Fidoussi, M.Lafitte, J. Tortajada, O. Kone, J-Y. Salpin. J. Mass Spectrom. 42, 999 (2007)


[P127] Measurement of vitellogenin protein in invertebrates: relevance and usefulness of mass spectrometry (LC-MS/MS) to propose a specific and transferable method across species

Romain Simon1, Fabien Audouard-Combe2, Guillaume Jubeaux2, Renaud Tutundjian2, Hervé Quéau2, Jeanne Garric2, Olivier Geffard2, Jérôme Lemoine1, Arnaud Chaumot2, Arnaud Salvador1

1 Institut des Sciences Analytiques, Université de Lyon, 43 Bd du 11 novembre 1918, 69622 Villeurbanne2 Unité de Recherche MALY, Cemagref Lyon, 3 B Quai Chauveau, 69009 Lyon

Contact: Romain Simon ([email protected])Keywords: Proteins, peptides and small molecules quantification

Reproductive success of organisms is related to the quantity and quality of eggs produced by females. Vitellogenin (Vg) is the precursor protein of vitellin that is the energy available for embryonic development in oviparous organisms. Vg is proposed as a relevant biomarker of endocrine disruptors in aquatic vertebrate species (e.g. fish, amphibian). Numerous strategies, such as enzyme-linked immunosorbent assays have been developed to characterize and quantify this protein in vertebrates. On the contrary, in invertebrates few methods are available in spite of their importance. This gap mainly comes from the low transferability of available antibodies across species. Recently, our laboratory developed a quantitative assay of Vg in a widespread amphipod, Gammarus fossarum, using liquid chromatography tandem mass spectrometry (LC-MS/MS) in selected reaction monitoring mode (SRM). In this context, the aim of this study was to assess the possibility to take advantage of peptidic motifs conservation to propose a transferable method across species. For this, our study focused on three model species for which sequence of egg yolk protein is well known: an amphipod (Gammarus fossarum), a cladocerean (Daphnia magna) and an insect (Drosophila melanogaster). In a first step, proteotypic peptides of Vg were identified for each species. Then we tried to find these proteotypic peptides in closely related species for which Vg sequence is unknown (such as G. pulex, G. wautierii, D. pulex). This study showed the high relevance of mass spectrometry to propose a specific methodology for Vg absolute quantification in organisms for which proteins sequences are unknown. Moreover, the proposed methodology is transferable from a species to another one.


[P128] 2D ECD/IRMPD FT-ICR MS Analysis of Glycopeptides

Maria A. van Agthoven1, Marie-Aude Coutouly3, Marc-André Delsuc2, Christian Rolando1

1 USR 3290 MSAP, Université Lille 1, Sciences et Technologies, bât C4, Cité Scientifique, 59655 Villeneuve d'Ascq cedex2 Institut de Génétique et de Biologie Moléculaire et Cellulaire, INSERM, U596; CNRS, UMR7104; Un�versité de Strasbourg, 1 rue Laurent Fries, 67404 Illkirch-Graffenstaden3 NMRTEC, Bld. Sébastien Brandt, Bioparc - Bat. B, 67400 Illkirch-Graffenstaden

Contact: Maria A. van Agthoven ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

Glycosylation is a common post-translational modification in proteins. In 2001, Håkansson et al. showed that Electron Capture Dissociation (ECD) and Infrared MultiPhoton Dissociation (IRMPD) are fragmentation techniques that yield complementary information on the structure of tryptic digest glycopeptides: IRMPD preferentially cleaves the glycosidic bond, while ECD cleaves the peptide backbone while leaving the glycosidic bond intact [1]. Since both IRMPD and ECD are commonly available on commercial FT-ICR mass spectrometers, determining the amino acid sequence of the glycopeptide, the position of the glycosylation site and the nature of the glycan by recording MS/MS spectra of glycopeptides is easy.We have successfully implemented 2D FT-ICR MS pulse sequences using both ECD and IRMPD on a commercial Bruker Daltonics 9.4 T ApexQE FT-ICR mass spectrometer [2]. This technique allows us to correlate the parent and fragment ions of a complex sample without isolating the various ion species before fragmenting them. We have also successfully reduced the signal-to-noise ratio by applying the Cadzow algorithm to 2D mass spectra [3] and we are now able to record and process spectra with high horizontal resolution and quadrupole-like vertical resolution. This enables us to use the fragmentation patterns of peptides to determine their amino acid sequence. By combining ECD and IRMPD we can also locate and identify possible glycosylation sites in peptide mixtures like tryptic digests.In this study, we used custom-made synthetic O-glycosylated peptides (SVES(β-O-GlcNAc)GSADAK-NH2, SVET(β-O-GlcNAc)GSADAK-NH2, YSPTS(β-O-GlcNAc)PSK-NH2) in order to optimize the determination of amino acid sequences and the location of glycosylation sites with ECD. In order to identify glycans using IRMPD, we used glycopeptides with more complex sugars, like vancomycin and bleomycin. We show the 2D ECD and IRMPD mass spectra of these compounds in mixtures, the sequence coverage we obtain from them and the identification of the nature of the glycosylation. We show that, in 2D FT-ICR MS, ECD and IRMPD are complementary tools not just for one, but for a mixture of glycopeptides and peptides for the complete identification of proteins and their glycosylations. The combination of the two fragmentation modes therefore has the potential to greatly facilitate the identification of post-translational modifications in proteomics.[1] Håkansson et al. Anal. Chem. (2001) 73, 4530-4536.[2] M.A. van Agthoven et al. Int. J. Mass Spectrom. (2010) http://dx.doi.org/10.1016/j.ijms.2010.10.034. [3] M.A. van Agthoven et al. Rapid Commun. in Mass Spectrom. (2011) 25, 1609-1616.


[P129] Etude de la glycosylation d’anticorps produits en milieu sans sérum

Jonlet Pierre1, Nicolas Smargiasso1, Sophie Waxweiler2, Alfred Collard2, Edwin De Pauw1

1 Laboratoire de Spectrométrie de Masse (LSM), Université de Liège, 3 Allée de la Chimie, 4000 Liège, Belgique2 CER Groupe- Dept Biotechnologie, Plateforme culture cellulaire,, 1 Rue du Carmel, 6900 Marloie, Belgique

Contact: Jonlet Pierre ([email protected])Keywords: Clinical proteomics, Signaling, interactomics and post-translational modifications

Les chaines glycosylées jouent un rôle important dans l’activité biologique des anticorps (Ac) produits de manière recombinante et leur profil oligosaccharidique est dépendant des conditions de culture. Afin d’optimaliser la production de longue durée d’anticorps monoclonaux dans des cellules cultivées en milieu sans sérum et d’obtenir des produits conformes, il est important de caractériser la glycosylation de ces protéines par rapport aux protéines natives, et cela en fonction du milieu utilisé et de la durée des cultures. Le suivi de ce paramètre permet d’assurer une production maximale tout en conservant les caractéristiques de la protéine produite, un mauvais profil de glycosylation pouvant engendrer une absence de reconnaissance de l’antigène. Dans ce contexte, quatre milieux chimiquement définis ont été choisis pour tester la production de ces protéines. La part de sérum dans le milieu de culture a été diminuée progressivement afin de permettre l’adaptation des cellules à un milieu sans sérum. Notre étude porte sur l’analyse de changements potentiels dans le profil de glycosylation intervenant au cours de ce processus d’adaptation.La première approche a consisté à étudier les protéines entières (ici les chaines lourdes des Ac) par ESI-Q-TOF afin d’obtenir rapidement les profils de glycosylation présents. Par la suite, nous nous sommes focalisés sur certains milieux afin de déterminer plus précisément les structures des glycanes présents. Dans ce cas, les glycanes ont été extraits, perméthylés puis analysés par MALDI-TOF. Des expériences de MS/MS ont de plus permis de mettre en évidence certaines structures présentes. Enfin, la localisation de la partie glycosylée au sein de la protéine a été réalisée à l’aide de la spectrométrie de masse en tandem CID-ETD. En combinant les premiers résultats obtenus, il apparait que la glycosylation des protéines produites grâce aux milieux sans sérum est globalement proche de celle obtenue pour les protéines produite de manière traditionnelle. Les espèces principales sont en effet identiques. De plus, la fucosylation est stable dans les différents échantillons analysés (80 à 90% des glycanes contiennent un fucose). Néanmoins, certaines différences peuvent apparaître concernant la présence et/ou la nature des acides sialiques rétrouvés. En ce qui concerne la localisation des parties glycosylées, les résultats obtenus montrent qu’il n’y a qu’un seul site portant les glycanes et que celui-ci reste identique dans les différentes conditions testées.


[P130] Dérivation chimique de phosphopeptides basiques comprenant une cystéine pour améliorer leur détection par spectrométrie de masse

Lucrèce Matheron1, Oumar Diebate1, Philippe Karoyan1, Emmanuelle Sachon1, Dominique Guianvarc'h1, Gérard Bolbach1

1 Laboratoire des Biomolécules, UMR 7203 CNRS-UPMC-ENS, 4 place Jussieu, 75005 Paris, France2 Plateforme de spectrométrie de masse et protéomique, IFR83, 7-9 quai saint Bernard, 75005 Paris, France3 Laboratoire des Biomolécules, UMR 7203 CNRS-UPMC-ENS, Ecole normale supérieure, département de chimie, 24 rue Lhomond, 75005 Paris, France

Contact: Lucrèce Matheron ([email protected])Keywords: Signaling, interactomics and post-translational modifications

La détection des phosphopeptides par spectrométrie de masse (MS) reste difficile à cause i) du faible rendement d’ionisation de ces espèces, ii) des phosphorylations in vivo non totales, et iii) des effets de suppression dans les mélanges.L’une des méthodes employées pour pallier ces difficultés est la purification sélective des espèces phosphorylées. Cependant, les méthodes majeures de chromatographie d’affinité sont peu efficaces pour les phosphopeptides avec de multiples résidus basiques. Nous avons pu le vérifier sur des substrats de Protéine Kinase C, dont la séquence de base est CFRTPSFLKK, phosphorylés sur la Ser et contenant 3 résidus basiques. Ces phosphopeptides ont une très faible affinité pour les matériaux classiques d’enrichissement. Nous avons donc développé une méthodologie de dérivation chimique pour en améliorer l’analyse par MALDI-TOF, en particulier en mélange avec les peptides non phosphorylés correspondants.La dérivation chimique , en conditions basiques, se réalise en deux étapes : (i) β-élimination du phosphate et (ii) addition de Michael sur la double liaison ainsi formée pour ajouter une fonction chimique favorable à l’ionisation. Lors de la β-élimination, nous observons une forte perte de SH2 sur la cystéine. L’élimination du phosphate et les réactions secondaires n’étant pas totales, on obtient de nombreux produits, ce qui complique les spectres MALDI-TOF et surtout diminue l’intensité des signaux observables. Jouer sur la cinétique et la température permettent de diminuer ces réactions secondaires, mais au détriment de l’élimination du phosphate. Nous cherchons à modifier la base utilisée pour obtenir une élimination totale sur la pSer et sur la Cys, ce qui conduirait à un produit unique et à une double addition de Michael.Divers nucléophiles ont été testés comme agents de dérivation sur des mélanges équimolaires peptide phosphorylé et non phosphorylé, en particulier le mercaptoéthylpyridine (MEP), la thiocholine et le 2-phényléthanethiol.Alors qu’avant dérivation, les phosphopeptides s’ionisent 3 à 5 fois moins bien en MALDI-TOF, la dérivation par le MEP permet d’obtenir des intensités équivalentes. La thiocholine donne lieu à des fragmentations en MALDI-TOF, qui diluent le signal obtenu. Enfin, la dérivation par le 2-phényléthanethiol permet d’obtenir des intensités pour le peptide dérivé pouvant être très supérieures à celle du peptide non phosphorylé. Finalement, la limite de détection de la méthode sera présentée, sous deux aspects : (1) Pour un mélange équimolaire, quelle est la limite en quantité totale de peptide ? (2) À quantité de peptide totale fixe, quel est l’excès maximal de peptide non phosphorylé permettant de continuer à observer le peptide dérivé ?


[P131] The mechanisms of fat loss during cooking of ‘foie gras’: Proteomic analysis of duck fatty liver

Laetitia Théron1, Carole Pichereaux2, Caroline Molette1, Nathalie Marty-Gasset1, Christophe Chambon4, Michel Rossignol2, Didier Viala4, Xavier Fernandez1

1 INRA, INPT-ENSAT, INPT-ENVT, UMR 1289 TANDEM, Avenue de l'Agrobiopole, 31326 Castanet-Tolosan2 IPBS-FR3450, Plateforme Protéomique du Génopole Toulouse Midi-Pyrénées, 205 route de Narbonne, 31077 Toulouse3 Université Paul Sabatier, Université de Toulouse, route de Narbonne, 31077 Toulouse4 Plateforme d’exploration du Métabolisme : Composante Protéomique, INRA, UR370, INRA de theix, 63122 Saint Genès-Champanelle

Contact: Laetitia Théron ([email protected])Keywords: Systems biology

Fat loss during cooking of duck «foie gras» is the main quality issue in the industry. To better understand the biological mechanisms involved in this phenomenon, a proteomic analysis was conducted on raw livers. The aim was to characterize changes in protein expression early post mortem (pm) and after chilling, according to fat loss during later cooking.The proteomic analysis of duck ‘foie gras’ was performed on two protein fractions. The soluble fraction at low ionic strength (SF) was analyzed by two-dimensional electrophoresis and the spots of interest were identified by mass spectrometry – both MALDI-TOF and LC-MS/MS. The non soluble fraction at low ionic strength (NSF) was analyzed by a shot-gun approach combining a separation by SDS-PAGE and identification by a tandem liquid chromatography-mass spectrometry system (nano-HPLC coupled to an Orbitrap-XL). Quantitative analysis of the results indicated that the fatty livers which showed a low fat loss during cooking exhibited a higher metabolic activity early pm (i.e. in the SF, the glycolytic enzymes G3PDH, alpha enolase and triose phosphate isomerase spots intensities were higher). In the "NSF" fraction, 70 proteins were only present in the sample with a low-fat loss and, according to the Gene Ontology database, the proteins implicated in the translation activity were the most abundant.The fatty livers which showed a high fat loss during cooking exhibited a higher expression of proteins involved in some protective mechanisms of cells. The two main proteins involved were HSP 27 and Calponin-1, a calcium binding protein which expression is linked to the activation of «activate stellate cells» and chronic liver injury (Feng et al., 2005). After the chilling, the fatty livers showed an increasing expression of proteins from the cytoskeleton. This is most likely due to the appearance of proteins fragments rather to protein synthesis which is unlikely in the post mortem tissue. We draw the hypothesis that the structure of the tissue would be thus more fragile and prone to fat loss during cooking.The proteomic analysis allowed us to hypothesize the scheme of evolution of fatty liver from slaughter to chilling, in relation with the fat loss during cooking. Further studies should investigate the proteolysis in relation to fat loss during cooking.


[P132] GC, GC-MS and GC-GC-MS analysis of essential oils isolated from Nigella sativa seeds by accelerated techniques assisted by microwaves using the cryogenic grinding

Farid Benkaci-Ali1, Edwin De Pau2, Rym Akloul1, Asma Boukenouche1

1 Université des Sciences et Technologies Houari Boumediene, Faculté de Chimie, Laboratoire d’Analyse Organique Fonctionnelle, , B.P. 32 El Alia, Bab Ezzouar, Algérie, 16001 Alger2 University of Liège, Laboratoire de Spectrométrie de Masse L.S.M, , Allée du 6 Août, Bât B6c, 4000 Liège (Sart-Tilman), Belgium, Liège

Contact: Farid Benkaci-Ali ([email protected])Keywords: Systems biology

Application of green technologies as cryogrinding and microwaves in extraction methods is considered highly promising since these techniques could improve safety and quality of natural product. The increasing interest of nutritional and pharmacological power of Nigella sativa seeds by products, particularly at industrial level, had motivated us to investigate the chemical content of Nigella sativa essential oil.Extraction of essential oil from Nigella sativa seed treated by cryogrinding (CG) has been conducted by three different procedures: conventional hydrodstillation (HD), steam distillation assisted by microwaves (SDAM) and steam distillation assisted by microwaves with cryogrinding (SDAM-CG). The SDAM and SDAM-CG essential oils were found to exhibit high level in active product as thymoquinone THQ (57%, 43.05% respectively) compared to HD technique (22,4%). The conversion rate (CR) of THQ to thymohydroquinone under heat effect is also very lower for SDAM and SDAM-CG (0.89%) and SDAM-CG (0.96%) compared to the HD procedure (55%).In addition the SDAM-CG technique has provided high yield content (1.3 %) compared to SDAM (0.9%) and HD-CG (0.34%).The composition of the volatile oil has been investigated by capillary gas chromatography (GC) and gas chromatography-mass spectrometry GC-MS. The cryogrinding coupled to microwaves and steam distillation process (SDAM and SDAM-CG) constitute the adequate technique to extraction operations from the yields and the high content in major component, and allows minimizing the energy consumption (95 % compared to HD), the heating time (10 mn), the formation of artefact products (thymohydroquinone and dithymoquinone). So, it’s profitable to treat some plants and seeds using this process for preserve their thermolabile components.


[P133] The use of immobilized trypsin bioreactors with MALDI TOF/TOF for protein digestion and identification studies

Raul NICOLI1, Sylvie MICHELLAND2, Morgane COUVET2, Serge RUDAZ1, Jean-Luc VEUTHEY1, Michel SEVE2

1 School of Pharmaceutical Sciences, University of Geneva, University of Lausanne, bvd d’Yvoy 20, 1211 Geneva, Switzerland2 Plate-forme Protéomique Prométhée, CR INSERM/UJF U823, Institut Albert Bonniot, IBP CHU Grenoble BP217, 38043 Grenoble, France

Contact: Michel SEVE ([email protected])Keywords: Systems biology

Trypsin is the most widely used proteolytic enzyme for protein digestion, which is classically performed in-solution with incubation protocols of several hours. In the development of rapid and automated analytical techniques, an attractive alternative is the use of solid-phase protein digestion through the immobilization of trypsin on monolithic materials (e.g. methacrylate-based disks). With this strategy, flow-through protein digestion can be achieved on-line with the peptides separation and detection by inserting an immobilized trypsin bioreactor in a LC-ESI-MS/MS system. In this work, an analytical approach was developed involving flow-through protein digestion in an immobilized trypsin bioreactor and off-line MALDI-TOF/TOF peptides analysis. Optimization of this process in terms of digestion flow rate, amount of digested protein(s) and use of a trapping column was carried out with beta-lactoglobulin containing samples. This strategy was then applied to the digestion of a more complex sample of five proteins with the integration in the analytical set-up of reversed-phase nano-LC peptides separation and automated MALDI spotting device. The results obtained throughout the study were compared with those of classical in-solution incubation method.


[P134] Développement d’une méthode d’analyse des Retardateurs de Flammes Bromés, plus particulièrement de l’Hexabromocyclododécane (HBCD) par chromatographie liquide couplée à la spectrométrie de masse en tandem (LC-ESI-MS-MS)

Zita Zendong1, Cyrille Vallée1, Frederic Larvor1, Sophie Durand1, Philippe Marchand1, Jean-Philippe Antignac1, Bruno Le Bizec1

1 Laboratoire d'etudes des residus et contaminants, Route de gachet BP 50707, 44307 Nantes2 INRA NANTES, ,

Contact: Zita Zendong ([email protected])Keywords: Systems biology

Les Retardateurs de Flammes Bromés (RFB) ont été largement utilisés dans divers produits commerciaux dans le but de réduire l’importance des incendies. Le 1,2,5,6,9,10-Hexabromocyclododécane (HBCD) est le troisième retardateur de flamme bromé le plus utilisé dans le monde (16700 tonnes en 2001) et le deuxième plus utilisé en Europe. L’HBCD est obtenu par bromation du cyclododéca-1,5,9-triène et se compose principalement de trois paires de diastéréoisomères : alpha, beta et gamma-HBCD, le gamma-HBCD étant majoritaire. Ces différents diastéréoisomères ont des propriétés différentes à l’instar de leur solubilité dans l’eau qui est respectivement de 48,8, 14,7 et 2,1 µg/L pour les alpha, beta et gamma-HBCD.Comme tous les autres retardateurs de flammes bromés, l’Hexabromocyclododécane (HBCD) peut être relâché dans l’environnement via les émissions durant sa production ou par des fuites suite à l’utilisation des produits traités avec ce dernier. Faiblement biodégradable et avec un coefficient de partage octanol/eau (Kow) élevé, l’HBCD a un potentiel élevé de bioaccumulation dans les tissus adipeux d’organismes vivants. Par ailleurs sa toxicité et sa persistance dans l’environnement pouvant conduire à des dommages irréversibles, ce composé suscite des inquiétudes en tant que potentiel contaminant. D’où la nécessité de mettre au point des méthodes d’analyses dans le but de le quantifier de manière précise.La plupart des données environnementales publiées dernièrement ont été obtenues en utilisant la spectrométrie de masse couplée à la chromatographie gazeuse. Cependant les isomères de l’HBCD n’étant pas séparables sur les colonnes conventionnelles de chromatographie gazeuse, seule la somme de tous les isomères de l’HBCD était quantifiée. Une nouvelle méthode utilisant la chromatographie liquide couplée à la spectrométrie de masse en tandem (LC-ESI-MS-MS) a donc été développée pour quantifier séparément les isomères alpha, beta et gamma de l’HBCD. Cette méthode applicable à des matrices variées consiste en une extraction liquide sous pression (ASE) suivie de purifications sur phases solides à l’issue desquelles l’extrait obtenu est repris dans le méthanol, solvant permettant une plus grande stabilité des isomères d’HBCD. L’élution de ces composés s’effectue ensuite sur une colonne Hypersil Gold (1,9µm ; 100 mm ; 2,1 mm) avec comme solvants un mélange méthanol/Eau (50:50, v:v) et de l’acétate d’ammonium 20mM. L’identification de chaque isomère se fait sur la base de deux ions du massif isotopique caractéristiques de l’ion pseudomoléculaire. Cette méthode permet la séparation des trois diastéréoisomères en 8 minutes.


[P135] Peptidomic analysis of skin secretions from the bullfrog Lithobates catesbeianus (Ranidae) identifies multiple peptides with potent insulin-releasing activity.

Milena Mechkarska1, Opeolu O. Ojo2, Mohammed A. Meetani3, Laurent Coquet4, Thierry Jouenne4, Yasser H.A. Abdel-Wahab2, Peter R. Flatt2, Jay D. King5, J. Michael Conlon1

1 Department of Biochemistry, Faculty of Medicine and Health Sciences, United Arab Emirates University, 17666 Al-Ain, United Arab Emirates 2 School of Biomedical Sciences, University of Ulster, Cromore Road, BT2 ISA Coleraine, North Ireland, UK3 Departement of Chemistry, Faculty of Science, United Arab Emirates University, 14551 Al-Ain, United Arab Emirates4 CNRS UMR6270, European Institute for Peptide research, University of Rouen, 76821 Mont-Saint-Aignan, France5 Rare Species Conservatory Foundation, , MO 63110 Saint Louis, USA

Contact: Laurent Coquet ([email protected])Keywords: Clinical proteomics

Using a combination of reversed-phase HPLC and electrospray mass spectrometry, peptidomic analysis of norepinephrine-stimulated skin secretions of the American bullfrog Lithobates catesbeianus (Shaw, 1802) led to the identification and characterization of five newly described peptides (ranatuerin-1CBb, ranatuerin-2CBc, and -CBd, palustrin-2CBa, and temporin-CBf) together with seven peptides previously isolated on the basis of their antimicrobial activity ranatuerin-1CBa, ranatuerin-2CBa, brevinin-1CBa, and -1CBb, temporin-CBa, -CBb, and -CBd). The abilities of the most abundant of the purified peptides to stimulate the release of insulin from the rat BRIN-BD11 clonal Beta-cell line were evaluated. Ranatuerin-2CBd (GFLDIIKNLGKTFAGHMLDKIRCTIGTCPPSP) was the most potent peptide producing a significant stimulation of insulin release (119% of basal rate) from BRIN-BD11 cells at a concentration of 30 nM, with a maximum response (236% of basal rate) at a concentration of 3µM. Ranatuerin-2CBd did not stimulate release of the cytosolic enzyme, lactate dehydrogenase at concentrations up to 3 µM, indicating that the integrity of the plasma membrane had been preserved. Brevinin-1CBb(FLPFIARLAAKVFPSIICSVTKKC) produced the maximum stimulation of insulin release (285% of basal rate) but the peptide was cytotoxic at this concentration.


[P136] Mass Spectrometry Imaging visualization tools developed during the Computis European project

Marie-France Robbe1, Etienne Thévenot1, Markus Stoeckli2, Alfons Hester3, Andreas Roempp3, Andriy Kharchenko4, Olivier Gal1, Serge Haan1

1 CEA Saclay, LIST, Laboratoire d'Outils d'Analyses de Données, Bâtiment 516, F-91191 Gif sur Yvette cedex, France2 Novartis, Lichstrasse 35, WSJ-507.1101, CH-4002 Basel, Switzerland3 Justus Liebig University, Schubertstrasse 60, Building 16, D-35392 Giessen, Germany4 FOM/AMOLF, Kruislaan 407, NL-1098 SJ Amsterdam, The Netherlands

Contact: Marie-France Robbe ([email protected])Keywords: Imaging mass spectrometry

The Computis European project (2006-2009) was aimed at developing innovative experimental mass spectrometry imaging (MSI) techniques and software tools for data treatment and visualization, and at validating them in key biological applications (neurobiology, pharmaceutical drug development). The project succeeded in defining a specific standard format for MSI, imzML, in collaboration with the HUPO consortium. The four main MSI software tools developed by the project all handle the imzML format.

Data Cube Explorer provides an easy spectral and spatial exploration of MS images: spectrum zooming, scrolling through the dataset masses with a manual contrast tuning for images, selection of Regions Of Interest with the display of the associated spectra. The self-organizing map functionality classifies images according to the intensity of all pixel places and automatically selects images as different as possible.

Mirion is a simple visualization module displaying spectra by pixel and for the total image, with zooming and scrolling functions. Histogram of the total ion count of each pixel can be calculated, using different input parameters. Images are displayed for each peak of the total spectrum, with a manual intensity tuning and a comparison of the intensity distributions by pixel between several images.

EasyMSI enables spatial and spectral visualization of mass spectrometry imaging datasets (spectrum and image display, peak and pixel picking, zooming on spectra and images, ROI selection), as well as an assistance for the interpretation of data: This assistance includes indicators (relative variance, Moran index, m/z correlation) to highlight peaks that bring interesting information, peak list for molecule identification, spectrum denoising or structure analysis by clustering methods (K-means, fuzzy, hierarchical clustering, diffusion map). EasyMSI offers the advantage of processing and displaying the original data (i.e. without binning).

BioMap is an image analysis platform for MSI and Magnetic Resonance Imaging. It includes viewing functions (spectrum and image display, intensity adjustment, zoom, treatment of multiple ROIs, geometrical transformations and operations), and spectrum treatment (spatial or temporal filtering, baseline correction, detrending). More elaborated functions enable a simultaneous view of all dataset images, creation of a movie, statistical and histogram analysis, co-registration of images of one or two dataset(s), and realignment of images. The use and capacities of these tools are presented through a comparative analysis of a rodent urinary bladder dataset in imzML format.


[P137] PREDALGO, a new multi-subcellular localization prediction tool dedicated to Algae

Marianne Tardif1, Ariane Atteia2, Olivier Vallon4, Michael Specht5, Sabine Brugière1, Norbert Rolland2, Myriam Ferro1, Christophe Bruley1, Gilles Peltier3, Laurent Cournac3

1 Biologie à Grande Echelle, CEA/INSERM/UJF, 17 rue des martyrs , F-38054 Grenoble, France2 Physiologie Cellulaire et Végétale, CEA/CNRS/UJF/INRA, 17 rue des martyrs , F-38054 Grenoble, France3 Bioénergétique et Biotechnologie des Bactéries et Microalgues, CEA/CNRS/Aix-Marseille Univ., , F-13108 Saint-Paul-lez-Durance, France4 Institut de Biologie Physico-Chimique, CNRS/Univ. Pierre et Marie Curie, 13 rue Pierre et Marie Curie, 75005 Paris, France5 Institute of Plant Biology and Biotechnology, University of Münster, Hindenburgplatz 55, 48143 Münster, Germany

Contact: Marianne Tardif ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics

With the growing economical interest in engineering production of energy molecules (hydrogen, lipids and carbohydrates), proteomics efforts were made to better understand the biogenesis and metabolism of the chloroplast of green Algae organisms. The unicellar green algae Chlamydomonas reinhardtii appeared as a model of choice. A crucial issue is to assign the correct subcellular localization to proteins identified in proteome surveys, a task usually assisted by Plant-dedicated localization-predicting softwares (e.g. TargetP). However, when applied to Algae sequences, these softwares tend to missort chloroplast-localized proteins to mitochondria, leading to very poor sensitivity for the chloroplast (40% for TargetP). We thus developped an Algae-specific predictor called PredAlgo. PredAlgo relies on Neural Network programming and uses as biological information the presence of any of the cleavable N-terminal presequences: chloroplast transit peptide (cTP), mitochondrial targeting peptide (mTP) or secretory pathway signal peptide (SP). The challenge was to identify new cTP/mTP in C. reinhardtii in order to train our predictor with algal-specific sets. This was achieved by screening MS/MS spectra generated by organella-specific proteomic studies [1, 2] for semi-trypsic peptides located within the first 100 amino acids of the precursor sequences. These peptide-matches likely represent N-terminal peptides of mature proteins. The data were completed with i) proteins whose cleavage site was previously determined (Edman sequencing), ii) proteins of the secretory pathway with annotated sequence cleavage position (Uniprot datamining) and iii) uncleaved cytosolic proteins. PredAlgo was trained using these C. reinhardtii-specific sets and its performance was evaluated on independant sets of C. reinhardtii sequences. Our predictor showed a highly improved discrimination capacity between chloroplast- and mitochondria-localized proteins, with high sensitivity for the chloroplast (85%). PredAlgo appeared eligible for usage on the closely related algae Volvox carteri. PredAlgo assigned about 20% of the C. reinhardtii proteome (~3000 proteins) to the chloroplast, recovering 64% of an experimental chloroplast proteome previously established by MS/MS survey [2]. In addition, PredAlgo identified ~2400 "chloroplastic" proteins which were absent from the experimental MS proteome and deserved further examination.

1. Atteia, A., et al., Mol Biol Evol, 2009. 26(7): p. 1533-48.2. Terashima, M., et al., Mol Cell Proteomics, 2010. 9(7): p. 1514-32.


[P138] Comment, et pourquoi en ESI, le groupement phosphate conduit la formation de liaisons fortes au sein de dimères du type Nuc/Nuc, Nuc/Pept et Pept/Pept ?

Jean-Claude Tabet1, Viet Nguyen1, Bessem Brahim1, Baiyie Xue1, Ying Xu1, Ludovic Muller1, Alice Delvolvé1, Sandra Alves1, Carlos Afonso1

1 LSCOB-IPCM Université Pie, 4 place Jussieu, 75 252 Paris

Contact: Jean-Claude Tabet ([email protected])Keywords: High mass and high resolution mass Spectrometry, Systems biology

Depuis l’avènement de méthodes de désorption douce, comme les modes variés d’ionisation ambiante, l’étude des systèmes non-covalents s’est développée, qu’ils s’agissent de complexes cationisés ou non, de faible ou forte taille, de nature et de propriétés différentes ou non. Ces systèmes peuvent être préformés en solution (ou dans les gouttelettes) ou non, dan ce dernier cas il ne s’agit pas de systèmes spécifiques. Dans les autres cas, ils peuvent l’être ou non et leur utilisation du point de vue analytique mérite une attention particulière pour ne par tirer des conclusions hâtives et erronées. Dans tous les cas, ses complexes simplement ou multichargés, positifs ou négatifs, libres de solvant produits après désolvatation d’agrégats chargés désorbés en phase gazeuse, nécessitent, pour «survivre» aux processus collisionnels, et d’élimination de molécules de solvant, de renforcer leurs états de charges locaux ou de changer leur nature. D’une autre manière, cela peut être associé à des modifications conformationnelles permettant de rapprocher des sites d’états de charges opposés, ou à favoriser les interactions ion-dipôle. Très souvent, les interactions hydrophobes existantes en solution, sont plus ou moins mémorisées dans les formes désorbées chargées par le jeu de modification d’états de charge locaux. Quelques soit les interactions produites et renforcées, le contrôle thermo-cinétique joue un rôle indéniable sur la présence soit de pont salin ou de liaison hydrogène. Ce comportement implique l’existence d’un ou plusieurs de formes de type zwitterion à coté de types canoniques. Afin d’illustrer l’ensemble ses points, des exemples de complexes non covalent, outre ceux de la méthode de Cooks, seront présentés. Leur comportement sera analysé avec les tandems LTQ/Orbitrap et hQH/FTICR en activant les ions avec processus d’excitations ergodiques ou non comme : (i) CID, SORI-CID, HCD, IRMP et (ii) EXD (ECD, EDD, EID, ETD). Ainsi, la discussion sera menées à partir de systèmes tels que : (i) peptides/phosphopeptide, (ii) dimères de mono nucléotides, (iii) ss, dsDNA/peptide, (iii) DNA/drug, (iv) ss, dsDNA/PNA pour montrer le comportement général quant à l’origine de leurs stabilités en phase gazeuse indépendamment de leurs charge et leur polarité nette. Nos remerciements vont à A. Woods pour ses fructueuses discussions, à la participation de maters 2 (S. Trévisiol, de Nguyen N.L.), à la SANOFI, à la plateforme SM3P, à l’UPMC et au CNRS.


[P139] Optimization of Label-Free analysis conditions for the comprehension of Pseudomonas aeruginosa biofilm establishment

Anthony Cotton1, Stéphane Claverol1, Sébastien Vilain2, Bertrand Garbay2, Marc Bonneu1

1 Plateforme Protéome, 146 rue Léo Saignat, 33076 BORDEAUX Cedex2 École Nationale Supérieure de Technologie des Biomolécules de Bordeaux, 146 rue Léo Saignat, 33076 BORDEAUX Cedex

Contact: Stéphane Claverol ([email protected])Keywords: Proteins, peptides and small molecules quantification

The bacteria immobilized within a biofilm are characterized by an exceptional resistance to the environmental stresses. The exact origin of this resistance is still debated. Among the hypothesis advanced to explain this phenotype; one finds the occurrence of a "biofilm" phenotype among all or part of the immobilized bacteria. Its medical implication; in particular in cystic fibrosis; be the reason for numerous analyses of the modifications of the genome expression of Pseudomonas aeruginosa induced by the «biofilm» mode of growth. Beside more historical quantitation technique such as bidimensionnal electrophoresis followed by image analysis or mass spectrometry after isotope labeling (i.e. iTRAQ), we have explored the capabilities of «label-free» mass spectrometry technique for the study of protein whose expression is altered in biofilms compared to planktonic growth conditions.Quantitations were performed on a LTQ-Orbitrap XL mass spectrometer and data were processed using Progenesis LC-MS «label-free» software. General considerations and optimized parameters relative to the methodology will be presented.Results from sample fractionated or not on SDS-PAGE will be compared.Finally, integration of «label-free» results with results from other quantitation techniques already performed in our laboratory will be introduced.


[P140] Aedes caspius mosquito bites: Salivary gland protein repertoire analysis and identification of specific individual exposure markers

Albin Fontaine1, Ibrahima Diouf1, Aurélie Pascual1, Nawal Bakkali1, Luc Camoin2, Emilie Baudelet2, Stéphane Audebert2, Franck Remoue3, Fréderic Pagès4, Lionel Almeras1

1 Unité de Parasitologie, Antenne Marseille de l’Institut de Recherche Biomédicale des Armées (IRBA), Le Pharo, BP 60109,, 13 262 Marseille, France2 INSERM U891, Centre de Recherche en Cancérologie de Marseille, , , 13009 Marseille, France3 UR016 Institut de Recherche pour le Développement (IRD), Caractérisation et Contrôle des Populations de vecteurs, , 911 avenue Agropolis, BP 64501,, 34394 Montpellier cedex 5, France4 Unité d’Entomologie Médicale, Antenne Marseille de l’Institut de Recherche Biomédicale des Armées (IRBA), Le Pharo, BP 60109, 13 262 Marseille Cedex 07, France

Contact: Lionel Almeras ([email protected])Keywords: Systems biology, Separative analysis methods, Clinical proteomics

Mosquito-borne diseases are a major health problem worldwide. Serological responses against mosquito saliva proteins may be useful in estimating an individual’s exposure to arthropod vectors. The aims of this study were to determine whether the IgG response level is related to mosquito density, to assess the genus and/or species specificity of this response and to identify corresponding salivary gland antigens. The antibody levels of southeast French individuals living in three areas with distinct Aedes caspius mosquito density were compared by ELISA on several mosquito salivary gland extracts. A significant increase in the antibody responses was observed based on seasonal and spatial Ae. caspius density, and the antibody responses seemed to be specific to the mosquito genus and species. Secreted Ae. caspius salivary proteins were analyzed using in-gel and off-gel methods allowing the identification of more than one thousand proteins including around two hundreds putative secreted salivary proteins. Additionally, antigenic salivary proteins eliciting this specific antibody response were characterized using an immunoproteomic approach. Such antigenic candidates will be used to assess Ae. caspius exposure bites at the individual level, and will serve to evaluate efficiency of mosquito control strategies.


[P141] Proteomic analysis of Endothelial Colony-Forming Cells (ECFCs) following treatment with Osteoprotegerin (OPG), a new actor in vasculogenesis

Zahia Benslimane-Ahmim2, Florence Poirier1, Dominique Heyman4, Catherine Boisson-Vidal2, Didier Lutomski1

1 Université Paris 13, UMR CNRS 7244 CSPBAT/LBPS, 74 rue Marcel Cachin, 93017 Bobigny, France2 INSERM, U765, , 75006 Paris, France3 Université Paris Descartes, Faculté de Pharmacie, , 75006 Paris, France4 INSERM UMR-S 957, , 44035 Nantes, France5 Université de Nantes, , 44035 Nantes, France

Contact: Florence Poirier ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Systems biology

Angiogenesis is a vital mechanism in the body’s response to wound healing and is involved in several pathological processes. It’s precisely regulated by a variety of inter- and extra-cellular signals. Osteoprotegerin (OPG) a soluble tumor necrosis factor receptor family molecule which potently inhibits RANKL-mediated osteoclastogenesis, emerges as a new actor in vasculogenesis. It protects mature endothelial cells from apoptosis in vitro and promotes neovascularization ex vivo. We previously found that OPG stimulated migration, chemotaxis and vascular cord formation on Matrigel® of Endothelial Colony-Forming Cells (ECFCs). In the present work, we attempted to determine, using proteomics, the changes in protein expression profiles following a treatment of ECFCs with OPG. The identity of differentially expressed proteins was determined by liquid chromatography-tandem mass spectrometry, and the identified proteins were grouped based on cellular function and participation in biochemical and signaling pathways. This would allow us to obtain a better knowledge of the metabolic pathways affected by OPG treatment and partly clarify how OPG is involved in vasculogenesis.


[P142] Contribution of Isotopic Mass Spectrometry to Profiling protein Changes in Colorectal Cancer disease (CRC)

Julien Peltier2, Jean-Pierre Roperch1, Stéphane Audebert2, Iradj Sobhani1, Luc Camoin2

1 Service de gastroentérologie & EA4393 laboratoire d'investigation clinique, Université Paris-Est Créteil, Hôpital Henri Mondor, 51, avenue du Mal de Lattre de Tassigny, 94010 Créteil2 Marseille Protéomique, Université de la Méditerranée, Centre de Recherche en Cancérologie de Marseille INSERM U-891, Institut Paoli-Calmettes, 27, Bd Leï Roure, 13273 Marseille

Contact: Luc Camoin ([email protected])Keywords: Clinical proteomics, Proteins, peptides and small molecules quantification

Background: The CRC is prevalent, with high cost and bad prognosis. Large polyps in the colon or rectum are considered as precancerous situation in CRC carcinogenesis schema. There is no sensitive and highly specific protein marker available in serum to detect patients with large polyp and CRC. The aim was to identify a deep proteomic library in patients with colon or rectal tumors.Methods: Serum from 4 clinical conditions were obtained: N=normal colonoscopy, A=patients with one polyp of 1 cm or more, K=patients with invasive carcinoma, B=patients investigated after treatment. For each condition, serum was considered for this study (before colonoscopy for N, A, K and 6 months after cancer treatment for B). Samples were submitted to immunopurification (MARS-14 columns), an enzymatic fragmentation followed by a chemical labeling and an isoelectric OffGel separation. Discriminative quantification of proteins was performed according the iTRAQ labeling. Results obtained by mass spectrometry were submitted to ProteinPilotTM (Applied Biosystems) program linked with IPI data bank limited to human proteins. Final analysis were performed by using Cluster 3.0, KEGG Pathway Database and Ingenuity Pathway Analysis (IPA) allowing functional estimation and genes which are involved in the carcinogenesis.Results: After optimization of protein concentration, depletion, trypsinisation and isotopic labeling, a separation of peptides was done based on two dimensional points (isoelectric & hydrophobic). Mass spectrometry MS/MS analysis allowed identification and quantification corresponding to 324 proteins (CI 95%). Based on N as control reference, 100 discriminative proteins were quantified (A/N=29, K/N=59, K/A=55). The proteins belong to two mains biological pathway; inflammation and blood coagulation. Majority of these proteins interact with MMP9 and P53 proteins in particular between N and A. In condition B these two processes are not significantly increased as compared to N.Conclusion: Inflammation and blood coagulation pathways are stimulated soon in the carcinogenesis schema of CRC. Proteins of these two pathways are now under validation in different clinical situations including patients with normal and abnormal colonoscopy.

Link: http://map.univmed.fr/


[P143] The budding yeast proteome revisited: a novel method applied to comprehensive protein identification in a simple eukaryote

Régis Lavigne1, Emmanuelle Becker 2, Yuchen Liu 3, Bertrand Evrard 3, Michael Primig 3, Charles Pineau1

1 Proteomics Core Facility Biogenouest, Campus de Beaulieu, 35042 Rennes, cedex, France2 University Rennes 1, Campus de Beaulieu, 35042 Rennes, cedex, France3 IRSET, Campus de Beaulieu, 35042 Rennes, cedex, France

Contact: Régis Lavigne ([email protected])Keywords: Systems biology

To reliably identify all proteins present in a given cell or tissue remains a challenge. In the unicellular eukaryote Saccharomyces cerevisiae, much progress has been made by establishing elaborate prefractionation protocols in combination with ever more efficient mass spectrometers. Recently, a method based on SILAC protein labeling has yielded quantitative measurements of protein concentrations in different yeast cultures. In spite of these advances the efficient and cost-effective analysis of whole sets of samples remains extremely laborious and cells cannot be studied under conditions which preclude standard amino-acid labeling.

A total yeast protein extract from logarithmically growing diploid cells cultured in rich medium was run on an SDS-polyacrylamide gel, cut into 30 bands and digested with Trypsin. Samples were then processed by iterative nanoflow LC-MS/MS analysis, the generation of peptide exclusion lists to simplify the task of peptide mapping after each round of injection, and an iterative database search with the SEQUEST and Mascot protein identification algorithms.

Our label-free method based on a simple protein extraction and separation step identified essentially all known proteins present in vegetatively growing diploid yeast cells. The vast majority of the proteins were found in both replicate experiments. Iterative protein identification was found to substantially increase the number of detected proteins.

Simple yeast protein extraction and SDS-gel based prefractionation in combination with our novel mass-spectrometric method yields the proteins present in vegetatively growing yeast cells. This finding raises the exciting possibility of large-scale dynamic proteome profiling of the yeast life cycle in wild type and mutant backgrounds. Moreover, our method is also suitable for studying processes not amenable to SILAC such as meiosis and gametogenesis.

Link: http://www.proteome.univ-rennes1.fr/


[P144] Aspect fondamental de l'utilisation de masques en MALDI

Laurent Diologent1, Maxence Wisztorski1, Gérard Bolbach3, Cristian Focsa2, Michael Ziskind2, Isabelle Fournier1

1 Laboratoire de Spectrométrie de Masse et de Biologie Fondamentale & Appliquées, EA 4550, Université Lille 1 Sciences et Technologies, F-59655 Villeneuve d'Ascq2 Laboratoire de Physique des Laser, Atomes et Molécules, CNRS UMR 8523, Université Lille 1 Sciences et Technologies, F-59655 Villeneuve d’Ascq3 Laboratoire des biomolécules, CNRS UMR 7203, Université Paris 6, F-75252 Paris

Contact: Laurent Diologent ([email protected])Keywords: Instrumentation, Imaging mass spectrometry

Depuis son introduction, fin des années 80, le MALDI s’est imposé comme une source de production d’ions incontournable pour les applications biologiques en permettant d’analyser des molécules jusqu’à des très haut poids moléculaires, quelque soit leur polarité et sous leur forme intacte. Les domaines d’application du MALDI se sont encore accrus avec le développement de l’imagerie MALDI à la fin des années 90. Cependant, les mécanismes impliqués dans le processus de désorption/ionisation sont extrêmement complexes et encore mal connus. Ainsi, si la source MALDI permet d’analyser de faibles quantités d’analytes en partie compatibles avec les systèmes biologiques étudiés, il faut noter que seul au maximum quelques pourcents d’ions sont formés par tir laser sur l’ensemble de la matière éjectée. L’augmentation de la quantité d’ions produite apparaît dans ces conditions comme un aspect crucial et particulièrement important pour l’imagerie MALDI, puisque l’amélioration de la résolution spatiale de la technologie pour atteindre une résolution subcellulaire nécessite une augmentation de la sensibilité. En effet, la quantité d’ions chute de façon assez drastique pour un faisceau plus focalisé. Différentes études fondamentales peuvent être conduites pour étudier cet aspect. Dans la présente étude, nous nous sommes plus particulièrement intéressés aux effets de l’utilisation de masques de silicium sur la quantité d’ions détectés. Les masques sont des wafers de silicium dans lesquels ont été gravés des ouvertures de dimensions identiques et espacées régulièrement afin de former un quadrillage où chaque ouverture constitue un point d’analyse à travers laquelle le laser atteint l’échantillon. Différentes configurations de masques peuvent être fabriquées par nanotechnologies i.e. masques à flancs inclinés ou à flancs droits. Pour une configuration de masque donnée, il est également possible de faire varier les paramètres dimensionnels soit la largeur de l’ouverture et l’épaisseur du masque. Les signaux mesurés sur les spectres MALDI-TOF obtenus lors de l’utilisation de ces masques se sont montrés grandement influencés par les variations des dimensions de ces masques. Des effets particulièrement importants ont été observés sur les masques à bords droits. Ainsi, l’utilisation de ces masques a clairement montré que les ouvertures les plus petites permettent d’obtenir des signaux généralement plus intenses qu’en l’absence de masque. Ces effets ont été étudiés de manière systématique pour différentes conformations afin de comprendre les phénomènes fondamentaux impliqués. L’une des hypothèses permettant d’expliquer cette augmentation de signal serait un confinement de la plume à l’intérieur de l’ouverture amplifiant les collisions efficaces entre les composés désorbés et augmentant donc le taux d’ions produits par transfert de proton de la matrice à l’analyte.

Link: www.maldi-imaging.com


[P145] MALDI imaging and profiling on a "mirror" mouse model for absence epilepsy: Identification and validation of potential protein markers

Mélanie Lagarrigue1, Theodore Alexandrov2, Régis Lavigne1, Gabriel Dieuset3, Benoît Martin3, Charles Pineau 1

1 Proteomics Core Facility Biogenouest, IRSET, Campus de Beaulieu, 35042 Rennes, France2 Center for Industrial Mathematics (ZeTeM), University of Bremen, 28334 Bremen, Germany3 Inserm U642, Campus de Beaulieu, 35042 Rennes, France

Contact: Charles Pineau ([email protected])Keywords: Imaging mass spectrometry, Bioinformatics et biostatistics dedicated to proteomics

Childhood Absence Epilepsy is a prototypic form of generalized non convulsive epilepsy characterized by short impairments of consciousness concomitant with synchronous and bilateral spike-and-wave discharges in the electroencephalogram. Two mouse lines BS/Orl (sensitive) and BR/Orl (resistant), constituting a "mirror" mouse model of human absence-epilepsy, were derived from a genetic selection to study absence epilepsies. MALDI imaging mass spectrometry (IMS) was chosen to investigate spatial distribution and expression levels of proteins in brains of the BR/Orl and BS/Orl mouse strains. Frozen brains of four BS/Orl and four BR/Orl were cut on a cryostat and thaw mounted onto Indium-Tin-Oxide coated conductive glass slides. After washing and drying of tissue sections, matrix was applied by vibrational vaporization under controlled conditions using an ImagePrep station. Protein mass spectra were acquired on Autoflex III Smartbeam MALDI-TOF mass spectrometer at 80 µm lateral resolution in a mass range of 2-25 kDa.Each dataset constituted of acquired mass spectra during each MALDI imaging experiment was reduced taking only each 16th spectrum (decimation). Null spectra were excluded and mass spectra recalibration was performed. A new type of cross-classification based on a combined discrete wavelet transformation (DWT) - support vector machine (SVM) classification was developed to classify all sets of one type vs. each set of the other type. Very high recognition rates (87-99%) were obtained to classify the BS/Orl and BR/Orl mice brains. Nineteen m/z ratios were thus highlighted as potential biomarkers. Five of them are significant for 7 or 6 out of 8 carried out cross-classifications. Potential biomarkers evidenced by the statistical analysis were further identified using a top-down approach. Proteins from three different zones of mice brains (thalamus, cortex and somatosensory cortex) containing potential biomarkers were extracted and then fractionated by reversed phase HPLC. An aliquot of each collected fraction was analyzed by MALDI-TOF mass spectrometry to select fractions containing proteins with m/z values that could correspond to the biomarkers of interest. Selected fractions were then loaded onto a nanoLC column coupled to an LTQ-Orbitrap XL mass spectrometer for top-down analysis. MS/MS fragmentations were performed using Higher Energy Collision Induced Dissociation (HCD). Several of the most significant potential biomarkers were identified so far, among which a key protein yet suspected to be involved in epilepsy. The topography of expression of candidate proteins was further validated by immunohistochemistry and Western blot experiments. Functional assays are being performed to confirm the involvement of one specific protein candidate in the mechanisms underlying absence epilepsy.



[P146] IMPACT OF HUMAN PLASMA PATHOGEN INACTIVATION BY UV-IRRADIATION IN PRESENCE OF METHYLENE BLUE/UV light: IDENTIFICATION OF FIBRINOGEN MODIFICATIONS

Alexia ORTIZ1, Christine DEFER1, Fabrice BRAY2, Dominique DERNIS1, Jean-Jacques HUART1, Caroline TOKARSKI2, Christian ROLANDO2

1 Etablissement Français du Sang Nord-de-France, 96, rue Jemmapes, 59012 Lille Cedex2 USR CNRS 3290 Miniaturisation pour l'Analyse, la Synthèse & la Protéomique et IFR 147 Protéomique, Modification Post-traductionnelles et Glycobiologie, Université de Lillé 1, Avenue Paul Langevin, 59655 Villeneuve d'Ascq Cedex

Contact: Alexia ORTIZ ([email protected])Keywords: High mass and high resolution mass Spectrometry, Clinical proteomics

One of the objectives of the French Blood Bank is to preserve the transfusional quality of plasma. Various procedures routinely used for pathogen inactivation cause some loss of biological function in key plasma proteins. The most used inactivation technique is the irradiation of plasma by UV light using methylene blue (MB) as a sensitizer, which is known to affect the biological activity of fibrinogen. Indeed MB, a phenothiazine dye compound, generates reactive oxygen species that oxidize AND, lipids and also proteins in presence of UV light. Fibrinogen is a phophorylated glycoprotein composed of a dimer of three non-identical Aα-, Bβ-, and γγ-chains that is involved in the clotting process, . This study aims to characterize the impact of BM-treatment on this coagulation factor.

First we optimized the isolation of intact fibrinogen. We started the isolation by the classical Cohn’s fractionation of plasma. Cohn’s fraction I, which contains fibrinogen, is obtained by cold 8% ethanol at -3°C. The fraction was then purified by HIC that does not require the use of organic solvents preserving the protein structure. The stationary phase, which is non commercially available, was obtained by grafting n-pentylamine on Sepharose 4B. A gel filtration step on Superose was added as a polishing step. Fibrinogen activity was checked after each step by testing its clottabilty using thrombin.

Plasmas from a single donor treated with MB and native were provided by the the French Blood Bank, Nord de France. Native 1DE clearly highlighted the presence of fibrinogen in its intact form (340 kDa) after the chromatographic steps. Native 1DE also shows the improvement of extra proteins elminination during the purification step, mainly APOB100 by Cohn’s precipitation and albumine by the HIC column. The identification of the band at 340 kDa was confirmed by in-gel digestion of high molecular weight zones and MALDI-TOF/TOF analysis. Denaturating 1D SDS-PAGE allowed the three α, β, γ chains to be separated. 2DE-gel images exhibited a change in the electrophoretic patterns of each subunit. Purified fibrinogen was digested in-solution and the resulting peptides were then analyzed by nanoLC-nanoESI-FT-ICR-MS. A label-free quantification pointed out an oxidation in MB-treated fibrinogen on its β-subunit. A deamidation was also identified on the α-subunit of fibrinogen on BM-treated samples. Preparative purifications are now planned to fully establish the link between clottability and these chemical modifications of fibrinogen after UV irradiation in presence of methylene blue.


[P147] Identification and absolute quantification of a potential degradation marker of transfusion-grade human plasma during production or storage

Alexia ORTIZ1, Latifa RICHA1, Christine DEFER1, Cathy LANE3, Carole MINSINI3, Dominique DERNIS1, Jean-Jacques HUART1, Caroline TOKARSKI2, Christian ROLANDO2

1 Etablissement Français du Sang Nord-de-France, 96 rue de Jemmapes, 59012 Lille Cedex, France2 USR CNRS 3290 Miniaturisation pour l'Analyse, la Synthèse & la Protéomique et IFR 147 Protéomique, Modification Post-traductionnelles et Glycobiologie, Université de Lille 1, Avenue Paul Langevin, 59655 Villeneuve d'Ascq Cedex, France3 AppliedBiosystems Sciex, , Warrington, UK

Contact: Alexia ORTIZ ([email protected])Keywords: Proteins, peptides and small molecules quantification, Clinical proteomics

The objective of the French Blood Bank is to preserve the transfusion quality of plasma. The plasma retinol binding protein 4 (RBP4) has previously been identified as a potential marker of plasma thermal degradation during production or storage. This 21 kDa protein is responsible of the transport of vitamin A. It circulates associated with transthyretin (TTR) in a tetrameric form to prevent its premature loss by kidney filtration. The aim of the present work is to develop a sensible and reliable method of absolute quantification of free RBP4 and of the RPB4-TTR complex in transfusion plasma.

The isolation of both free RPB4 and TTR-complexed RBP4 from plasma sample was set up by coupling anti-RBP4 antibodies which recognize both forms on a Sepharose column. Characterization was performed by 1D gel electrophoresis under both native and denaturing conditions. Bands of interests were digested by trypsin and analyzed by MALDI-TOF/TOF. Then, purifications were achieved according to the French Blood Bank’s specifications: 6 hours, 12 h, 24 h and 72h after collecting the blood from the donor.

To define specific peptides to be labeled by stable isotopes, an in-solution digestion of a commercial RBP4 using trypsin was achieved. The resulting peptides were analyzed by nanoLC-nanoESI-Q-TOF MS. Three specific peptides (YWGVASFLQK, FSGTWYAMAK and DPNGLPPEAQK) were identified for the AQUA quantifications and synthesized with isotope incorporation (on 13C and 15N labeled lysine). 5 µg of non-depleted plasma were digested in liquid; the resulting peptides were added to the labeled ones in isotopic dilution conditions and analyzed by nanoLC-nanoESI-FT-ICR MS. The total amount of RBP4 was quantified at 1.6 pmol/µL. The result is consistent with the theoretical plasma level. Both forms of RBP4 were also quantified after immuno-purification from specifically degraded plasma samples.

Additional analyses were achieved on nanoLC-nanoESI-QTRAP MS on non-depleted plasma. RBP4 was selected for MRM assay development from MS/MS data. Linear Ion Trap MS/MS spectra confirmed the identity of the RBP4 peptides. Furthermore, a deamidation was pointed out on the LIVHNGYCDGR peptide. This modification is characteristic of protein degradation. A quantification of this deamidation was achieved from MRM traces. It was also applied to plasma samples degraded under specific conditions related to pathogen inactivation treatments. The time dependence of the apparition of free RBP4 and of post-translational modifications will be discussed.


[P148] Détermination par couplage GC/TOF des différents composants des huiles essentielles de Zanthoxylum zanthoxyloïdes et Newbouldia laevis

P. A. Olounladé1, E. Leroy5, E. V. B. Azando1, M. S. Hounzangbe-Adoté1, T. B. Tam Ha2, C . Moulis3, N. Fabre3, H. Hoste4, A. Valentin3

1 Laboratoire d'Ethnopharmacologie et de Santé Animale, Faculté des Sciences Agronomiques, Université d'Abomey-Calavi, 01 BP 526, 00229 Cotonou, Bénin2 Laboratoire de Pharmacognosie de l’Université Paul Sabatier, 35 Chemin des Maraîchers, 31062 Toulouse, Cedex France3 Pharma-Dev -UMR 152 / Faculté de Pharmacie, Université de Toulouse III, 35 Chemin des Maraîchers, 31062 Toulouse, Cedex France4 UMR 1225 INRA/ ENVT, 23, Chemin des Capelles, 31076 Toulouse Cedex France5 Service Commun de Spectrométrie de Masse, Université Paul Sabatier, 118 route de Narbonne, 31062 Toulouse cedex 09 France

Contact: E. Leroy ([email protected])Keywords: High mass and high resolution mass Spectrometry, Separative analysis methods

L’anguillulose est une parasitose des zones tropicales et subtropicales dont les traitements perdent de leur efficacité (émergence de résistances). Au Bénin, la flore qui regorge d’une ressource abondante et diversifiée de plantes médicinales et de la connaissance de la médecine traditionnelle sont susceptibles d'ouvrir de nouvelles voies pour la recherche de nouveaux médicaments antiparasitaires. Notre travail présente une détermination par couplage GC/TOF et évaluation in vitro de l'activité anthelminthique des différents composants des huiles essentielles de Zanthoxylum zanthoxyloïdes et Newbouldia laevis, deux plantes médicinales de la pharmacopée traditionnelle béninoise. Environ 81% de composés ont été identifiées dans l'huile essentielle des feuilles de Newbouldia laevis alors qu'environ 85% de composés ont été identifiées dans l'huile essentielle des graines de Zanthoxylum zanthoxyloïdes. L'huile essentielle des graines de Zanthoxylum zanthoxyloïdes présente 27 molécules dont les principales sont γ-terpinène (18 %), undécane (14,8 %), valencène (8,3 %), le décanal (8,3%) et 3 -carène (6,7%). L'huile essentielle des feuilles de Newbouldia laevis contient 42 composés et ses principaux constituants sont β-caryophyllène (36,1%), et l'eugénol (5,7%). Les huiles essentielles des deux plantes ont inhibé l’excrétion des œufs et la migration des larves de Strongyloïdes ratti, modèle proche de Strongyloïdes stercoralis agent pathogène de l’anguillulose humaine. L’utilisation traditionnelle de ces plantes dans la médecine traditionnelle comme anthelminthique semble être justifiée.


[P149] AT_CHLORO, a Comprehensive Chloroplast Proteome Database with Subplastidial Localization

Myriam Ferro1, Daniel Salvi2, Sabine Brugière1, Daphné Seigneurin-Berny2, Mourad Mellal1, Lucas Moyet2, Christophe Bruley1, Christophe Masselon1, Norbert Rolland2

1 BGE/EDyP, CEA/Grenoble, 17 rue des Martyrs, 38054 Grenoble2 PCV, CEA/Grenoble, 17 rue des Martyrs, 38054 Grenoble

Contact: Myriam Ferro ([email protected])Keywords: Systems biology

Recent advances in the proteomics field have allowed a series of high throughput experiments to be conducted on chloroplast samples, and the data are available in several public databases. However, the accurate localization of many chloroplast proteins often remains hypothetical. This is especially true for envelope proteins. We went a step further into the knowledge of the chloroplast proteome by focusing, in the same set of experiments, on the localization of proteins in the stroma, the thylakoids, and envelope membranes. LC-MS/MS-based analyses first allowed building the AT_CHLORO database (http://www.grenoble.prabi.fr/protehome/grenoble-plant-proteomics/), a comprehensive repertoire of the 1323 proteins, identified by 10,654 unique peptide sequences, present in highly purified chloroplasts and their subfractions prepared from Arabidopsis thaliana leaves. This database also provides extensive proteomics information (peptide sequences and molecular weight, chromatographic retention times, MS/MS spectra, and spectral count) for a unique chloroplast protein accurate mass and time tag database gathering identified peptides with their respective and precise analytical coordinates, molecular weight, and retention time. We assessed the partitioning of each protein in the three chloroplast compartments by using a semiquantitative proteomics approach (spectral count). These data together with an in-depth investigation of the literature were compiled to provide accurate subplastidial localization of previously known and newly identified proteins. A unique knowledge base containing extensive information on the proteins identified in envelope fractions was thus obtained, allowing new insights into this membrane system to be revealed. Altogether, the data we obtained provide unexpected information about plastidial or subplastidial localization of some proteins that were not suspected to be associated to this membrane system. The spectral counting-based strategy was further validated as the compartmentation of well known pathways (for instance, photosynthesis and amino acid, fatty acid, or glycerolipid biosynthesis) within chloroplasts could be dissected. It also allowed revisiting the compartmentation of the chloroplast metabolism and functions.Molecular & Cellular Proteomics 9:1063–1084, 2010.

Link: http://www.grenoble.prabi.fr/protehome/grenoble-plant-proteomics/


[P150] Gel-free and Gel-based Quantitative Proteomic Profiles of the Marine Bacterium Photobacterium angustum Exposed to UVB Radiation

Sabine Matallana-Surget1, Fabien Joux1, Ruddy Wattiez2, Philippe Lebaron1

1 Laboratoire d’Océanographie Microbienne, Observatoire Océanologique, Université Paris VI. CNRS, UMR7621 , Avenue Fontaulé, 66650 Banyuls sur mer, France2 Department of Proteomics and Microbiology, Interdisciplinary Mass Spectrometry Center (CISMa), Université de Mons, Avenue du Champ de Mars n°6, 7000 Mons, Belgium

Contact: Sabine Matallana-Surget ([email protected])Keywords: Proteins, peptides and small molecules quantification

The marine heterotrophic bacterium with sequenced genome Photobacterium angustum was previously found to be resistant towards UVB radiation. The objective of this study was to examine the UVB response of this bacterial model using both gel-free and gel-based quantitative proteomics approaches. Bacterial cells were grown in artificial sea water with glucose (3 mM) under moderate irradiation (1 W/ m²) to study their capacity to photoadapt and to resist to UVB. Irradiated cells and their respective dark controls were harvested for proteomics study after 1h45 of growth under UVB (corresponding to 6.5 kJ / m²). The analysis of the changes in the proteome of P. angustum when exposed to UV radiation was analyzed by application of both post-digest Isotope Coded Protein Labeling (ICPL) and 2D DIGE methods. Thus, we used these two quantitative proteomics methods to screen for heart proteins that are regulated under UV radiation.A total of 993 proteins were identified by LC-MS/MS, corresponding to 22% of the theoretical proteome of P. angustum. Four different biological replicates were carried out for each of the two quantitative proteomics methods and a total of 8 LC-MS/MS runs were performed for the shotgun identification. An average of 400 proteins was quantified in all biological replicates of each ICPL run with a differential protein abundance ratio (UVB/DARK) ranging from 0.5 up to 3.5. A total of 583 ICPL labeled non-redundant proteins had significant differential abundance in comparison to the dark control, and 245 were identified in the four replicates, representing an overall average of 25% of the expressed proteome. Among the 245 common proteins in the four biological replicates, 40 were found to be identically regulated. The 2D DIGE technology enabled to identify 22 proteins newly quantified proteins compared to the post-digest ICPL approach, and confirmed the differential regulation of 8 proteins already quantified using the ICPL approach. The major consequence of long term UVB irradiation is DNA damage. Our data are consistent with this, indicating that recombinase A with an average ratio (UVB/dark) of almost 3, play a crucial role in the so-called dark repair systems, involved in excision repair, post-replication recombinational repair, mutagenic or SOS response, and thus preventing the cell against the accumulation of DNA damage. Several other up-regulated proteins are of interest such as a putative antioxidant AhpC/Tsa family protein, chaperonin proteins, and glyoxalase protein as well as a putative lipoprotein. The down-regulated proteins are mainly involved in amino acids transport and metabolism, phosphotransferase system, as well as the Krebs cycle. Currently, we further developed different strategies to confirm and validate those interesting data.

Link: http://lomic.obs-banyuls.fr/fr/equipe_biodiversite_et_biotechnologie_microbienne.html


[P151] Quantitative proteomics ICPL analysis reveals alteration of several functional processes in glioblastoma multiforme

Emmanuelle Com1, Anne Clavreul2, Mélanie Lagarrigue1, Sophie Michalak3, Philippe Menei2, Charles Pineau1

1 Plate-forme protéomique Biogenouest, IRSET , 263 avenue du Général Leclerc, 35042 Rennes cedex, France2 Département de Neurochirurgie, CHU d’Angers, Inserm U646, 4 rue Larrey, 49933 Angers, France3 Département de pathologie cellulaire et tissulaire, CHU d’Angers, 4 rue Larrey, 49933 Angers, France

Contact: Emmanuelle Com ([email protected])Keywords: Clinical proteomics

Glioblastoma multiform, the most frequent primary tumor of the central nervous system, remains one of the most lethal human cancers despite intensive researches. The current paradigm in the molecular biology of glioblastoma has been focused on inter–patient variability and on trying to isolate new classification elements or prognostic factors. On the contrary, the purpose of the Grand Ouest Glioma Project, a comprehensive pluridisciplinary and multicentric research project financed INCa, is to offer an innovative view on the intra-tumor heterogeneity by analyzing four regions of interest (necrosis, tumor core, interface and peritumoral brain tissues) with different technologies (functional RMI, isolation of tumor cells by primo-cultures from per operative computer guided biopsies, genomics, transcriptomics, proteomics and comparative biological studies).In the proteomics workpackage, we aimed at identifying proteins differentially expressed between the four regions of glioblastoma. It was conducted on biopsies from 5 patients using the ICPL technology. Proteins of the different region of interest were extracted from isolated cells and labeled with light (12C), medium (2H4) or heavy (13C6) ICPL reagents. The three samples were combined and the mixture was further resolved onto a SDS-PAGE gel. The gel lane was cut into 20 pieces that were further trypsin digested. Proteolytic mixtures were analyzed by nanoLC-ESI-ITMS. Protein identifications were obtained by submitting MS/MS data to protein database (SwissProt) search using the Mascot algorithm. Relative quantification was obtained by comparing the signal intensities of light, medium and heavy labeled peptides on MS-spectra, using the WarpLC software. The Annotation, Mapping, Expression and Network (AMEN) software was used to identify the involvement of differential proteins in various biological processes.584 non-redundant proteins were identified and a protein expression gradient was observed from the tumor core to the periphery. We have identified 31 up-regulated proteins in the tumor region compare to the peri-tumoral brain tissue, among which, 23 proteins belong to an interaction network linked to 4 biological processes such as synaptic transmission. The core of this network is mainly constituted of interactions between beta-actin (ACTB) with heat shock proteins (HSP90AA1, HSPA8) and 14-3-3 proteins (YWHAZ, YWHAG, YWHAB). Furthermore, a cluster of three isoforms of the sodium pump alpha subunit (ATP1A1, ATP1A2, ATP1A3) was identified outside this network. The differential expression observed for ACTB and 14-3-3 gamma was validated by western blot and immunohistochemistry.This study confirms the identity of original molecular targets, highlights several functional processes altered in glioblastoma such as energy metabolism and synaptic transmission and suggests new therapeutic trails.


[P152] Accessing the testicular germ cell secretome with «combinatorial omics»: a major breakthrough in deciphering the germ cell-sertoli cell dialogue

Emmanuelle Com1, Frédéric Chalmel2, Régis Lavigne1, Nolwen Hernio1, Laetitia Guillot1, Ana-Paula Teixeira 3, Jean-Louis Dacheux 3, Charles Pineau 1

1 Plate-forme protéomique Biogenouest, 263 avenue du Général Leclerc, 35042 Rennes Cedex2 IRSET, 263 avenue du Général Leclerc, 35042 Rennes Cedex3 UMR INRA-CNRS 6175, Centre de Tours, 37380 Nouzilly

Contact: Emmanuelle Com ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics, Systems biology

The extremely complex structural organization of the mammalian testis creates particular difficulties for studying its organization, function and regulation. Spermatogenesis that takes place in the seminiferous tubules is an intricate and highly specialized process whose control incorporates juxtacrine, paracrine and endocrine factor information, and is conditioned by the successive activation and/or repression of thousands of genes and proteins, including numerous testis-specific isoforms. It has been yet established that germ cells modulate somatic Sertoli cell function via diffusible proteins. However, the impossibility to maintain germ cells in vitro makes it difficult to study their secretome. Interestingly, within the seminiferous tubules, germ cells and Sertoli cells are surrounded by the testicular fluid, which probably contains factors involved in the germ cell-somatic cell crosstalk.

An innovative approach combining testicular fluid collection by microsurgery, fluid pre-fractionation, shotgun mass spectrometry and «combinatorial omics» was used to decipher and mine the rat and ram testicular fluids. Over 1400 non redundant proteins were identified and their presence in testicular fluids was further correlated with the transcriptome of isolated testicular cells so as to confirm their cellular origin.

Secreted proteins were identified and scored using the Secreted Protein Database (SPD). We demonstrate here that a subset of proteins is actively secreted into the testicular fluid by germ cells. Potential known partners of these germ cell-secreted proteins were proposed using protein network data available via certified public repositories and those known to be expressed on Sertoli cells plasma membranes were selected for further studies. Coexpression of potential germ cell-Sertoli cell protein partners was validated using immunohistochemistry on rat testis sections.

Our results provide new insights into the germ cell-Sertoli cell crosstalk by identifying novel interacting protein partners. We also demonstrate that «combinatorial omics» is a powerful approach to characterize the testicular germ cell secretome that was so far technically inaccessible.



[P153] TOF-SIMS imaging study of laminar distribution of cholesterol in Alzheimer disease

Adina N LAZAR1, Nicolas DESBENOIT3, Claudia BICH3, Vanessa PETIT4, Mai PANCHAL1, David TOUBOUL3, Olivier LAPREVOTE5, Alain BRUNELLE3, Charles DUYCKAERTS1

1 Laboratoire de Neuropathologie Escourolle, Hôpital de la Salpêtrière, 47 Bd de l'Hôpital, 75013 Paris, France2 Centre de recherche de l'ICM, 47 Bd de l'Hôpital, 75013 Paris, France3 Centre de recherche de Gif, Institut de Chimie des substances naturelles, CNRS, Avenue de la terrasse, 9 Gif-sur-Yvette, France4 LRTS, IRCM, DSV, Commissariat à l'énergie atomique CEA, 18 route du panorama, 92265 Fontenay-aux-roses, France5 Laboratoire de Chimie-Toxicologie Analytique et Cellulaire, Faculté des sciences Pharmaceutiques et Biologiques, Université Paris Descartes, 12 rue de l'école de médecine, 75006 Paris, France

Contact: Adina N LAZAR ([email protected])Keywords: Imaging mass spectrometry

Alzheimer’s disease (AD) is the most common form of dementia characterized by extracellular deposition of aggregated amyloid beta peptide and intraneuronal accumulation of tau protein. Several evidences support the involvement of cholesterol in the development of AD: the isoform E4 of apolipoprotein E, the main transporter of cholesterol in the brain, is the strongest known risk factor of AD; cholesterol concentration is increased in AD brains (Xiong 2008, Culter 2004, Puglielli, 2003) and cholesterol accumulates in senile plaques (Panchal 2010). In this work we determined if the higher level of cholesterol in the cortex was due to a homogeneous increase or if cholesterol was accumulated in specific layers. By means of TOF-SIMS imaging we confirmed that the total amount of cortical cholesterol was significantly higher in AD than in controls. Cholesterol was unevenly distributed in the cortical layers. By correlating the distribution of cholesterol with the probability of location of a given cortical layer, we found that the increase of cholesterol in AD was mainly significant for cortical layer III. This might be related to a higher concentration of senile plaques in this layer. Up to now, TOF-SIMS analysis of the cortex has been performed on rat or mouse tissue (Altellar 2006, McDonnell 2006, Nygren 2005, Sjöval 2004, Touboul 2004, 2005). Only two studies report on human brain analysis by SIMS, concerning the imaging and quantification of aluminium in the cortex of non-encephalopathic renal dialysis patients (Candy 1992) or the subcellular distribution of iron-ferritin-hemosiderin in hippocampus of AD subjects (Quintana 2007).


[P154] Analyse de composés ultra-volatiles par GC/MS : application à l’étude des composés de dégradation d’une perfluorocétone.

Guillaume Cazals1, Christine Enjalbal2, Franck Guillen3, Abdelkader Dahmani3

1 Laboratoire de Mesures Physiques, Université Montpellier 2, Place E.Bataillon, 34095 Montpellier Cedex 52 Institut des Biomolécules Max Mousseron, Université Montpellier 2, Place E.Bataillon, 34095 Montpellier Cedex 53 Société S3F chimie, Université Montpellier 2, Place E.Bataillon, 34095 Montpellier Cedex 5

Contact: Guillaume Cazals ([email protected])Keywords: Separative analysis methods

La chromatographie en phase gazeuse (GC) est l’outil de choix pour l’étude de composés volatile, le couplage de cette technique à la spectrométrie de masse permet une identification de composés au sein de mélanges parfois complexes. Cependant dans le cas de l’étude de composés ultra-volatiles (points ébullition compris entre -10°C et -130°C), les conditions classiques d’analyse et d’injection en solution ne sont plus adaptées.

Nous avons développé au laboratoire une technique d’analyse de ces composés basée sur une injection head-space et une colonne capillaire ayant des propriétés spécifiques pour retenir nos composés d’intérêts. Cette méthode qui se veut efficace et facile à mettre en œuvre a été appliquée avec succès à l’étude des composés issus de la dégradation thermique d’une perfluorocétone.

Pour cela, la dodécafluoro-2-méthylpentan-3-one (C6F12O, FK-5-1-12) sous forme liquide est soumise à une dégradation thermique, le gaz résultant est ensuite injecté sur four de chromatographie gazeuse (Focus GC, Thermo) selon la technique d’injection head-space. La séparation s’effectue en utilisant une colonne capillaire Rtx-200 (Restek), greffée avec des groupements trifluoropropylmethyl polysiloxane, assurant ainsi une affinité optimale avec les composés perfluorés d’intérêt. La détection est assurée par spectrométrie de masse simple quadripôle en Impact Electronique (DSQII, Thermo) qui s’est révélée être un mode d’ionisation très sensible de nos composés.Cette méthode nous a ainsi permis de séparer et d’identifier les différents composants issus de la dégradation thermique d’un composé perfluoré.

Link: http://www.ibmm.univ-montp1.fr/index.php


[P155] Development of an absolute and multiplex MS-based quantification method for E. coli carbon central metabolism protein, and application for creating dynamic predictive models.

Mathieu Trauchessec1,2, Michel Jaquinod1, Gwenaëlle Bestel-Corre2, Christophe Bruley1, Jérôme Garin1, Myriam Ferro1

1 EDyP/BGE/iRTSV/CEA, 17 rue des martyrs, 38000 Grenoble, France2 Metabolic Explorer, Bipôle Clermont LImagne, 63360 Saint-Beauzire, France

Contact: Mathieu Trauchessec ([email protected])Keywords: Proteins, peptides and small molecules quantification, Systems biology, High mass and high resolution mass Spectrometry

METabolic EXplorer is a green chemistry company seeking to design and invent the next generation of daily products by reducing or eliminating the use or generation of hazardous substances. The strategy to develop an economically viable fermentation process was to genetically engineer high-performance production strains. To that aim, Metex use metabolic engineering of E.coli for industrial production. Metabolic network models allow absolute fluxes through larger networks of central carbon metabolism to be determined. However, these stoichiometric based-models only set aside static prediction. To obtain dynamic prediction models, quantitative omics must be integrated into a systems-oriented framework together with enzymology quantitative data. To accurately quantify protein, different MS-based strategies are available, such as AQUA or QconCAT. Among this list, PSAQ strategy (Protein standard Absolute Quantification), based on full length isotope labeled protein as internal standard for mass spectrometry quantification [Brun et al, 2007], is described as the most accurate. To carry out our study, PSAQ strategy coupled to SRM (Selected Reaction Monitoring) analysis has been chosen to accurately and specifically quantify proteins in E.coli lysat. The challenge of the present study is to obtain high-precision absolute quantification of dozen of proteins in a single SRM analysis without any decomplexification. Indeed, dynamic range of E.coli is known to be roughly 10^4 between the less and more abundant proteins. However, in spite of its good specificity, SRM is not sensitive enough to accurately quantify in a so large dynamic range. To bypass heavy pre-fractionation steps, scheduled SRM mode was set up, allowing sensitivity gain, compared to classical SRM mode. For absolute quantitative proteomics we have produced full-length stable 15N isotopally labelled protein. The purification and quality control of protein standards, crucial for good-quality and accurate measurement, were achieved by Amino Acids composition and isotopic distribution using LC/MS on an Orbitrap mass spectrometer. Accurate quantification of dozen of proteins was obtained on a single run, without decomplexification, in a 10^2 dynamic range, scanning hundreds transitions by scheduled SRM. A comparison has been carried out between the conventional SRM and the scheduled SRM modes. In complex matrices, it clearly appeared that scSRM allowed both better chromatogram definition and noise reduction, resulting respectively in a more accurate quantification and sensitivity gain. With this approach, our aim is to scan and accurately quantify approximately 30-40 proteins in a single run, in a larger dynamic range. With a so rapid accurate quantification method, it will become possible to obtain enough quantitative proteomics data of different E.coli strains for providing dynamic prediction models.


[P156] Comparison between imac and tio2 for on-line enrichment of phosphopeptides: application for quantitative analysis of hepatic biopsies.

Luc Negroni1, Sophie Geiger1, Stephane Claverol3, Marc Bonneu3, Eric Chevet2, Jean Rosenbaum2, Jean-Marie Schmitter1

1 CBMN, université de Bordeaux, Univ. Victor Segalen, 146 rue Léo Saignat, BP68, 33076 Bordeaux cedex2 U1053, Université de Bordeaux, Univ. Victor Segalen, 146 rue Léo Saignat, 33076 Bordeaux3 PGF, université de Bordeaux, Univ. Victor Segalen, 146 rue Léo Saignat, BP68, 33076 Bordeaux cedex

Contact: Luc Negroni ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Separative analysis methods

Phosphoproteomics require an enrichment of phosphopeptides that is usually done by affinity chromatography with disposable tips or in-vial. In the present work, we have implemented an on-line process, including a column packed with titanium dioxide (TiO2). Preliminary tests showed unambiguously the better performance of Ti4+ for phosphopeptide enrichment in comparison to IMAC-Fe3+ (POROS 20 MC). Contamination level was estimated using a simple mixture (tryptic digest of casein-albumin) and confirmed the results of Jensen et al.[1]. Different acidic and saline conditions were tested for sample loading. Several elution conditions were compared and confirmed the crucial role of the loading buffer toward the specificity of TiO2 purification. A simple increase of TFA from 0.1 M to 0.65M (5%TFA) dramatically decreases the non-specific binding of acidic peptides (D/E-rich peptides) and the use of 1 M glycolic acid reinforces the specificity of phosphopeptide enrichment. This last eluent was successfully tested with complex samples from plant (root extract) or animal (liver) origin. A protocol that includes iTRAQ labeling and the preliminary results obtained with biopsies from hepatic carcinoma will also be presented.

1. Jensen SS, Larsen MR: Evaluation of the impact of some experimental procedures on different phosphopeptide enrichment techniques. Rapid Commun Mass Spectrom 2007, 21:3635-3645.


[P157] Analyse iTRAQ, comparatif RSLC LTQ-Orbitrap-Velos / NanoLC MALDI-TOF-TOF 4800

Marjorie Leduc1, Virginie Salnot1, Christian Federici1, François Guillonneau1, Cédric Broussard1, Patrick Mayeux1

1 Plateforme de Protéomique Paris Descartes (3P5), 22, rue méchain, 75014 Paris

Contact: Marjorie Leduc ([email protected])Keywords: Systems biology

La technique iTRAQ (ABSciex) est une méthode de quantification relative basée sur l’utilisation d’étiquettes isobariques. Ces étiquettes propres à chaque échantillon sont fixées sur les amines primaires des peptides après digestion trypsique et produisent des fragments spécifiques en MSMS (entre 113 et 121Da). L’intensité de ces fragments permet d’établir des ratios de protéines.Dans ce poster sont présentées les optimisations de fragmentation MSMS réalisées sur un sytème RSLC LTQ-Orbitrap-Velos (Thermo) pour l’analyse d’un protéome complexe marqué à l’iTRAQ préfractionné en Off-gel (Agilent). En effet, la fragmentation CID en LTQ ne permet pas de voir le signal des rapporteurs iTRAQ car leur faible masse les rend instables dans l’analyseur. Pour faire de la quantification, il faut utiliser un autre type de fragmentation, l’HCD. L’HCD peut aussi être utilisé pour obtenir des fragments participant à l’identification. Une énergie de collision plus forte peut être nécessaire pour l’obtention d’ion rapporteur suffisamment intense. Ainsi, 2 approches de fragmentations ont étés comparées d’abord une association fragmentation CID+HCD puis une association HCD basse et haute énergie de collision.Par ailleurs, la comparaison entre RSLC LTQ-Orbitrap-Velos et NanoLC MALDI-TOF-TOF 4800 (ABSciex) est basée sur les résultats d’identification et de quantification obtenu par ProteinPilot 4 (ABSciex). Enfin, l’analyse par spectrométrie de masse est étoffée par l’ajout de données bibliographiques grâce aux traitements Ingénuity et Pathway Studio des données qualitatives et quantitatives.

Link: http://3p5.medecine.univ-paris5.fr/


[P158] Impact métabolique de l’exposition de plusieurs cytochromes P450 à différents xénobiotiques par chromatographie liquide couplée à la spectrométrie de masse haute résolution

Mélaine Courcoul1, Isabelle De Waziers1, Marie Anne Loriot1, Hélène Gondelle1, Morgane Moulin1, Catherine Marchetti1, Alice Chort1, Sophie Ayciriex2, Olivier Laprevote2, Philippe Beaune1

1 Bases Moléculaires de la Réponse aux Xénobiotiques INSERM UMR-S 775, Centre universitaire des Saints Pères, 45 Rue des Saints Pères, 75006 Paris2 Laboratoire de Chimie-Toxicologie Analytique et Cellulaire, EA 4463, Faculté des sciences pharmaceutiques et biologiques, Université Paris Descartes, 4 Avenue de l'observatoire, 75006 Paris3 Laboratoire de Toxicologie Biologique, Hôpital Lariboisière, 2 rue Ambroise Paré, 75010 Paris4 Laboratoire de Biochimie, Pôle de Biologie Produits de Santé, Hôpital Européen Georges Pompidou, 20 Rue Leblanc, 75015 Paris

Contact: Mélaine Courcoul ([email protected])Keywords: High mass and high resolution mass Spectrometry, Méthodes d'analyse séparative, Organic and inorganic mass spectrometry

Les cytochromes P450 (CYPs) sont des enzymes monooxygénases responsables de la monooxygénation de xénobiotiques et de substrats endogènes (1). Actuellement, les études métabonomiques sont réalisées principalement sur des échantillons in vivo (tissus, bio-fluides) pour des applications diverses telles que le diagnostique et le suivi de maladies, ou pour identifier des biomarqueurs ou des mécanismes responsables de la toxicité de xénobiotiques (2).

Nous étudions l’influence de CYPs humains sur le métabolisme de composés endogènes et sur celui de xénobiotiques toxiques. Dans notre approche in vitro, nous utilisons des cellules de type HepG2 (issues d’un carcinome hépatique humain (3)) auxquelles nous faisons surexprimer différents CYPs. Ces cellules sont ensuite exposées à différents xénobiotiques. L’utilisation d’une telle approche in vitro permet d’observer les perturbations métaboliques dues à la surexpression d’un seul CYP et d’obtenir un système biologique simplifié.

Les études métabonomiques sur des cultures in vitro sont peu réalisées mais restent possibles grâce à la sensibilité apportée par la spectrométrie de masse. Dans cette étude, nous utilisons la chromatographie liquide (UPLC) couplée à un spectromètre de masse de type Q-Tof (Synapt G2 HDMS) associés à une préparation d’échantillons par extraction liquide-liquide afin de mettre en évidence les perturbations métaboliques. Nos observations portent autant au niveau des petites molécules polaires (acides aminés, acides organiques) que des lipides (acides gras, acides biliaires, hormones stéroïdiennes et stérols). Une analyse statistique multivariée des données LC-MS est ensuite réalisée afin d’identifier les biomarqueurs spécifiques de la surexpression des CYPs dans les cellules HepG2 ainsi que de l’exposition à des xénobiotiques.

Références:(1) : Guengerich P. Drug Metabolism Review (2004) 36, No. 2 , 159-197(2) : Masson P, Couto Alves A, Ebbels T, Nicholson J, Want E Analytical Chemistry (2010) 82, 7779-7786(3) : Aden DP, Fogel A, Plotkin S, Damjanov I, Knowles BB Nature (1979 dec 6) 282, 615-616


[P159] Signaling pathways activated by oncogenic mutations of the tyrosine phosphatase Shp2: Quantitative phosphoproteomics and functional analysis

Carine Froment1, Armelle Yart2, Karine Tréguer2, Mylène Tajan2, Odile Burlet-Schiltz1, Serge Roche3, Bernard Monsarrat1, Patrick Raynal4

1 Proteomics and Mass Spectrometry of Biomolecules, Institut de Pharmacologie et de Biologie Structurale, CNRS, Université de Toulouse, 205 route de Narbonne, F-31077 Toulouse, France2 INSERM UMR 1048, Université Toulous III, 1 avenue Jean Poulhès, F-31432 Toulouse, France3 CRBM, CNRS UMR5237 UM1 & 2, 1919 route de Mende, 34000 Montpellier, France4 EA4568, Université Toulouse III, CHU Purpan, 31059 Toulouse, France

Contact: Carine Froment ([email protected])Keywords: Signaling, interactomics and post-translational modifications, High mass and high resolution mass Spectrometry, Proteins, peptides and small molecules quantification

Mutations of the Shp2 tyrosine phosphatase give rise to leukemia and solid tumours, and to genetic syndromes - Noonan and LEOPARD - with increased cancer susceptibility, so that Shp2 has been recently defined as an authentic oncogene. However, the mechanisms driving its tumourigenic potential are largely unknown.

Shp2 is a ubiquitous protein tyrosine phosphatase (PTP) belonging to the Src Homology 2 domain-containing PTPs family. By dephosphorylating specific phosphotyrosine residues, PTPs play essential functions, as they regulate, negatively as well as positively, the signals emanating from tyrosine kinases-dependent membrane receptors (growth factors, cytokines, or hormones receptors, as well as G-protein coupled receptors). Previous reports have suggested that Shp2 could be involved in the Ras/Mitogen-Activated Protein Kinases (MAPK) and the phosphoinositide 3-kinase (PI3K) pathways, possibly through regulation of the Src Family Kinases (SFK). Thus, given the recent identification of these novel Shp2 targets, we aim at deciphering how oncogenic Shp2 mutants affect these signaling pathways and other actors of tumourigenesis.For this study, a series of cellular and molecular tools have been developed to analyse the impact of Shp2 oncogenic mutations notably patient cells (skin fibroblasts, blood cells) and adenovirus/lentivirus infected cells carrying Shp2 mutations. Taking advantage of these tools, we first intend to identify which substrates and more specifically which known or novel phosphotyrosine residues are differentially�dephosphorylated by oncogenic Shp2. To this aim, we chose to use a SILAC quantitative phosphoproteomic approach combining a 13C-tyrosine metabolic labeling and tyrosine phosphorylated peptides enrichment with phosphotyrosine-specific antibody.

Briefly, two populations of cell lines (patient versus healthy cells or adenovirus/lentivirus infected cells) were switched from growing in media containing normal tyrosine to media containing 13C9-tyrosine and both lysates were combined prior to trypsin digestion. Then, the peptides containing phosphotyrosine were isolated directly using the PhosphoscanTM Kit (Cell signaling Technology), identified by nanoLC-MS/MS on a LTQ Orbitrap Velos mass spectrometer using CID and HCD fragmentation modes and quantified using the in-house developed MFPaQ software.

Preliminary analyses of cells expressing or not Shp2 and stimulated by EGF allowed to identify and quantify about 300 phosphotyrosine peptides. Among them, 49 phosphotyrosine peptides were differentially phosphorylated. Importantly, almost all these tyrosine phosphorylated peptides belong to proteins involved in proliferation-promoting signaling pathway including potential Shp2 substrates or Shp2 downstream effectors.


[P160] Développement comparé de stratégies analytiques basées sur les couplages GC-MS/MS et LC-MS/MS pour la mesure du Bisphénol A dans les matrices alimentaires.

Yoann DECEUNINCK1, Zita ZENDONG1, Emmanuelle BICHON1, Jean-Philippe ANTIGNAC1, Bruno LE BIZEC1

1 LABERCA - ONIRIS, Route de Gachet, 44307 NANTES2 Université Nantes Angers Le Mans, , 3 INRA, , Nantes

Contact: Yoann DECEUNINCK ([email protected])Keywords: Proteins, peptides and small molecules quantification , Separative analysis methods

Le bisphénol A (BPA, 4,4’-dihydroxy-2,2-diphénylpropane) appartient à la famille des diphénylalcanes hydroxylés ou bisphénols. Le BPA est notamment utilisé comme monomère pour la fabrication industrielle par polymérisation de plastiques de type polycarbonate et de résine époxy. Largement présent dans notre environnement quotidien, ce composé fait l’objet d’une attention particulière et très actuelle de la part à la fois de la communauté scientifique et des agences en charge de l’évaluation du risque quand à ses effets sur la santé de l’Homme. Un manque de données est en particulier constaté quand à l’exposition et l’imprégnation des populations à ce composé. Dans ce contexte général, la spectrométrie de masse apparait comme la technique analytique de choix pour l’identification et la quantification du BPA dans les diverses denrées alimentaires. Le mode d’acquisition SRM (Selected Reaction Monitoring) est quant à lui le plus adapté à une mesure à la fois sensible et spécifique. Le comportement du BPA en termes de séparation chromatographique, d’ionisation, puis de schéma de fragmentation en MS/MS, a été étudié sur deux systèmes de type GC-(EI)-MS/MS et UHPLC-(ESI)-MS/MS. Les signaux diagnostiques (transitions SRM) spécifiques du BPA ont ainsi été déterminés pour les deux approches, et les conditions instrumentales (paramètres d’ionisation dans la source et de fragmentation dans la cellule de collision) ont été optimisées. La quantification du BPA a été assurée par dilution isotopique en utilisant le 13C-BPA comme étalon interne. Les deux stratégies ont enfin été comparées sur la base des limites de détection observées et du temps d’analyse. Parallèlement, un protocole de préparation des échantillons a été développé pour l’extraction et la purification du BPA à partir de diverses matrices alimentaires.Le couplage GC-MS/MS est finalement apparu comme la technique la plus sensible permettant ainsi une identification du BPA dans les différentes matrices alimentaires, à une concentration inférieure à 0,01 µg/kg. D’autre part, les résultats obtenus lors de la phase de validation de la méthode, en termes de reproductibilité et de justesse des résultats ainsi que la maîtrise de la contamination environnementale (matériaux et matériels) se sont avérés très satisfaisants et en adéquation avec les niveaux d’occurrence publiés dans la littérature, i.e. une limite de quantification inférieure à 0,1 µg/kg. Cette méthode a enfin été validée conformément aux référentiels en vigueur et s’accompagne d’un suivi continu des performances par l’intermédiaire de cartes de contrôle (maîtrise des paramètres de contamination analytique et de justesse). Applicable en l’état aux matrices alimentaires et donc à la génération de données d’exposition, cette stratégie est en voie d’être adaptée pour la mesure du BPA dans les fluides biologiques en vue de la génération de données d’imprégnation.


[P161] Caractérisation des glycosylations de l’invertase vacuolaire de raisin par combinaison de différentes stratégies de spectrométrie de masse

Agnès Hovasse1, Sandrine Jégou2, Tchilabalo Alayi1, Alexandra Conreux2, Sandra Villaume2, Alain Van Dorsselaer 1, Christine Schaeffer-Reiss1

1 Laboratoire de Spectrometrie de Masse Bio-Organique, DSA-IPHC, UMR 7178, 25 rue Becquerel, 67087 Strasbourg2 Laboratoire d’Oenologie et Chimie Appliquée, URVVC-SE UPRES EA 2069, Université de Reims Champagne-Ardenne, Moulin de la Housse, BP 1039, 51687 Reims Cedex 2

Contact: Agnès Hovasse ([email protected])Keywords: Signaling, interactomics and post-translational modifications

L’invertase vacuolaire de raisin est une enzyme clé du métabolisme des sucres du raisin impliquée dans l’hydrolyse du saccharose en glucose et fructose et est une des protéines majeures des vins de Champagne [1-2]. Cette glycoprotéine possède 12 séquences consensus de N-glycosylation dont seulement 2 sont actuellement décrites [3]. La caractérisation complète des glycosylations de l’invertase de raisin permettrait notamment de mieux comprendre leur impact sur sa stabilité, sa solubilité, son repliement, son activité biologique, sa résistance potentielle aux protéases et son rôle dans les propriétés moussantes des vins effervescents dont le Champagne.Nous avons donc réalisé une analyse structurale fine des sites de glycosylation et de leur micro-hétérogénéité en utilisant une combinaison de stratégies basées sur la spectrométrie de masse.Dans un premier temps, pour déterminer les sites de glycosylation, la protéine entière purifiée [4] a été déglycosylée par la PNGase A, puis digérée (trypsine et chymotrypsine en parallèle). Une déglycosylation a aussi été réalisée sur la protéine préalablement digérée à la trypsine. L’analyse de ces 3 digests par nanoLC-MS/MS a mis en évidence la présence de 9 Asn déamidées en Asp en positions 108, 225, 277, 289, 430, 450, 499, 621 et 626.Dans un deuxième temps, pour caractériser la micro-hétérogénéité de ces sites, l’invertase a été digérée par 3 enzymes (trypsine, chymotrypsine et GluC en parallèle), et les digests enrichis en glycopeptides (phase ZIC-HILIC). Une première analyse des 3 digests par nanoLC-MS (Q-TOF maXis), avec recherche des ions dits «diagnostiques» issus de la fragmentation spécifique des glycanes, a permis de localiser dans les chromatogrammes les glycopeptides et de donner une image de leur micro-hétérogénéité. Une deuxième analyse par nanoLC-MS/MS a permis d’identifier les glycoformes présentes sur 5 sites de glycosylation, de déterminer la masse de la partie peptidique correspondante pour chacun d’eux et donc de les identifier. Cette stratégie a permis de caractériser la micro-hétérogénéité (jusqu’à 11 glycoformes) pour 5 sites de glycosylation en positions 158, 212, 430, 450, 485. Les glycosylations observées sont de type complexe ; la majorité porte un fucose en alpha 1-3 sur le GlcNAc proximal ainsi qu’un xylose.En conclusion, nous avons identifié la totalité des 12 sites potentiels de l’invertase vacuolaire de raisin, et caractérisé la micro-hétérogénéité de 5 de ces sites. Ce fort taux de glycosylation permettra de mieux comprendre l’impact des glycosylations de l’invertase sur les propriétés moussantes des vins effervescents, et sur les caractéristiques biochimiques de cette protéine.

1. Cilindre C., et al., J Proteome Res 2008, 7. 1199-2082. Dambrouck T., et al., J Agric Food Chem 2005, 53. 8782-93. Palmisano G., et al., J Proteome Res 2010, 9. 6148-594. Jégou S., et al., Anal Chim Acta 2009, 638. 75-8

Mots clés : Signalisation, complexes et modifications post-traductionnelles


[P162] Quantification of homologous proteins in yeast protein fractions that modulate the assembly of the yeast prion Sup35p

Virginie Redeker1, Chris Hughes2, Jimmy Savistchenko1, Johannes P.C. Vissers2, Ronald Melki1

1 Laboratoire d’Enzymologie et Biochimie Structurales, CNRS, 1 avenue de la terrasse, 91190 Gif-sur-Yvette, France2 Waters Corporation, Atlas Park, Simonsway, M22 5PP Manchester, UK

Contact: Virginie Redeker ([email protected])Keywords: Proteins, peptides and small molecules quantification

The aggregation of the baker’s yeast prion Sup35p is at the origin of the transmissible [PSI+] trait. We designed a functional proteomic study that combines two techniques to identify modulators of Sup35p aggregation and describe the changes associated to [PSI+] formation. The first allows measuring the effect of fractionated Saccharomyces cerevisiae cytosolic extracts from [PSI+] and [psi-] yeast cells on Sup35p assembly. The second is a multiplex qualitative and quantitative comparison of protein composition of active and inactive fractions using a gel free and label-free LC-MS approach. We identify changes in proteins involved in translation, folding, degradation, oxido-reduction and metabolic processes. We and others have shown previously that molecular chaperones modulate Sup35p aggregation (1). Interestingly, in this study, we identify and quantify nineteen proteins involved in protein folding.

Among the identified proteins, we find a number of homologous proteins. In order to quantitatively assess individual protein paralogs, we processed manually the data. When isoform specific peptide sequences were detected a quantification of protein isoforms was carried out. Otherwise, the different isoforms were grouped in homology protein group and an absolute amount assigned to the group as a whole. The isoform processing methodology used to quantify a number of protein homologs, and in particular some chaperone protein isoforms, will be presented.

Our functional proteomic study provides the first inventory list of over 300 proteins, including 19 chaperon proteins, that directly or indirectly affect Sup35p aggregation and [PSI+] formation. Our results pave the way for in vitro studies aimed to document the effect of individual and/or combinations of proteins identified in this study, susceptible of affecting Sup35p assembly.

(1) Krzewska J, Melki R., EMBO J. 2006, 25: 822-833


[P163] Microenvironnement et cancer du sein : analyse protéomique du sécrétome d’adipocytes cocultivés en présence de cellules tumorales

Karima Chaoui1, Victor Laurent1, Béatrice Dirat1, Philippe Valet1, Catherine Muller1, Bernard Monsarrat1, Odile Burlet-Schiltz1

1 Institut de Pharmacologie et de Biologie Structurale, CNRS, 205 route de Narbonne, 31400 Toulouse Cedex, France2 Institut des Maladies Métaboliques et Cardiovasculaires, Inserm, CHU Rangueil, BP 84225, Avenue Jean Poulhès , 31062 Toulouse cedex 4, France

Contact: Karima Chaoui ([email protected])Keywords: Proteins, peptides and small molecules quantification , Systems biology

Les adipocytes demeurent peu étudiés en dépit du fait qu’ils représentent le type cellulaire prédominant du microenvironnement du cancer du sein. Pourtant, des études épidémiologiques ont montré que l’obésité dans le cancer du sein pouvait être associée à un mauvais pronostic avec des tumeurs plus agressives définies par un stade avancé et une propension plus élevée à donner des métastases.Des résultats récemment publiés ont montré que la coculture (2D) de cellules tumorales avec des adipocytes contribue à augmenter les capacités invasives des cellules tumorales in vitro et in vivo. Ces résultats laissent à penser qu’un cross-talk existe entre les deux populations cellulaires et que la population des adipocytes participe à la progression tumorale (1). L’objectif de cette étude a donc été d’identifier les protéines adipocytaires dont l’expression est modulée par la coculture avec des cellules tumorales du sein afin de comprendre les mécanismes mis en jeu.Dans ce but, nous avons réalisé une analyse protéomique quantitative différentielle de type label free (2) des sécrétomes d’adipocytes F442A (d’origine murine) cocultivés durant 3 jours avec des cellules ZR (cellules tumorales du sein humaines) versus un pool de sécrétomes d’adipocytes et de cellules ZR non cocultivés. Ces deux sécrétomes ont été fractionnés sur un gel SDS-PAGE et chacune des deux pistes a été découpée de façon systématique. Les bandes obtenues ont été analysées sur un appareil de type LTQ-Orbitrap XL, dont la haute résolution et la vitesse de séquençage permettent l’analyse optimale des mélanges complexes.Cette analyse différentielle a été réalisée sur trois réplicats d’échantillons biologiques et nous a permis de quantifier plus de 2700 protéines et d’observer plus de 200 protéines variantes entre les deux sécrétomes.A titre d’exemple, ces analyses ont ainsi permis d’identifier diverses chimiokines dont l’expression est fortement diminuée par la coculture avec les cellules tumorales. Les chimiokines sont des protéines capables de stimuler la migration de certaines cellules tumorales via la formation d’un gradient de chimiokine ; la migration se faisant de faible vers de fortes concentrations en chimiokines. Cette régulation négative des chimiokines adipocytaires en coculture pourrait correspondre à une diminution de l’expression au niveau du front invasif, favorisant ainsi la formation du gradient et donc la migration.Enfin il est à noter que la diminution d’expression de ces chimiokines en coculture a été validée par la suite par PCR quantitative.

(1) Dirat B et al, Cancer-associated adipocytes exhibit an activated phenotype and contribute to breast cancer invasion, Cancer Res, 2011, 71(7):2455-65.(2) Mouton-Barbosa E et al, In-depth exploration of cerebrospinal fluid by combining peptide ligand library treatment and label-free protein quantification, MCP, 2010, 9(5):1006-21.


[P164] The secretome of Botrytis cinerea : adaptation to environmental pH

Cindy Dieryckx1, Vincent Girard1, Semcheddine Cherrad1, Dominique Job1, Claudette Job1, Christine Rascle 1, Nathalie Poussereau 1

1 Joint laboratory, University of Lyon1- CNRS UMR5240-Bayer S.A.S., 14-20 rue Pierre Baizet, 69009 lyon

Contact: Vincent Girard ([email protected])Keywords: Separative analysis methods

Micro-organisms must adapt to environmental change to survive, and this is particularly true for fungal pathogens such as Botrytis cinerea. B. cinerea is found both in the environment and in diverse plant hosts. Their ambient pHs varie considerably, and therefore we have examined the response of B. cinerea to changes in ambient pH using a proteomic approach.The expression of secreted proteins induced by controlled growth conditions, i.e. complete synthetic medium at pH 5.0, was identified by two-dimensional gel electrophoresis and image analysis software. All reproducible and statistically significant spots were identified by peptide mass fingerprinting, thereby extending our 2-DE map of the Botrytis cinerea to a total of 257 identified proteins. Proteins expressed in B. cinerea cells growing at pH 5.0 or 7.0 were compared by 2-DE. Qualitative and quantitative differences were observed related to the protein patterns whereas at both pH (5.0 and 7.0). Furthermore, characterization of a strain of B. cinerea deleted transcription factor Pacc will clarify the role of the signaling pathway Pal/Pac on the establishment of the secretome of the fungus in both pH.Discussion will be done on the possible factors regulating secreted protein expression by the pH in Botrytis. In addition, our data suggested that different fungal proteins could be involved in the infection process depending on the external pH.


[P165] ISO 9001, un outil adapté et accessible pour l’organisation et la gestion des plateformes et des équipes scientifiques associées

Renaud Albigot1, Stéphane Libat1, Carole Pichereaux1, Marie-Pierre Dubrulle2, Odile Schiltz1, Bernard Monsarrat1

1 Institut de Pharmacologie et de Biologie Structurale, CNRS UMR 5089, Université de Toulouse, 205 Route de Narbonne, 31077 Toulouse, France2 GIS IBiSA, 147 rue de l'Université, 75338 Paris, France

Contact: Renaud Albigot ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics

Qu’il s’agisse des plateformes ou des équipes de recherche, le besoin de répondre dans des délais contrôlés aux demandes de prestation ou de collaboration scientifique, la nécessité de consolider la qualité des expertises réalisées grâce à la gestion des compétences du personnel ainsi que la maîtrise de l’ensemble du parc instrumental, laisse clairement apparaître la nécessité d’encadrer l’activité par la mise en place d’une démarche qualité permettant de répondre à ces besoins d’une manière parfaitement structurée. Cela répond également à des enjeux :- Scientifiques : une organisation optimisée permet de maîtriser les coûts, la gestion des ressources humaines, mais aussi la fiabilité et la diffusion de l’information (résultats expérimentaux, publications, brevets) ;- Financiers : l’implication dans une démarche qualité favorise l’allocation de fonds car elle garantit les meilleures conditions de production scientifique et la capacité à gérer les ressources allouées.En nous appuyant sur l’exemple d’un système qualité mis en place au sein de l’Infrastructure Protéomique de Toulouse depuis 2006, nous illustrons l’impact du référentiel ISO 9001. Impact pour la direction, dans sa gestion quotidienne de ces structures, impact pour le personnel dans son activité journalière et enfin, impact pour les collaborateurs et les clients dans l’utilisation de nos infrastructures et de nos résultats.Ces éléments laissent apparaître que le référentiel ISO 9001, loin de son image d’ « usine à gaz » « paperassière », s’avère un outil d’organisation d’une grande souplesse, d’une mise en œuvre relativement simple et largement compatible avec les spécificités des plateformes technologiques et des équipes de recherche.

Link: http://proteomique.ipbs.fr


[P166] Diurnal metabolite changes of red ripe tomato fruit and mature leaf using mass spectrometry methodologies

Stéphane Bernillon1, Camille Bénard2, Mickaël Maucourt3, Benoit Biais1, Sonia Osorio-Algar, Alisdair Fernie5, Emilie Labadie-Lemière1, Patricia Ballias, Catherine Deborde, Annick Moing 1, Cécile Cabasson, Dominique Rolin3, Michel Génard, Hélène Gautier2, Yves Gibon1

1 INRA, UMR1332, Biologie du Fruit et Pathologie, 71 Avenue Edouard Bourlaux, 33140 Villenave d'Ornon, France2 INRA UR1115 Plantes et Systèmes de culture Horticoles, Domaine St Paul, Site Agroparc, 84914 Avignon, France3 Université de Bordeaux, UMR 1332, Biologie du Fruit et Pathologie, 71 Avenue Edouard Bourlaux, 33140 Villenave d'Ornon, France4 Plateforme Métabolome du Centre de Génomique Fonctionnelle Bordeaux, IBVM, Centre INRA Bordeaux, 71 av Edouard Bourlaux, 33140 Villenave d'Ornon, France5 Max-Planck-Institut of Molecular Plant Physiology, Am Mühlenberg 1, 14476 Golm-Potsdam, Germany

Contact: Stéphane Bernillon ([email protected])Keywords: Systems biology

The Fruit Integrative Modelling project is an Eranet EraSysBio+ project, which aims at describing and modelling the influence of environmental and metabolic variables on the quality of tomato fruits (Solanum lycopersicum cv Money Maker). The present study focused on the importance of diurnal changes in the metabolome of tomato fruits and leaves. For this, red ripe fruits and their closest leaf were harvested at the end of the night, at midday and at the end of the day and analyses of pericarp and foliar limb tissues were performed on water/methanol/chloroform extracts using GC/EI-ToF-MS after derivatization, and on methanol/water extracts using LC/ESI-QToF-MS. Identity of metabolites was assigned by comparison with a database for GC/MS data, and by accurate masses, diagnostic fragments and literature for LC/MS data. Metabolite levels were estimated and normalised relatively to a biological standard. A multivariate analysis revealed that the metabolome of red ripe fruits undergoes subtle changes throughout a day and night cycle. Several metabolites were then found to change significantly during the day, but with very low amplitude. In contrast and as expected, metabolite fluctuations were of much larger amplitude in leaves. The next step of this study will be to investigate the metabolism of the fruit at green stages throughout the same diurnal cycle.


[P167] Proteomic analysis of S-nitrosylation induced by the lipid A analogue, OM-174

Myriam Lamrani1, Géraldine Lucchi2, Patrick Ducoroy2, Jean-François Jeannin1, Ali Bettaieb1

1 Laboratoire d’Immunologie et Immunothérapie des cancers – INSERM U866 - Faculté de Médecine, 7 Boulevard Jeanne d’Arc, 21000 Dijon2 CLIPP IFR100 CHU Université de Bourgogne, 1 rue du Professeur Marion, 21000 Dijon

Contact: Patrick Ducoroy ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Background: The antitumor efficacy of a lipid A analogue (OM-174) was demonstrated, an effect that requires the expression of NOS II and the production of nitric oxide (NO) by tumor cells. Recent studies show that NO can react with cysteine residues target proteins to form S-nitrosothiols (SNOS), a process called S-nitrosylation, thereby altering protein function (inhibition, activation). Methods: To characterize the profil of S-nitrosylated proteins, murine mammary cancer cells EMT-6H were treated or not by OM-174 combined with IFN gamma (a cytotoxic combination). S-nitrosylated proteins were detected by the method of Biotin Switch Assay (BSA). This method involves replacing the S-NO bond cysteines of target proteins by S-biotin bonds, followed by purification on a streptavidin column. The biotinylated proteins (S-nitrosylated) are then reduced, alkylated and digested by trypsin. After purification and concentration of generated peptides for each sample, they are separated by nanochromatography column liquid C18. The 140 fractions generated are analyzed by MALDI mass spectrometry in MS and MS/MS. Results: Sixteen specific proteins in the EMT-6H stimulated by OM-174/IFN gamma combination sample are identified. We are interested in three proteins: both involved in cell survival (nucleophosmin and ubiquitin conjugating enzyme UBC13) and one involved in the anti-tumor immune system activation (ERp57). We confirmed their S-nitrosylation by BSA and a Western Blot. Conclusion: The role of S-nitrosylation in the anti-tumor efficacy of OM-174 on EMT-6H cells remains to be evaluated. The cDNA construct encoding mutated forms of the proteins of interest, on their S-nitrosylated cysteines, will determine the role of these changes. This work should allow the identification of new proteins targets of NO. Their S-nitrosylation may affect their functions leading to lipid A antitumor effect of breast cancer cells.

Link: www.clipproteomic.fr


[P168] Nanostructured materials for the phosphoproteome profiling with mass spectrometry

Géraldine Lucchi1, Nicolas Martin2, Joseph Gavoille2, Patrick Ducoroy1, Wilfrid Boireau2

1 CLIPP CHU IFR100 Université de Bourgogne, 1 rue du Professeur Marion, 21000 Dijon2 FEMTO-ST MN2S Université de Franche Comté, 32 rue de l'Observatoire, 25000 Besançon

Contact: Wilfrid Boireau ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Background: Phosphorylation plays a pivotal role in the regulation of many biological processes and its dysregulation has been found to be the underlying basis of many human diseases[1]. Moreover, phosphoproteins could be cancer markers useful for diagnostics and cancers fingerprinting [2,3].Mass spectrometry (MS) is the method of choice for the analysis of protein phosphorylation because of its sensitivity, speed, and simplicity [3,4]. However, MS analysis of phosphorylation on a proteome-wide scale remains a major challenge due to many limitations (low abundance & stoichiometry and high dynamic nature of protein phosphorylations) [4, 5].Methods: Procedures of enrichment of phosphopeptides prior MS analysis are crucial and could be based on metal oxide affinity chromatography (MOAC)[5]. On the other side, during the last decade, the notion of Surface-Assisted Laser Desorption/Ionization (SALDI-MS) appears because the surface structure was critical to obtain mass spectra without chemical matrixes. Research studies on TiO2 based materials are very active and a recent publication has pointed out the potential of Titania substrates in this field [6].Results: Here, we present the influence of nanostructuration of titania substrates on the phosphopeptides enrichments and SALDI-MS analysis. The optimization of the fabrication of nanostructured titania substrates and the establishment of protocols to promote the on-chip selection of phosphopeptides have allow to detect 3 multi and 4 monophosphopeptides after deposition and treatment of 25 fmoles of alpha-casein digest. Moreover, we have demonstrated the ability of rutile structure to ionize and desorb peptides in SALDI experiments. By this way, BSA has been identified in MS and MS2 modes at fmole level.Conclusion: For the first time, we demonstrated the powerful SALDI and chromatographic properties of rutile among titania substrates for phosphoproteomic studies.References:1) Nita-Lazar et al.. Proteomics 2008, 8, 4433–432) Lim YP.; et al., Clin Cancer Research 2004; 10, 3980-73) Thingholm T. E, et al., Proteomics 2009, 9, 1451– 684) Steen J. A. J.; et al., Proc. Natl. Acad. Sci. U.S.A. 2008, 105, 6069–745) Bodenmiller B.; et al., Nat. Methods 2007, 4, 231–2376) Bi H. Y., et al. Anal Chem 2009, 81, 1177-83



[P169] Discrimination between Arabica and Robusta coffee species based on their peptide/protein profiles using ClinProTools approach

Laure F. Marvin-Guy1, Justine Yerly1, Philippe Montavon1, Helia Dias Abelairas1, Dominique Piguet1, Young Joo Chung1, Irma Silva Zollezzi1

1 Nestlé Research Center, Vers-chez-les-Blanc, 1000 Lausanne 26, Switzerland

Contact: Laure F. Marvin-Guy ([email protected])Keywords: Proteins, peptides and small molecules quantification

Coffee is the most traded food commodity. The two commercially relevant coffee species are Arabica and Robusta. In the cup, they strongly differ by their sensory profiles, Arabicas providing the highest quality blends and being more expensive than Robustas. Hence, tools to evaluate the purity of Arabica blends are of commercial importance. Furthermore, green and roasted coffee blends appear on the market. The identification of coffee proteins in these mixtures might be required to solve quality issues.Here we show that coffee protein extracts, produced from commercial Arabica and Robusta green coffee, can be clearly ascribed to their original source by using Matrix-Assisted Laser Desorption/Ionization time-of-flight mass spectrometry (MALDI-TOF-MS) and data analysis with ClinProTools. This commercially available software allows the visualization of peptide/protein profiles and comparison of datasets with powerful bioinformatic tools. Multivariate analyses applied to our MALDI-TOF-MS data demonstrated strong discrimination power between the two coffee species, which should lead to the discovery of valuable biological markers to evaluate purity and origin of coffee blends. This technique is less time-consuming, more specific and sensitive, and cheaper than other proteomic techniques like e.g. gel electrophoresis.


[P170] Etude de complexes Cyclodextrine-Gadolinium par ESI-MS

Marie Hubert-Roux1, Ibrahim Zgani1, Hussein Idriss1, François Estour1, Géraldine Gouhier1, Catherine Lange1

1 CNRS UMR 6014, Université de Rouen, Rue tesnières, 76821 Mont-Saint-Aignan, France

Contact: Marie Hubert-Roux ([email protected])Keywords: Organic and inorganic mass spectrometry

Dans le cadre de la recherche actuelle en IRM, et plus spécifiquement de la mise au point d’une imagerie à l’échelle moléculaire, de nouveaux agents de contrastes (AC) dits « intelligents » (ou sondes bimodales) sont développés pour permettre de détecter et de quantifier in vivo les phénomènes biologiques extra-cellulaires. L’agent de contraste choisi est le Gadolinium III (Gd III) lié à une β-Cyclodextrine (CD). En effet, il avait été montré que les CD étaient des agents prometteurs pour la vectorisation in vivo des complexes avec le Gd, permettant d’augmenter la valeur de la relaxation des protons de l’eau et par conséquent l’activité en terme d’imagerie médicale [1,2,3].La première étape de synthèse de ces nouvelles sondes a consisté à greffer sur la β-Cyclodextrine 7 ligands acétate pouvant coordiner le Gd.

Ce complexe CD/Gd a été caractérisé par Spectrométrie de Masse sous ionisation Electrospray (ESI) en mode de détection négatif. Certains paramètres source de tension, température et pression ont été ajustés afin d’optimiser le signal des espèces multichargées du complexe. Puis, des échantillons de rapports molaires CD/Gd différents ont été analysés par cette technique afin de déterminer la stoechiométrie des complexes formés.

[1] S. Aime, M. Botta, F. Fedeli, E. Gianolio, E. Terreno, P. Anelli, Chem. Eur. J., 2001, 7, 5261-69.[2] S. Aime, E. Gianolio, E. Terreno, I. Menegotto, C. Braco, L. Milon, G. Cravotto, Magn. Res. Chem., 2003, 41, 800-805.[3] S. Aime, E. Gianolio, E. Terreno, F. Uggeri, S. Tagliapietra, A. Barge, G. Cravotto, J. Inorg. Biochem., 2006, 100, 931-938.


[P171] Identification of the species of animal glues found in artwork by proteomics

Sophie Dallongeville1, Olga Plechakova1, Nicolas Garnier2, Geneviève Reille-Taillefert3, Caroline Tokarski1, Christian Rolando1

1 USR CNRS 3290 Miniaturisation pour l'Analyse, la Synthèse & la Protéomique (MSAP), Université Lille 1, Cité Scientifique Bat C4, 59655 Villeneuve d'ascq cedex2 SARL Laboratoire Nicolas Garnier, , 63270 Vic Le Comte3 A.R.T SA (Atelier de Restauration Taillefert) , 37, rue de Gruenewald, Luxembourg

Contact: Caroline Tokarski ([email protected])Keywords: High mass and high resolution mass Spectrometry, Bioinformatics et biostatistics dedicated to proteomics

Over the past centuries, artists have tried out various organic compounds as binding media to develop their paint recipes. Among these substances, animal glues have been used not only as binders for pigments but also in mixtures with chalk for the preparation of ground in canvas paintings, as adhesives or for gilding. Traditionally animal glues are made by boiling skin or bones of mammals or by boiling sturgeon bladders for fish glue. Different methods have been proposed to identify proteinaceous binders and discrimination between animal glues and egg or milk is easily achieved. Nevertheless, the identification of the origin of the animal glue is still a challenging task. In this study, we propose to identify proteins in animal glue samples and to achieve animal species differentiation on the basis of species-specific peptides. The methodology, based on an adapted proteomics approach including high resolution analysis using nanoLC-nanoESI-Qh-FT-ICR MS/MS was first evaluated on commercially available samples of animal glues from different origins in order to create a database of peptides specific of the different species of interest (i.e. bovine, rabbit and fish). In order to identify peptides specific of a species, homemade software based on Biopython was developed. The specific peptides identified were checked by performing a blast within the ncbi database. As result, up to 15 specific peptides were identified for the bovine glue, including 2 different collagen proteins. Concerning rabbit skin glue, 3 specific peptides corresponding to one rabbit collagen protein were found and in the case of sturgeon glue, 3 fish-specific peptides were identified by sequence homology with the rainbow trout. The methodology was then applied to authenticate different rabbit skin glue samples, including a 60 years old sample coming from «Maison Totin-Frères,» one of the most famous French manufacturers of rabbit skin glue. The analysis was performed on hundreds micrograms of painting and, for example, 8 bovine-specific peptides were found for the model painting, made according to old recipes, during this work with cow hide glue as binder. Finally, the methodology was applied on a gilt sample coming from the St Maximin church, located in Thionville. Bovine collagens α1 and α2 type I, bovine collagen α1 type II and bovine collagen α1 type III were identified. More interestingly, 4 specific peptides of bovine collagen α1 type I were found. For example, the sequence GEPGPAGLPGPPGER, specific to bovine collagen α1 type I (472-486) was identified by MS/MS using the complete set of y1+ to y13+ ions. 8 specific peptides were identified for collagen α2 type I, including for example the sequence IGQPGAVGPAGIR (1066-1078) and only one specific peptide for collagen α1 type III. These results prove that animal glue from bovine origin was used for the making of this gilt.


[P172] Caractérisation de la machinerie multiprotéique impliquée dans l’Architecture de l’ADN Transformasome chez S. pneumoniae : mise en œuvre d’approches conjuguées de type Tap-Tag et de Protéomique Quantitative en Label Free.

Audrey Olivier2, Alexandre Stella1, Jean-Pierre Claverys2, Patrice Polard2, Odile Burlet-Schiltz1, Bernard Monsarrat1

1 Plateforme Protéomique Toulouse Midi-Pyrénées, Institut de Pharmacologie et de Biologie Structurale, CNRS UMR5089, Université de Toulouse, 205, route de Narbonne, 31077 Toulouse, France2 Equipe ‘Transformation du Pneumocoque’, Laboratoire de Microbiologie et Génétique Moléculaires, Université de Toulouse, CNRS, 118, route de Narbonne , 31062 Toulouse, France

Contact: Alexandre Stella ([email protected])Keywords: Proteins, peptides and small molecules quantification , Signaling, interactomics and post-translational modifications

La transformation génétique est un processus de transfert horizontal de gènes caractéristique du monde bactérien. Elle se déroule en trois étapes distinctes : (i) la capture d’ADN double-brin présent dans le milieu extérieur ; (ii) l’internalisation d’un brin d’ADN dans la cellule, couplée à la dégradation de son brin complémentaire ; (iii) l’intégration par recombinaison homologue de l’ADN simple-brin (ADNsb) internalisé.Une machinerie multiprotéique spécialisée, le transformasome est en charge du transport de l’ADN et de son intégration dans le génome. La protéine RecA, catalyseur de la recherche d’homologie et de l’échange des brins d’ADN homologues, est une pièce centrale de cet appareil spécialisé de recombinaison d’ADN. Elle est assistée par plusieurs protéines spécifiques du transformasome. Chez la bactérie Streptococcus pneumoniae, l’un de ces effecteurs est la protéine de liaison à l’ADNsb : SsbB, dont l’un des rôles est de lier et protéger l’ADNsb internalisé. SsbB est un paralogue de la protéine SsbA, universellement conservée chez les bactéries et impliquée dans la plupart des mécanismes de maintenance de l’intégrité du génome. En plus de son activité de liaison à l’ADNsb, SsbA agit dans ces processus comme plateforme d’interaction pour plusieurs protéines des appareillages de la dynamique de l’ADN génomique (1, 2).Afin de comprendre l’architecture du transformasome, et plus précisément d’identifier le réseau d’interaction spécifique entretenu autour de SsbB, nous avons engagé l’étude de son interactome en parallèle de celui de SsbA. Pour cela nous avons adapté la méthodologie de capture de complexes protéiques du Tap-Tag à S. pneumoniae afin d’extraire sélectivement SsbB ou SsbA en association avec leurs partenaires en condition native. Dans une première étape nous avons identifié par couplage nanoHPLC-MS/MS Orbitrap Velos l’ensemble des protéines représentatives de ces complexes. Dans une deuxième étape, nous avons ensuite analysé la dynamique de ces complexes en présence d’ADN transformant. Cette analyse différentielle des protéines partenaires a été réalisée par des approches quantitatives label-free en utilisant le logiciel MFPaQ v4 (3).

1. Coste et al., PloS Genetics, 20102. Lecointe et al., EMBO J. 20073. Mouton-Barbosa et al., MCP, 2010


[P173] LC-MS/MS based urinary proteome analysis of obstructive nephropathy

Chrystelle Lacroix1, Cécile Caubet2, David Bouyssié1, Caroline Le Gall3, Benjamin Breuil2, Anne Gonzalez de Peredo1, Jean-Loup Bascands2, Bernard Monsarrat1, Joost Peter Schanstra2, Odile Burlet-Schiltz1

1 Laboratoire "Protéomique et spectrométrie de masse des biomolécules", IPBS, CNRS UMR 5089, Université de Toulouse, 205 Route de Narbonne, 31077 Toulouse, France2 Laboratoire "Fibrose rénale - mécanismes et détection", I2MC, INSERM UMR1048, Université de Toulouse, CHU Rangueil -BP 84225 Institut Louis Bugnard, Bâtiment L4 Avenue Jean Poulhès , 31432 Toulouse, France3 Equipe de Statistique et Probabilités, Institut de Mathématiques, CNRS UMR 5219, Université de Toulouse , 118 route de Narbonne , 31062 Toulouse, France

Contact: Chrystelle Lacroix ([email protected])Keywords: Clinical proteomics, Proteins, peptides and small molecules quantification , Bioinformatics et biostatistics dedicated to proteomics

Dr Schanstra’s group has previously shown that urinary peptidome analysis by capillary electrophoresis coupled to mass spectrometry allows early prediction of obstructive nephropathy (ON) in newborns. Although these urinary peptidome biomarkers are of great potential clinical value, they are currently less informative on the pathophysiology of the disease. Therefore we decided to focus on the changes in the urinary proteome of ON patients using label-free LC-MS/MS and antibody-array analyses. Here, we present primarily the label-free proteomic quantitative analysis. Urine samples from patients (n=5/group) were divided into 4 groups: bladder urine from controls (healthy), mild ON (NoOp), severe ON (Op) and pelvis urine from severe ON (Pyelon). 2-15 mL urine samples were concentrated and processed using the FASP based method (Wisniewski et al., Nat Methods, 2009). 30 µg of protein was digested by trypsin. Peptide mixtures were then acidified and analysed 3 times (~4 µg per injection) by online capillary LC-MS/MS (Ultimate 3000 Dionex system coupled to a LTQ-Orbitrap-VELOS). Proteins were identified by MS/MS database search using Mascot and validation of identification results was performed with the MFPaQ v4 software (Bouyssié et al., MCP, 2007). Protein quantification was carried out with the label-free quantitative module of MFPaQ (Mouton-Barbosa et al., MCP, 2010). This module uses an identity-based method in which the precursor ion m/z and retention time of each identified peptide are retrieved from MS/MS database search result files, and used as a starting coordinate to extract the peptide elution peak intensity in the MS survey scans, allowing to perform peak detection in a robust and accurate way. Protein abundance was estimated by computing the sum of related peptides intensities. Such abundances were then normalized using the Probabilistic Quotient Normalization method (Dieterle et al, Anal Chem, 2006). Statistical analysis by Student t-test (corrected using Benjamini Hochberg adjustment for multiple testing) was performed to detect significant changes between two groups. Based on these comparisons we established a list of proteins that are specific for the obstructed or controlateral kidney. We are currently in the process of independent validation of a subset of these proteins. Two different approaches for validation are used: antibody-based validation (immunoblotting and ELISA) and multiple reaction monitoring on small (max 1.5 ml) urine samples to increase patient numbers during validation. The progress of this ongoing project will be shown.


[P174] Impacts de la variation génétique naturelle du protéome de Saccharomyces cerevisiae et S. bayanus var. uvarum sur les principales voies métaboliques

Mélisande Blein-Nicolas1, Warren Albertin1, Benoît Valot1, Philippe Marullo2, Hao Xu4, Sylvie Huet4, Christophe Giraud5, Delphine Sicard1, Dominique de Vienne1, Michel Zivy1

1 UMR 0320 / UMR 8120 / PAPPSO Génétique Végétale, Ferme du Moulon, 91190 Gif sur Yvette2 Université Bordeaux 2, ISVV, USC Œnologie, 210 chemin de Leysotte, 33882 Villenave d’Ornon3 SARCO/LAFFORT Group, 7 rue Franc Sanson, 33370 Floirac4 UMR MIA, Domaine de Vilvert, 78352 Jouy-en-Josas5 UMR CNRS 7641, Ecole Polytechnique, Route de Saclay, 91128 Palaiseau

Contact: Mélisande Blein-Nicolas ([email protected])Keywords: Systems biology, Proteins, peptides and small molecules quantification

Saccharomyces cerevisiae et S. bayanus var. uvarum sont deux espèces de levure adaptées à la fermentation alcoolique et dont l'utilisation en oenologie fait l'objet de nombreux développements industriels. Afin d'analyser la variabilité génétique naturelle des abondances des protéines de ces deux espèces, nous avons sélectionné 9 souches de S. cerevisiae et 6 souches de S. bayanus var uvarum isolées sur des substrats différents et dans des zones géographiques diverses, et les avons mises en culture anaérobie dans du jus de raisin à 18°C. Après prélèvement en phase stationnaire (3 réplicats indépendants par souche), le protéome a été analysé par LC-MS/MS et quantification sans marquage (logiciel MassChroQ1). Les bases de données de séquence des deux espèces ont été utilisées pour l'identification des protéines.Nous nous sommes tout d'abord intéressés aux 3713 peptides présentant des variations qualitatives. Après avoir éliminé les peptides de moindre abondance, nous avons isolé 2399 peptides correspondant potentiellement à des SAP (Single Amino-acid Substitution) qui nous ont permis d'obtenir une représentation de la variabilité génétique des souches. Nous avons ensuite estimé les abondances de 622 protéines à partir de 5858 peptides répétables par une approche bayésienne permettant d'inclure l'information portée par les peptides communs à plusieurs protéines. Au total, 382 protéines présentaient une variation génétique significative entre au moins deux souches, avec ratio d'abondance s'étendant entre 1.3 et 356. L'analyse des voies métaboliques auxquelles ces protéines appartiennent a permis de mettre en évidence i. des divergences entre espèces concernant notamment les protéines de la fermentation ainsi que les protéines catalysant une même réaction. Ces divergences n'ont pas d'impact global sur la capacité fermentaire des deux espèces; ii. des divergences entre souches de S. cerevisiae qui permettent de faire des hypothèses sur les causes de leurs variations de capacité fermentaire. Certaines des souches de S. cerevisiae présentant une mauvaise capacité fermentaire sont en effet caractérisées par un niveau élevé de protéines impliquées dans le métabolisme énergétique et la réponse aux stress et des protéines du métabolisme des acides aminés en moindre abondance. Globalement, l'ensemble de ces résultats suggère que S. cerevisiae et S. bayanus var. uvarum se sont adaptées aux conditions de fermentation alcoolique par des métabolismes différents.


[P175] Exploration du surfaceome de Listeria monocytogenes

Marie LAURIER1, Christophe CHAMBON2, Didier VIALA2, Mickaël DESVAUX1, Michel HEBRAUD1

1 UR454 Microbiologie, Equipe QuaSA, INRA de Clermont-Ferrand, site de Theix, 63122 Saint-Genès Champanelle2 Plate-Forme d’Exploration du Métabolisme composante protéomique, INRA de Clermont-Ferrand, site de Theix, 63122 Saint-Genès Champanelle

Contact: Michel HEBRAUD ([email protected])Keywords: Systems biology

Listeria monocytogenes est une bactérie pathogène à Gram positif d’origine alimentaire. Elle est l’agent étiologique de la listériose, une infection grave sous sa forme invasive (20 à 30% de mortalité), mais qui est relativement rare avec une incidence de 0,45 cas pour 100 000 habitants en France en 2008. Cette bactérie a la capacité de s’adapter et de survivre dans divers environnements relativement hostiles, d’adhérer et de former des biofilms sur des surfaces biotiques et abiotiques. Les protéines de surface peuvent intervenir dans les mécanismes de perception et de résistance à l’environnement, dans la virulence, la communication cellulaire ou encore dans l’adhésion aux surfaces. C’est pour ces raisons qu’un intérêt particulier est porté aux protéines de l’enveloppe cellulaire, qu’elles soient membranaires ou pariétales.La caractérisation de ce sous-protéome, appelé surfaceome, avec les approches classiques d’extraction par fractionnement cellulaire et de séparation en gel d’électrophorèse ne sont pas très adaptées. En effet, ces approches ne permettent pas d’accéder à la plupart des protéines liées à la paroi ou enchâssées dans la membrane. D’autres stratégies de protéomique, mises en œuvre récemment, tentent d’appréhender les protéines exposées à la surface par des approches de marquage, d’analyse soustractive ou de décapage chimique ou enzymatique.L’objectif de ce travail est de mettre au point une méthode d’analyse des protéines exposées à la surface chez L. monocytogenes afin de l’utiliser dans le cadre d’étude comparatives souches mutantes/souche sauvage ou mode de croissance planctonique vs sessile, par exemple. Pour cela, une méthode de décapage enzymatique a été testée en modulant différents paramètres (composition du tampon, durée d’incubation, ajout d’agent dénaturant) puis comparée à une méthode de décapage chimique (Schaumburg et al., 2004). Les peptides extraits ont été pré-purifiés sur Sep Pak Light C18 (Waters) et analysés par LC-MS/MS, avec une colonne PepmapC18 (75 µm x 150 mm, 2 µm, 100 Å), couplée à un spectromètre de masse nano-ESI-IT (LTQ Velos, ThermoFisher). Les protéines ont été validées par la présence d’au minimum 2 peptides distincts. La prédiction de leur localisation a été effectuée par plusieurs outils bioinformatiques, utilisés séquentiellement pour caractériser la présence d’un peptide signal, le système de sécrétion utilisé, la présence d’un motif de liaison à l’enveloppe et de domaines transmembranaires. Elle permet d’évaluer l’efficacité de chaque méthode à extraire des protéines de surface tout en limitant la contamination cytoplasmique. En effet, l’un des principaux challenges de cette approche est de maintenir l’intégrité des cellules bactériennes afin d’éviter une contamination massive par des protéines cytoplasmiques. Les résultats de cette étude méthodologique seront présentés et discutés.


[P176] Masschroq : a complete tool for mass spectrometry-based proteomic quantification

Edlira Nano1, Benoît Valot1, Olivier Langella1, Mélisande Blein-Nicolas1, Ludovic Bonhomme1, Michel Zivy1

1 INRA, Plateforme d'Analyse Protéomique de Paris Sud-Ouest, Ferme du Moulon, 91190 Gif-sur-Yvette, France2 CNRS, Plateforme d'Analyse Protéomique de Paris Sud-Ouest, Ferme du Moulon, 91190 Gif-sur-Yvette, France

Contact: Edlira Nano ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics, Proteins, peptides and small molecules quantification

MassChroQ (Mass Chromatogram Quantification) is a new software tool that performs XIC (eXtracted Ion Chromatogram) extraction, peak detection, alignment and quantification on data obtained from Liquid Chromatography-Mass Spectrometry (LC-MS) systems. A full description and evaluation of this tool can be found in [1].

MassChroQ is able to : - analyze data acquired by both high and low resolution mass spectrometers;- analyze data from label-free as well as from isotopic labeling experiments; take into account complex sample treatments as peptide or protein fractionation prior to LC-MS analysis.This versatility is mainly due to the fully configurable and traceable traits of the tool.

MassChroQ is able to automatically and time-efficiently process large amounts of various data in one shot, its quantification results being ready to use for statistical analysis. In addition, it is open-source, every data it uses and produces is in open standard format (mzXML, mzML, CSV, gnumeric, ODT...) and its modular architecture allows easy integration in proteomic pipelines (like TPP or TOPP) or proteomic databases (like PROTICdb).

We present here two studies of label-free and isotopic-labeling experiments where MassChroQ was used for quantification:- A study of genetic diversity in yeast (Blein-Nicolas et al, in prep). In this study, 9 strains of Saccharomyces cerevisiae and 6 strains of Saccharomyces bayanus var. uvarum (3 replicates of each) were analyzed without labeling by LC-MS/MS using an LTQ-Orbitrap (Thermo). From a total of 250Go of data MassChroQ quantified about 6684 peptides in 654 identified proteins in 30 minutes. 360 proteins were shown to vary significantly within and between species.- A quantitative phosphoproteomics study of in vivo changes during drought and recovery in the growing zone of maize leaves (Bonhomme et al, in prep). In this study, 40 maize leaf protein lysates were subject to dimethyl isotope labeling followed by SCX-fractionation. Ten fractions were recovered and used for further phosphopeptide enrichment using IMAC. The 400 resulting fractions were analyzed by LC-MS³ using an LTQ (Thermo) spectrometer. From a total of 450Go data, MassChroQ quantified 3659 phosphorylation sites accounting for 2462 distinct proteins. Statistical analysis of the quantification results evidenced fine localized phosphoproteomic changes possibly involved in the plant-growth process.

For further information refer to MassChroQ's homepage at http://pappso.inra.fr/bioinfo/masschroq.

[1] Valot B, Langella O, Nano E, Zivy M . MassChroQ: A versatile tool for mass spectrometry quantification, Proteomics 2011, in press.

Link: http://pappso.inra.fr/bioinfo/masschroq


[P177] A novel platform for comprehensive lipidomics screening based on MALDI-QIT-TOF-MSn technology

Gerald STÜBIGER1, Wolfgang WERTHER2, Omar BELGACEM3

1 MEDICAL UNIVERSITY OF VIENNA, Spitalgasse 23, 1090 VIENNA (AUSTRIA)2 UNIVERSITY OF VIENNA, Doktor-Karl-Lueger-Ring 1, 1010 VIENNA (AUSTRIA)3 SHIMADZU KRATOS, Wharfside, Trafford Wharf Road, M17 1GP MANCHESTER (UK)

Contact: Omar BELGACEM ([email protected])Keywords: Clinical proteomics

IntroductionPhospholipids (PLs) are essential components of biological membranes interacting dynamically to form platforms for protein activity, signal transduction and cell interactions. Changes in type, abundance and quantity of membrane PLs may be associated with the etiology of many diseases (e.g. neurological disorders, cancer, cardiovascular pathologies and atherosclerosis). Development of soft-ionization techniques (ESI- and MALDI-MS) facilitated the breakthrough for the analysis and understanding of the immense structural variability and functionality of membrane lipids. Efforts in the discovery of novel matrix substances, improvements of instrumentation, sensitivity and reproducibility open the possibility for setup of novel qualitative and quantitative MALDI-MS/MS lipidomics approaches. We introduce a comprehensive lipidomics screening platform based on MALDI-QIT-TOF-MSn combined with multivariate data analysis (MVDA) dedicated to clinical applications.

Preliminary DataSeveral matrix substances have been evaluated for selective detection of different lipid classes. THAP and ATT were found the best matrices for detection of cationic PLs (e.g. LPC, PC, SM) and oxidized PLs (e.g. OxPCs), respectively. These lipid classes are exclusively detectable in positive-ion mode either as [M+H/alkali]+ ions. Anionic lipid classes (e.g. PA, PE, PG, PI, PS) could be selectively detected in negative mode using 9-AA as the most universal or ATT as more selective matrix. The limit of detection of PLs was in the range <100 fmole on target allowing comprehensive profiling of the different PL-classes directly from mouse or human plasma (<1-10 nL equivalents) without need for any pre-separation. Using positive-ion mode verification of individual LPC, PC and SM species was possible via MS3 experiments from [M+Li]+ ions. OxPCs showed characteristic signature ions corresponding to degree of oxidative modification. In negative-ion mode [M-H]- ions provided conclusive structural information (e.g. carboxylate anions) in MS2 mode. This structural information was subsequently used for PL-profiling from biological samples based on statistical evaluation. Now ongoing work is centered towards implementation of the MALDI-QIT-TOF-MSn platform for clinical diagnostics.

Novel AspectMALDI-QIT-TOF-MSn is introduced as comprehensive lipidomics platform for basic research and clinical diagnostics in the future.



[P178] Analyse des polymères par spectrométrie de masse : apport du logiciel Polymerix

Valérie Bourdon1, Eric Leroy1, Olivier Thillaye du Boullay2, Fethi Bensaid2, Catherine Claparols1

1 Service Commun de Spectrométrie de Masse, Université Paul Sabatier, 118 route de Narbonne, 31062 Toulouse cedex 92 Laboratoire Heterochimie Fondamentale et Appliquée, Université Paul Sabatier, 118 route de Narbonne, 31062 Toulouse cedex 93 Laboratoire de Chimie de Coordination, CNRS, 205 route de Narbonne, 31077 Toulouse cedex 4

Contact: Valérie Bourdon ([email protected])Keywords: High mass and high resolution mass Spectrometry

Les polymères sont des macromolécules constituées d’un enchaînement d’unités répétées appelées monomères. La grande variété de masse et de morphologie des polymères, ainsi que de nature des monomères dont ils sont constitués, permet d’obtenir des matériaux très divers avec de larges domaines d’applications. La caractérisation de ces matériaux est essentielle pour prédire et élucider les propriétés et la morphologie des polymères. La spectrométrie de masse, plus particulièrement la technique d’ionisation MALDI-TOF, est utilisée pour l’étude de composés non volatils de haute masse et est donc particulièrement adaptée à l’analyse de polymères.La spectrométrie de masse permet d’apporter un grand nombre d’informations au chimiste concernant la structure du polymère (extrémités de chaînes, motif de rép�tition) et de déterminer sa masse molaire moyenne absolue. Cependant, l’interprétation d’un spectre de masse n’est pas toujours évidente notamment lorsque l’échantillon contient différentes familles. C’est là qu’intervient le logiciel Polymerix (Sierra Analytics) qui permet d’identifier les polymères et de faire le calcul des grandeurs caractéristiques : Ip, Mn, Mw, DPn, DPw… pour chaque famille identifiée. Il est utilisable avec les différentes marques de logiciels de masse et avec les différentes sources d’ionisation : ESI, MALDI-TOF… Nous nous intéresserons ici particulièrement à l’analyse MALDI.Un des principaux intérêts de Polymerix consiste à « deisotoper » les spectres de masse obtenus c'est-à-dire à transformer le massif isotopique en un seul pic isotopique qui tient compte de l’abondance relative des éléments présents dans le polymère. L’utilité du logiciel sera abordée à travers 3 exemples concrets : Un premier spectre MALDI d’un échantillon polydisperse pour lequel le fait de « deisotoper » a pu mettre en évidence l’enveloppe du polymère.Puis l’exemple d’un mélange de polymères avec un écart de masse de 2 uma. Les 2 polymères étaient confondus dans un même profil isotopique et la fonction « deisotoping » a permis de les différencier. Pour finir, un exemple où l’analyse du spectre MALDI combiné avec le logiciel Polymerix a montré que la fonctionnalisation d’un polyethylèneglycol PEGXH par une molécule A n’était pas univoque. Nous avons pu déterminer que le polymère obtenu était en fait un mélange de PEG de départ (PEGXH), de PEG monofonctionalisé (PEGX-A-H) et de PEG difonctionalisé (PEGX-AA-H). La RMN 1H ne permettait pas de lever l’ambigüité quant à la pureté du polymère obtenu, monodisperse en analyse SEC.


[P179] Identification of heterodimers between the planar cell polarity receptors Vangl1 and Vangl2

Tania Guenneau-Puvijesinghe1, Edwige Belotti1, Stéphane Audebert2, Emilie Baudelet1, Luc Camoin1, Jean-Paul Borg1

1 Inserm U891, Centre de Recherche en Cancérologie de Marseille, 27, bd lei Roure, 13009 Marseille, France2 Institut Paoli-Calmettes, , 13009 Marseille, France3 Université de la Mediterranée, , 13007 Marseille, France4 Marseille Proteomic Platform (MaP-IBIsa), ,

Contact: Stéphane Audebert ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Neural tube defects (NTDs) are very common diseases in humans and rank second only to cardiac defects for inborn errors. The most common type of NTD is spina bifida whose prevalence in Europe is 5/10,000 births. Craniorachischisis is the most severe (and lethal) NTD characterized by a completely open neural tube along the whole body axis. At the molecular level, recent advances have highlighted that loss of function mutations in genes regulating planar cell polarity (PCP), a process required for the organization of epithelia sheets and morphogenesis of tissues, play a key role in the emergence of NTDs during early embryonic development. Genetic studies conducted in mouse models that were recently confirmed in humans have revealed that mutations in the cell polarity receptor Vangl2 cause PCP defects and craniorachischisis. Vangl2 is a 521-amino acid membrane protein with poorly described functions and is composed of four putative transmembrane domains. Interestingly, Vangl2 genetically interacts with Vangl1, a close homolog, as double heterozygous Vangl1/Vangl2 mice develop identical PCP defects and craniorachischisis as Vangl2-/- deficient mice. It remains unknown whether these proteins belong to a common protein complex or act in parallel pathways. Considering the very close similarity between the peptide sequences of Vangl1 and Vangl2, the study of these proteins is severely hampered by the lack of antibodies able to biochemically discriminate between the two homologs.

In this study, we have generated a highly specific monoclonal anti-Vangl2 antibody able to efficiently purify Vangl2 from protein extracts. The specificity of the antibody was demonstrated in western blot and immunoprecipitation assays. We screened breast cancer cell lines and identified SKBR7 as a cell line expressing both Vangl1 and Vangl2. We then used an immunoaffinity-based experimental approach using the anti-Vangl2 antibody to isolate endogenous Vangl2 and its associated binding partners from SKBR7 protein extracts. Protein analysis of the immunoprecipitated proteins was undertaken using denaturing SDS-PAGE separation, in-gel trypsin digestion and Orbitrap mass spectrometry analysis. We efficiently identified endogenous Vangl2 with very good peptide sequence coverage and through the analysis of post-translational modifications confirmed the methionine encoded by the predicted start codon as acetylated. Analysis of proteins present in Vangl2 immunoprecipitates showed that Vangl2 copurifies with endogenous Vangl1. Using GFP or Myc-tagged Vangl1 and Vangl2 constructs, we further confirmed that these cell polarity receptors are able to form homo- and hetero-complexes in living cells.

The data presented here demonstrate that Vangl1 and Vangl2 form protein complexes and therefore establish a paradigm for the understanding of the morphogenetic defects in which these proteins are implicated.

Link: http://crcm.marseille.inserm.fr/


[P180] Pre-treatment of proteins before enzymatic digestion: a critical step to consider further in proteomic analyses.

Sylvie Kieffer-Jaquinod1, Mathieu Baudet1, Alexandra Kraut1, Maighread Gallagher-Gambarelli1, Michel Jaquinod1, Christophe Bruley1, Yohann Couté1

1 Biologie à Grande Echelle, CEA / INSERM 1038 / UJF, 17, rue des Martyrs, 38054 Grenoble cedex 9, France

Contact: Yohann Couté ([email protected])Keywords: Separative analysis methods

In bottom-up proteomic studies, after optional biological or biochemical fractionations, extracted proteins are classically submitted to specific treatments before enzymatic digestion and analysis of the generated peptides using mass spectrometry. These pre-digestion steps mainly aim at disassembling disulfide bonds and blocking free sulfhydryl groups of cysteines, rendering proteins more accessible to enzymatic cleavages and facilitating unambiguous identification of cysteine-containing peptides. However, even sounding straightforward, these procedures need to be fully controlled in order to avoid irreproducible amino acid modifications as well as complexification of the studied proteomes.In the presented work, we evaluated two different ways of preparing proteins from various complex samples of different origins before in-gel digestion: reduction/alkylation and hydrogen peroxide oxidation. Number of identified peptides as well as amino acids (notably C, M) representations and modifications were studied. Our results highlighted the strengths and weaknesses of both protocols; for example more cysteine-containing peptides were identified using the reduction/alkylation strategy compared to the hydrogen peroxide oxidation whereas an opposite observation was made for methionine-containing peptides.We then worked on the optimization of both protocols. For the oxidation protocol, performic acid was tested using several concentrations of acid and of hydrogen peroxide. This led to an increase in the number of identified peptides, the conversion of all methionines to a unique and maximal oxidation state but also to the disappearance of tryptophan-containing peptides from the list of identified peptides. For the reduction/alkylation protocol, several concentrations of alkylating reagents as well as the addition of a step stopping alkylation were tested. Conditions generating maximal peptide identifications and minimal generation of side reactions were found. The improvements made in the reduction/alkylation protocol were also successfully tested with in-solution trypsin digestion.In conclusion, pre-treatment of proteins before digestion is a critical step that has to be carefully studied. Reduction/alkylation and mild oxidation of proteins are complementary protocols that can be used in parallel to further characterize proteomes of interest.


[P181] Caractérisation par spectrométrie de masse Maldi-Tof de polyisoprènes à structure complexe

Christelle Absalon1, Samira Ouardad2, Christiane Vitry1, Claire Mouche1, Patricia Castel1, Alain Deffieux2, Frédéric Peruch2

1 ISM-CESAMO Université Bordeaux1 UMR 5255, 351 cours de la Libération, 33405 Talence2 LCPO Université Bordeaux 1 UMR 5629, 16 avenue Pey Berland, 33607 Pessac

Contact: Christelle Absalon ([email protected])Keywords: Systems biology

Le caoutchouc naturel, un poly(isoprène) de structure purement 1,4 cis présentent des propriétés inégalées par ses homologues synthétiques. Pour cette raison la production mondiale de caoutchouc naturel demeure stratégique et est toujours proche de 10 millions de tonnes, soit 50% de la demande mondiale annuelle en élastomères. Alors que les voies de synthèse développées jusqu’à présent pour accéder à des homologues du caoutchouc naturel sont basées sur la polymérisation par voie anionique ou par coordination de l’isoprène, l’approche suivie par la nature pour synthétiser les polyterpènes est basée sur la polymérisation à caractère cationique d’un autre monomère, l’isopentényl pyrophosphate (IPP) qui est la brique de construction universelle de la famille des terpènes. Nous avons alors développé une voie cationique pour polymériser des modèles de l’IPP afin d’accéder à des polyterpènes approchant la structure des produits naturels.Les polyisoprènes obtenus par voie cationique possèdent une structure relativement complexe du aux nombreuses réactions secondaires engendrées par ce type de polymérisation (amorçage parasite, branchement, cyclisation, …). Les analyses par résonnance magnétique nucléaire et par analyse par chromatographie d’exclusion stérique SEC ne nous ont pas permis de mettre en évidence l’ensemble de ces réactions secondaires. En revanche, l’analyse de spectrométrie de masse Maldi-TOF s’est révélée être un outil performant permettant de mettre en évidence différents types d’amorçage par exemple.L’objet de cette étude est de proposer une méthode optimisée pour la caractérisation de ces polyisoprènes. En premier lieu, le choix de la matrice et des sels d’ionisation s’avèrent particulièrement primordial pour l’obtention de spectres homogènes et reproductibles. Cette technique d’analyse a pu non seulement fournir des informations sur les mécanismes mis en jeu mais aussi une quantification relative des familles.


[P182] Conversion of fern (Pteris vittata L.) biomass from a phytoremediation trial in sub- and supercritical water conditions : qualitative and quantitative study by GC-MS

Christelle Absalon1, Marion Carrier2, Marie-Hélène Lescure1, Anne Loppinet-Serani2, Cyril Aymonier2, Michel Mench3

1 ISM-CESAMO Université Bordeaux 1 UMR 5255, 351, cours de la Libération, 33405 Talence2 ICMCB CNRS Université Bordeaux 1 UPR 9048, 87, avenue du Dr. A. Schweitzer, 33608 Pessac3 UMR BIOGECO INRA 1202 Université Bordeaux 1, avenue des Facultés, 33405 Talence

Contact: Christelle Absalon ([email protected])Keywords: Systems biology

Unlike organic compounds, trace elements in contaminated soils cannot be degraded. To reduce pollutant linkages evidenced by risk assessment, the clean-up of many contaminated sites requires removing trace elements in excess from the soil.

Phytoextraction refers to the uptake and translocation of soil contaminants by plant roots into generally the above ground plant parts to remove contaminants from soil and promote long term soil cleaning. This natural, solar-energy driven phytoremediation option does not compromise the topsoil functioning and fertility and may improve it, without secondary pollution, huge costs, and consummation of primary raw. Chinese brake fern (Pteris vittata L.), an arsenic (As) hyperaccumulator is an option to phytoextract As in contaminated soils. Post-harvest disposal of such trace element-contaminated plant biomass is a key-point to gain financial returns from phytoextraction and to support public, policy maker and stakeholder acceptance.

An innovative process using sub and supercritical water treatments propose the complete oxidation of biomass or its conversion into valorizable products via gasification or liquefaction mechanisms.

This work deals with characterization of obtained products in liquid phase. The chemistry of biomass degradation has been studied with plant model compounds such as cellulose, sugars, and lignin and subsequently numerous compounds such as phenols, furfurals, carbon acids, sugars and condensation products have been detected after a supercritical treatment.

Therefore key organic compounds, i.e. phenol, cyclopentenones, furfural, and guaïacols, were measured by GC-MS in the liquid phase following the sub- and supercritical treatments. In this study, we will follow the influence of the temperature during supercritical water treatments on the formation of organic compounds. Qualitative and quantitative study of liquid phases will help understanding degradation mechanisms.


[P183] Développement d’une approche multi-plateforme pour l’analyse des phytomicronutriments et de leurs métabolites chez l’homme

Noura Meklat1, Mercedes Quintana2, Bernard Lyan1, Claudine Manach2, Estelle Pujos-Guillot1

1 Plateforme d'Exploration du Métabolisme, Centre de Recherche de Clermont-Ferrand/Theix, 63122 Saint-Genes-Champanelle2 UMR1019 Nutrition Humaine, Centre de Recherche de Clermont-Ferrand/Theix, 63122 Saint-Genes-Champanelle

Contact: Noura Meklat ([email protected])Keywords: Instrumentation, Proteins, peptides and small molecules quantification

Le « Food metabolome » est l’ensemble des métabolites issus de l’alimentation et retrouvés dans les fluides biologiques en particulier le sang et l’urine (Walsh et al.,2006 ; Manach et al., 2009, Van Duynhoven et al., 2011). Les phytomicronutriments constituent un ensemble hétérogène de composés appartenant à diverses familles chimiques tels que les polyphénols, les terpènes, les phytostérols, les caroténoïdes etc. Même s’ils ne font pas partie des nutriments essentiels, leurs effets sur la santé sont de plus en plus étudiés. De plus ils peuvent constituer des biomarqueurs de consommation des fruits et légumes, qui permettront de mettre en évidence les relations entre les habitudes alimentaires et diverses pathologies dans les études épidémiologiques.L’objectif de ce travail est le développement d’une stratégie analytique permettant de couvrir un maximum de la composante phytomicronutriments du « Food metabolome », et pouvant être appliquée à l’analyse d’échantillons urinaires et plasmatiques de consommateurs de fruits et légumes issus d’une cohorte.Un inventaire des familles de phytomicronutriments présents dans les aliments a été réalisé. L’examen détaillé des propriétés physico-chimiques de chacun de ces composés et de leurs métabolites, nous a permis de sélectionner 28 composés représentatifs des diverses familles. En raison du large éventail de masses, de polarités et de fonctions chimiques mises en jeu et pour rendre l’analyse de ces métabolites la plus exhaustive possible nous avons mis en place une stratégie analytique combinant à la fois la chromatographie gazeuse couplée à la spectrométrie de masse (GC-EI/MS) et la chromatographie liquide couplée à la spectrométrie de masse (LC-ESI/APCI-MS mode positif et négatif). Les conditions chromatographiques, les méthodes de détection, ainsi que les étapes de préparation d’échantillons ont été optimisés dans le but garantir la couverture analytique de la méthode, tout en limitant la variabilité induite.Nous présentons ici les premiers résultats obtenus sur matrices urinaires et plasmatiques supplémentées avec les standards des composés sélectionnés comme représentatifs des principaux phytomicronutriments du « Food metabolome ».


[P184] Localization of the active site of Abf2, a mitochondrial DNA repair protein

Guillaume GABANT1, Françoise CULARD1, Stéphane GOFFINONT1, Bertrand CASTAING 1, Martine CADENE1

1 Centre de Biophysique Moléculaire, CNRS UPR4301, rue Charles Sadron, 45071 Orléans, France

Contact: Martine CADENE ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Mitochondrial genomes are constantly damaged by endogenous reactive oxygen species generated during the electron transport chain of cellular respiration. These DNA lesions are potentially mutagenic and cytotoxic and most of them are corrected through the base excision repair (BER) pathway. Autonomously replicating sequence (ARS)-binding factor 2 (Abf2) protein is essential for the maintenance of mitochondrial DNA of Saccharomyces cerevisiae. We have recently shown that Abf2 exhibits an abasic (AP) site cleavage activity. Here we investigate the amino acid responsible for this protein activity.In these experiments we used the intermediate of the enzymatic reaction which involves a Schiff base formation between the enzyme and DNA that can be stabilized by a sodium borohydride reduction to form a covalently linked complex.Mass spectrometry characterization of protein-DNA or peptide-nucleic acid heteroconjugates is hampered by the contrasting physical-chemical properties of nucleic acid and peptide entities present in such heteroconjugates. Furthermore, the oligonucleotide part of the heteroconjugate had to be small enough to ensure that the species under investigation exhibit peptide-like properties to facilitate peptide analysis and sequencing in the positive ion mode.A two-step enrichment method (avidin-biotin affinity chromatography and metal chelate chromatography) combined with enzymatic degradation of protein (Trypsin proteolysis) and oligonucleotide (Nuclease P1 hydrolysis) prior to mass spectrometric analysis was developped. Matrix-assisted laser desorption/ionization mass spectrometry experiments on proteolytic peptides allow for the identification of a modified sequence containing three potential targeted residues: Lys147, Lys156 and Lys158. Sequencing of the corresponding peptide–nucleic acid heteroconjugate by nanoelectrospray ion trap MS/MS mass spectrometry shows that Lys147 is not modified but cannot discriminate between Lys156 and Lys158 which are in close proximity. Additional proteolysis of the tryptic products with endoproteinase Glu-C (V8 Protease) leads to cleavage at Asp157 with unambiguous assignment of Lys158 as a modified residue. Directed mutagenesis experiments are underway to confirm this result.


[P185] Proteinscape, un outil convivial et performant au service de la protéomique : de la gestion des projets à l’exploitation des données de spectrométrie de masse

Lauriane Kuhn1, Pierre-OIivier Schmit2, Yannis François3, Emmanuelle Leize-Wagner3, Philippe Hammann1

1 Plate-forme Protéomique Strasbourg – Esplanade, Institut de Biologie Moléculaire et Cellulaire, FRC1589 , 15 rue René Descartes , 67084 Strasbourg Cedex2 Bruker Daltonique, 34 rue de l’Industrie, BP10004, 67166 Wissembourg Cedex3 Laboratoire de Dynamique et Structure Moléculaire par Spectrométrie de Masse, UMR7177, Faculté de Chimie, 1 rue Blaise Pascal, 67008 Strasbourg Cedex

Contact: Lauriane Kuhn ([email protected])Keywords: Systems biology

Grâce à la mise en place de méthodes d’analyse protéomique «haut-débit» , les plates-formes technologiques en protéomique peuvent traiter un nombre important et croissant de demandes d’analyse. Mais il y a une contrepartie: savoir stocker le volume de données générées et savoir exploiter ces données de manière à donner un sens aux identifications et répertoires protéiques obtenus. Ce constat a permis de prendre conscience de l’importance des outils informatiques et bioinformatiques, indispensables à chaque étape du traitement des échantillons.

Notre plate-forme d’analyses protéomiques, située à Strasbourg – Esplanade, réalise des prestations de service pour l’analyse des protéines et peptides par spectrométrie de masse. De part l’augmentation du nombre de demandes d’analyse, de la multiplicité des approches utilisées (1D- et 2D-E, (LC)-MALDI-TOF/TOF et nanoLC-MS/MS) et de la profondeur d’analyse souhaitée (identification, modification, quantification), nous avons opté pour la solution logicielle Proteinscape (Bruker Daltonique). Cet outil, convivial et performant, nous assiste quotidiennement sur la plate-forme, et s’articule autour des étapes clés suivantes:

1)Gestion des échantillons et des projets : Proteinscape nous permet de hiérarchiser de manière intelligente les prestations de service et les projets, selon la granulométrie souhaitée (projet / échantillon / gel / séparation / enzyme / données MS multi-constructeurs / etc). La manière d’utiliser cette plate-forme logicielle nous garantit une traçabilité des données et leur stockage dans un outil de type LIMS (protocoles, scans de gels, recherche dans les banques de données, fichier contenant les protéines validées, partage des données entre plusieurs utilisateurs agrées …). 2)Recherches dans les banques de données : Proteinscape permet une utilisation complémentaire des moteurs de recherches Mascot et Phenyx, étape à l’issue de laquelle une validation, automatique ou manuelle, des identifications et une évaluation de la qualité de données (FPR) est réalisée. 3)Exploration des données : Proteinscape reposant sur une base de données SQL sous-jacente, nous utilisons des requêtes afin d’extraire les informations les plus pertinentes des analyses effectuées (interrogation de plusieurs échantillons pour rechercher une protéine ou un peptide d’intérêt, mise en évidence de protéines différentiellement exprimées par comparaison de différentes conditions d’études, …).4)Exports : dans le cadre du rendu de résultats par la plate-forme, l’utilisation de Proteinscape s’avère indispensable pour l’édition de rapports d’analyses contenant les détails des identifications obtenues sur un ou plusieurs échantillons. De plus, Proteinscape permet également d’effectuer des exports de données utilisables pour la valorisation des résultats et le respect des guidelines des journaux de protéomique.

Link: http://www.bdal.com/products/software/proteinscape/overview.html


[P186] CESI-MS. Principe et application pour l'analyse sensible de mélanges peptidiques complexes

Michael Biacchi1, Nina Pourhassan1, A. A. Heemskerk3, B. Schoenmaker3, Yannis Francois1, Emmanuelle Leize-Wagner1, Jean-Marc Busnel3, O.A. Mayboroda3

1 Laboratoire de Dynamique et Structure Moléculaire par Spectrométrie de Masse (LDSM2), CNRS – UMR 7177, Institut de Chimie de Strasbourg, 1 rue Blaise Pascal, 67000 Strasbourg, France2 Laboratoire Biochimie Toxicologie, CHR Metz Thionville, 2 rue de Friscaty, 57126 Thionville, France3 Biomolecular Mass Spectrometry Unit, Leiden University Medical Center, Albinusdreef 2, 2333 ZA Leiden, Pays-Bas4 Beckman Coulter Inc., 250 South Kraemer Boulevard, CA 92821-6232 Brea, Etats-Unis

Contact: Yannis Francois ([email protected])Keywords: Instrumentation, Clinical proteomics

La nouvelle plateforme CESI, reposant sur la technologie OptiMS de la société Beckman Coulter a été récemment mise en place au laboratoire. Cette technologie, basée sur l’utilisation d’un capillaire de séparation dont une extrémité a été traitée par acide fluoridrique a pour but de permettre un couplage « idéal » de l’électrophorèse capillaire (CE) et de la spectrométrie de masse par électronébulisation (ESI-MS).

Dans un premier temps, afin de caractériser cette nouvelle interface, différentes expériences ont été réalisées afin de déterminer quelle était la gamme de débits compatible avec la technologie OptiMS. Il a ainsi été démontré que cette approche permettait de générer un spray stable pour des débits allant de plusieurs centaines de nL/min a des valeurs inferieures a 10 nL/min, ceci permettant de tirer profit du régime nanoESI (< 30 nL/min) qui se caractérise par une augmentation de la sensibilité et une diminution du phénomène de suppression d’ions. Par la suite, l’analyse de mélanges peptidiques de complexité croissante a démontré que cette nouvelle plateforme fournit d’excellentes sensibilités permettant la détection de faibles quantités d’échantillon avec un pouvoir résolutif optimal. De plus, il est ici démontré qu’une étape de préconcentration par isotachophorèse transitoire (tITP), permettant d’augmenter significativement le volume d’échantillon injecté tout en conservant l’efficacité et la résolution des pics, est parfaitement compatible avec cette nouvelle interface. Les limites de concentrations et de détections obtenues sur ce système sont de l’ordre du subnanomolaire et du nanomolaire selon l’amplitude de la phase de preconcentration.


[P187] Développement d’une approche protéomique chez le crabe Carcinus maenas (L.) : mise au point d’un protocole d’extraction de protéines à partir des branchies et révélation des protéines ubiquitinisées

François Panchout1, Julie Letendre1, Xavier Denier1, Florence Bultelle1, Béatrice Rocher1, François Leboulenger1, Fabrice Durand1

1 Laboratoire d’Ecotoxicologie-Milieux Aquatiques (LEMA) EA3222, IFRM 23, Université du Havre, 25 rue Philippe Lebon B.P. 540, 76058 Le Havre, France

Contact: Béatrice Rocher ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

L’acclimatation des organismes soumis à des contaminations chimiques est devenue une question majeure au vu de la pollution croissante et complexe qui touche les écosystèmes. Les espèces vivant en milieux côtiers sont exposées de façon chronique à un stress physique et chimique. Parmi ces espèces, le crabe, Carcinus maenas, présente une large répartition géographique, occupe des habitats variés de l’embouchure des estuaires jusqu’au circalittoral des mers côtières, traversant des continuums hydrologiques à salinité, température, oxygénation et durée d’exondation variables, démontrant ainsi une forte plasticité physiologique et suggérant des capacités d’acclimatation et de résistance importantes. En tant que consommateur privilégié de bivalves estuariens et médiolittoraux (moules, tellines et scrobiculaires), Carcinus maenas est aussi un modèle potentiel de bioamplification des contaminants. L’objectif de l’étude est d’évaluer la résistance de crabes Carcinus maenas à des conditions de stress contrôlées en fonction de leur trait de vie, en particulier en fonction de l’exposition à la pollution préalablement subie. Pour se faire, une approche ouverte a été développée, qui vise à mettre en évidence des acteurs protéiques dont l’expression traductionnelle, voire post-traductionnelle, est modifiée sous l’impact des facteurs environnementaux et/ou sous l’effet de la contamination chimique. Cette étude a pour but, à terme, d’élucider des mécanismes moléculaires et cellulaires impliqués dans la résistance aux polluants. L’analyse sera réalisée par comparaison des profils 2DE obtenus après coloration au nitrate d’argent et après transfert sur membrane et immunodétection des protéines polyubiquitinisées. L’ubiquitination est une modification post-traductionnelle qui oriente les protéines vers le protéasome en vue de leur protéolyse. Ce système complexe demeure peu étudié chez les invertébrés aquatiques. Le tissu choisi, la branchie, occupe une position privilégiée à l’interface entre le reste de l’organisme et le milieu extérieur. Cependant, les branchies des décapodes sont recouvertes d’une cuticule de chitine qui rend inefficace les protocoles classiques d’extraction et de solubilisation des protéines. De ce fait, le travail présenté ici est centré sur le développement de la technique d’extraction et de solubilisation des protéines dans les branchies chez le crabe Carcinus maenas. Les résultats en termes de qualités des empreintes protéomiques obtenues après 2DE indiquent que la méthode la plus efficace et reproductible consiste en une extraction par broyage dans l’azote liquide suivie d’une précipitation au trichloroacétate avant solubilisation. Le marquage des protéines ubiquitinisées montre une grande hétérogénéité des profils au sein de la population de crabes testée avec une protéine majoritairement marquée et qui reste encore à identifier.


[P188] Fast Analysis of Mineral Oils in Recycled Cereal Food Packaging using Direct Sampling Analysis Time-of-Flight Mass Spectrometry, DSA-TOF MS

Sean Daugherty 1, Massimo Santoro1, Shida Shen1, Karima BAUDIN2

1 PerkinElmer Inc, 710 Bridgeport Avenue, CT 06484 Shelton, USA2 Perkin Elmer France, 16 Avenue du Quebec, 91140 Villebon sur Yvette, France

Contact: Karima BAUDIN ([email protected])Keywords: Instrumentation, Organic and inorganic mass spectrometry

NOVEL ASPECTA fast and sensitive method for determination of mineral oils in recycled food packaging using Direct Sample Analysis Time-of-Flight Mass Spectrometry (DSA-TOF MS).

INTRODUCTIONRecent tests on recycled food packaging have found a variety of mineral oils, some associated with components of printing ink. Mineral oil consists of various hydrocarbons known as mineral oil saturated hydrocarbons (MOSH) and mineral oil aromatic hydrocarbons (MOAH). The safe upper limit for MOSH according to the UN Food and Agriculture Organization/World Health Organization Joint Expert Committee on Food Additives is 0.6 mg/kg. This level is often exceeded because of presence of mineral oil from newspaper and other printed paper utilized in the recycling process.

METHODSMeasurement was performed using a PerkinElmer TOF MS system equipped with a PerkinElmer Direct Sample Analysis (DSA) ion source. The DSA source ionizes compounds evaporated from the surface and bulk cardboard packaging through gas phase charge exchange reactions. It allows detection, identification, spatial mapping of migration, and relative abundance determination of mineral oils in the packaging material without sample preparation.

PRELIMINARY DATAA fast DSA method for the determination of mineral oils in recycled packaging allows monitoring the progress of the printing inks through the recycled matrix, determination of the different mineral oils present, and their concentrations. Data acquired from a coffee shop cardboard cup holder in positive ion polarity mode using the DSA source detected peaks separated by m/z 28, indicating a hydrocarbon chain with an increasing number of C2H4 units.


[P189] Tissue proteomics for ovarian epithelial cancers biomarkers hunting: screening and targeting for new issues in biology and pharmacology

Rémi Longuespée1, Charlotte Boyon1, Olivier Kerdraon4, Annie Desmons1, Robert Day2, Denis Vinatier3, Robert Day2, Isabelle Fournier1, Michel Salzet1

1 Laboratoire de Spectrométrie de masse fondamentale et appliquée, Université des Sciences et Technologies de Lille, 59650 Villeneuve D'Ascq, France2 Institut de Pharmacologie de Sherbrooke, Université de Sherbrooke, J1H5N4 Sherbrooke, Canada (Québec)3 Service de chirurgie gynécologique, CHRU Lille, 59000 Lille, France4 Centre d'Anatomie et de Cytologie pathologiques, CHRU Lille, 59000 Lille, France

Contact: Rémi Longuespée ([email protected])Keywords: Imaging mass spectrometry, Clinical proteomics

Direct analysis of tissues by MALDI-MS is an interesting strategy for markers hunting in pathologies by giving molecular information at the tumor level. Using different chemical preparations, benign and malignant ovarian biopsies were analyzed by MALDI-TOF-MS for peptides, proteins, and high-mass proteins, in automatic profiling assays to investigate specific signatures for diagnosis.By this strategy, coupled to bottom-up procedures, several biomarkers from ovarian carcinoma regions were obtained and classified as proteins associated with cell proliferation, immune response modulation, signaling to the cytoskeleton, tumor progression, and epithelial-to-mesenchymal cell transformation. These specific biomarkers were then validated by immunocytochemistry using Tag-mass technology, Western blot, and PCR.One of these markers is a fragment of the immunoproteasome-11S which was found in borderline and stage-I serous, endometrioid, and mucinous tissues. This makes it a potential target for wide screenings of the early development of the disease and reveals an early biological process of immunotolerance for cancer cells in the ovarian environment.Then, our recent developments allowed us to associate immunocytochemistry and MSI to track this molecule in biopsies by imaging and quantifying the tryptic peptides of anti-Reg Alpha antibodies. This strategy could be used for monitoring of the effect of treatments of the pathology by screening the evolution of the presence of the compound in malignant tissues.All these assays clearly demonstrate the use of the technique for the understanding of cancers mechanistic and pave a new way for new pharmacologic applications.


[P190] Quantitative analysis of proteasome inhibitor effect in acute myeloid leukaemia cells

Mariette Matondo1, Marlène Marcellin1, Karima Chaoui1, Marie-Pierre Bousquet-Dubouch1, Sandrine Uttenweiler-Joseph1, Ruedi Aebersold2, Bernard Monsarrat1, Odile Burlet-Schiltz1

1 Institut de Pharmacologie et de Biologie Structurale , 205 route de Narbonne, 31077 Toulouse2 Institute of Molecular Systems Biology, Wolfgang-Pauli-Str. 16, 8093 Zurich

Contact: Mariette Matondo ([email protected])Keywords: Systems biology, Proteins, peptides and small molecules quantification

The ubiquitin-proteasome pathway plays a critical role in the degradation of proteins involved in cell cycle control and signal transduction. Aberrant regulation of cell cycle proteins can result in accelerated and uncontrolled cell division, leading to tumorigenesis and cancer1. Proteasome inhibitors possess potent antitumor activity and have been used against a broad spectrum of human tumor types2-4. However, the effect of these compounds at the molecular level remains unclear. In the present study, we have investigated the effect of proteasome inhibitors on human acute myeloid leukaemia (AML) cells. We demonstrated that exposure to several proteasome inhibitors (MG132, PS-341 and Lactacystin) induced a higher level of apoptosis in immature KG1a cells in comparison to mature U937 cells5. To go further into the understanding of the effect of proteasome inhibitors on these cell lines, we investigated their protein expression profile before and after proteasome inhibition using SILAC quantitative proteomic analyses. Cell fractionation into cytoplasmic and nuclear extracts was used to reduce sample complexity and maximize protein coverage. The proteins were then separated on a 1D SDS-PAGE gel and digested. Mass spectrometric analysis was performed on both LTQ-Orbitrap XL and Velos instruments. To evaluate the reproducibility and relevance of the variations, two biological replicates were performed. Overall, more than 7,000 proteins were accurately identified and quantified across the samples, where 350 proteins were significantly regulated upon proteasome inhibition in both KG1a and U937 cells. Some of these regulated proteins will be quantified by SRM in cells treated under multiple relevant conditions to validate further their role in the differential apoptotic responses to the proteasome inhibition.

References 1-C.Wojcik and al., J cell.Mol.Med 20022- J. Adams and al., Cancer Research 19993- Lu M and al., J Cell Biochem. 20064- Szokalska A and al., Cancer Research 20095-Matondo and al., Leukemia Research 2010


[P191] Club-jeunes de la Société Française d'Electrophorèse et d'Analyse Protéomique (cjSFEAP)

Rémy Aurand1, Barbara Deracinois1, Erwann Arc1, Sarah Lennon1, Paul Morel1, Mathieu Trauchessec1, Stéphanie Petiot 1, Morgane Couvet1, Bertrand Delaunois1, Céline Boursier1

1 cjSFEAP, Club-Jeunes de la Société Française d'Electrophorèse et d'Analyse Protéomique, 10 rue Vauquelin, 75005 Paris

Contact: Céline Boursier ([email protected])Keywords: Separative analysis methods, Proteins, peptides and small molecules quantification , Bioinformatics et biostatistics dedicated to proteomics

Le Club-Jeunes de la SFEAP, ou cjSFEAP, est, comme son nom l'indique, la filière jeune de la SFEAP. Son objectif est de former un réseau de relations entre les jeunes protéomistes pour qu'ils puissent échanger leurs expériences et s'entraider pour trouver des solutions aux différents problèmes rencontrés mais aussi pour préparer leur insertion professionnelle et les former dans le domaine de la protéomique. Pour cela, des rencontres scientifiques sont organisées tous les ans par le cjSFEAP :- "Les journées du Club-Jeunes" qui ont lieu en mai-juin et qui regroupent une trentaine de jeunes et une dizaine d'intervenants séniors ;- "La session Jeunes" lors du congrès annuel, où les membres présentent leurs travaux.

Pour être membre, il faut remplir les conditions suivantes :- être adhérent à la SFEAP ;- être étudiant et/ou avoir moins de 35 ans !Le Club-Jeunes compte à ce jour près de 80 membres.

Pour se renseigner sur l'actualité du cjSFEAP, il suffit de se connecter au site web : http://cj.sfeap.frVous pouvez également nous contacter via notre mail : [email protected]

Nous proposons à l'ensemble des jeunes travaillant dans le domaine de la protéomique de nous rejoindre pour élargir notre réseau.

Link: http://cj.sfeap.fr


[P192] Multimodal size and charge based analysis of the egfr signaling pathway using an automated capillary-based system for nanoscale protein analysis

Francisco Ramirez1 , Irina Kazakova1 , Jessica Dermody1 , Thierry Salomon1, Tom Yang1 , Uyen Nguyen1 , Robert Gavin1 , Annegret Boge1

1 ProteinSimple (Cell Biosciences Inc.), 3040 Oakmead Village Drive, 95051 CA Santa Clara USA

Contact: Thierry Salomon ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Clinical proteomics, Instrumentation

Background: Aberrant expression and signaling of epidermal growth factor receptor (EGFR) is a common occurrence in a variety of cancers including breast cancer. Understanding how EGFR signaling impacts disease progression is key to the development of novel therapeutics. Analysis of EGFR expression in cancer samples frequently employs Western blot analysis. However, in order to fully understand signaling events, evaluating changes in signaling proteins is accomplished utilizing size-based as well as charge-based separation techniques, each of which is followed by immunoassay detection.

Methods: To this end, we have developed the NanoPro2 (NP2), which combines the ability to perform size- and isoelectric charge-based separation of proteins in nanoscale volumes in one instrument. The NP2 performs these Capillary Electrophoresis (CE) modes coupled to an automated workflow that eliminates the need for manual processing of multiple steps. Proteins from a single sample preparation were analyzed in two assay modes: either in a native conformation using charge-based separation or in a denatured state followed by size-based separation.

Results: Utilizing both modes allowed for detailed analysis of post-translational modifications (isoelectric charge-based separation) and protein abundance (size-based separation) within a prepared sample. As a validation of the dual-mode capabilities of the NP2, we investigated EGFR signaling in response to treatment with EGF.

Conclusion: We showed that the same cellular lysate preparation could be used for analysis by charge and size-based separation, thus establishing a highly flexible system that utilizes a single lysate for multiple assay modes. Advantages of the NP2 assay over slab gel-based assays shown include ease of use, minimal user intervention, automatic analysis and excellent reproducibility.

Link: http://www.proteinsimple.com/


[P193] Caractérisation de peptides lasso par EPD et EDD

Marie Pérot-Taillandier1, Carlos Afonso1, Séverine Zirah2, Quentin Enjalbert3, Rodolphe Antoine3, Jérôme Lemoine3, Philippe Dugourd3, Sylvie Rebuffat2, Jean-Claude Tabet1

1 Institut Parisien de Chimie Moléculaire, UMR 7201 CNRS-UPMC, 4 place Jussieu , 75005 Paris, France2 Molécules de Communication et Adaptation des Microorganismes, UMR 7245 CNRS-MNHN, 57 rue Cuvier, 75005 Paris, France3 Laboratoire de Spectrométrie Ionique et Moléculaire, UMR 5579 CNRS-UCBL, 43, bd du 11 Novembre 1918, 69100 Villeurbanne, France

Contact: Marie Pérot-Taillandier ([email protected])Keywords: Systems biology

Les peptides lasso sont des peptides bioactifs d’origine bactérienne. L’extrémité C-terminale de ces peptides est enchâssée dans un cycle macrolactame formé entre le résidu N-terminal et le carboxylate de la chaîne latérale d'un résidu glutamate ou aspartate en position 8 ou 9. La maturation d’un précurseur linéaire sous l’action de deux enzymes permet d’obtenir cette structure compacte et rigide. Notre travail consiste à caractériser par spectrométrie de masse la topologie de ces peptides en forme de lasso. Leur fragmentation est comparée à celle de peptides synthétiques possédant une topologie différente avec le même enchaînement d’acides aminés: peptide lactame non-lasso ou peptide linéaire.

La microcine J25 (MccJ25), peptide lasso antibactérien produit par Escherichia coli AY25 [1], a d’abord été étudiée par spectrométrie de masse en mode positif (CID, IRMPD et ECD) [2]. Dans cet exposé nous présenterons les résultats obtenus sur cette molécule en mode négatif par activation vibrationnelle (CID) et électronique (EDD, EPD). Les expériences EPD (Electron Photo-detachment Dissociation) ont été réalisées sur un LTQ modifié équipé d’un laser à 266 nm [3], tandis que les expériences EDD (Electron Detachment Dissociation) ont été réalisées sur un FT-ICR [2] avec des électrons d’environ 20 eV.

La MccJ25 contient deux tyrosines capables d’absorber l’UV à 266 nm, induisant le détachement d’électron à l’origine des fragmentations observées en EPD. Afin de préciser le rôle de chaque tyrosine en EPD, nous avons étudié deux variants de MccJ25 produits par mutagenèse dirigée, dans lesquels chaque tyrosine est sélectivement substituée par une phénylalanine.

Par ailleurs des expériences de double-résonance ont été réalisées en EDD sur le FT-ICR en faisant varier l’amplitude d’éjection de l’ion de charge réduite au cours de l’irradiation par les électrons [4]. Ces expériences fournissent des informations sur la cinétique de formation des fragments et nous ont permis de différencier plusieurs mécanismes de fragmentation.

[1] Rosengren K.J et al, Biochemistry 43, 4696 (2004)[2] Zirah S et al, J. Am. Soc. Mass Spectrom. 22, 467 (2011)[3] Larraillet V et al, Anal. Chem. 81, 8410 (2009)[4] Lin C et al, J. Am. Soc. Mass Spectrom. 17, 1605 (2006)

Link: http://hal.archives-ouvertes.fr/docs/00/57/84/42/PDF/Article.pdf


[P194] Lipid Imaging by Liquid Extraction Surface Analyses of brain tissue sections using High Resolution Nano-ESI-MS and Nano-LC-MS.

Reinaldo Almeida1, Johannes Vogt3, Hans Kristian Hannibal-Bach2, Jan Baumgart3, Robert Nitsch3, Christer Ejsing2, Kees Vlak1

1 ADVION, Harlow Enterprise Hub, CM20 2NQ Harlow, Essex, UK2 Department of Biochemistry and Molecular Biology, , Odense, Denmark 3 Institute For Microscopical Anatomy and Neurobiology, , Mainz, Germany

Contact: Kees Vlak ([email protected])Keywords: Imaging mass spectrometry, Instrumentation

Novel Aspect: Comprehensive Brain Tissue Lipid Imaging by Liquid Extraction Surface Analyses (LESA) in combination with nano-ESI and nano-LC-MS, which enables an extra separation step after the tissue extraction .

IntroductionLiquid Extraction Surface Analyses (LESA) can have distinguished advantages providing soft ionisation of analytes without introducing additional sample preparation steps like matrix deposition. Although the spatial resolution of LESA ( ~ 200 µm) is lower than that of MALDI ( 10 -100µm), LESA allows the sensitive detection of a wide range of lipids classes in combination with Nano-ESI-MS and Nano-LCMS.

MethodsFrozen Mice brain tissue, horizontally sliced in 15 µm thickness and placed onto a glass slide, was analyzed by liquid extraction surface analyses. 0.5 µL to 1 µL optimized extraction solvent was robotically placed onto the tissue to form a micro liquid junction between a capillary and the surface. The extract was then aspirated into the capillary and transferred automatically to the inlet of a nano ESI chip for direct analyses in a shotgun lipidomics fashion using high resolution mass spectrometry detection. Alternatively the extract was loaded onto a nanobore column enabling the chromatography separation and localization of individual Lipid species in single MS analyses. In booth modes positive and negative Ion detection was performed to increase the coverage.

Preliminary DataA crucial aspect for a successful analysis is to control the extraction of a defined area on the biological surface of interest. The surface tension of the solvent and the capillary forces had to be optimized for best extraction and ionization efficiency maintaining the highest possible spatial resolution. A mixture of 1/5 Chloroform/Methanol with 5mM Ammonium Acetate for positive mode analyses and 0.005% Methylamine for negative mode worked best. Furthermore the transfer capillary placing the solvent onto the tissue was optimized to have 100um ID and 170 um OD resulting in a 200um spatial resolution for this technique. Using Lipid imaging of specific regions of mice brain hippocampus like the dentate gyrus, the CA1 region or the layers 2/3 of the entorhinal cortex, we identified, quantified and localized several Lipid species including PC,PE,PA,PS,PI,SM, Sulfatide, Cholesterol, FFA and LPA. 1 uL extract allowed the analyses for 20 minutes at a flow rate of 50 nL/min by direct Infusion using the TriVersa Nanomate (Advion BioSciences) coupled to high resolution MS (LTQ Orbitrap, Thermo Fischer) or by MPIS using the QSTAR (ABSciex).In a second experiment 0.5µL – 1 µL of the extract was automatically loaded onto a PVA-SIL nanobore column (YMC) to furthermore separate isobaric compounds in the Lipid extract. In the hippocampus all pyramidal cells express PRG-1 a membrane Protein interacting with lipid phosphate phosphatase (LPP) allowing the enzymatic dephosphorylation of bioactive PA, LPA and S1P. These lipid phosphates play an important role in signaling and are therefore key in cellular processes. We here compare the Lipid composition in the different hippocampus regions of wild type mice and a PRG-1-KO mice using the LESA shotgun and LESA LC-MS approach in positive and negative ionization mode resulting in the most comprehensive and sensitive Lipid imaging method.

Link: www.advion.com


[P195] Proteomics of CAP-Gly proteins-EB1 C-terminal acidic tail interactome.

David Calligaris 1, Marlène Marcellin 2, Claude Villard 1, Lionel Terras 3, Michel O. Steinmetz4, Bernard Monsarrat 2, Diane Braguer 1, Pascal Verdier-Pinard 1, Daniel Lafitte1

1 INSERM UMR 911, Centre de Recherche en Oncologie biologique et Oncopharmacologie; Plateforme Proteomique et Innovation Technologique Timone, 27 boulevard Jean Moulin, 13385 Marseille Cedex 52 Institut de Pharmacologie et de Biologie Structurale , 205 route de Narbonne, 31077 Toulouse3 Synprosis, 59, avenue sainte victoire Zac Saint Charles, 13710 Fuveau4 Biomolecular Research, Structural biology, Paul Scherrer Institut, OFLC/111, CH- 5232 Villigen

Contact: David Calligaris ([email protected])Keywords: Proteins, peptides and small molecules quantification , Signaling, interactomics and post-translational modifications

Microtubule +TIPs constitute a dynamic interaction network where the C-terminal motif EEY/F, common to the +TIPs EB1, CLIP-170 and to α-tubulin binds to the CAP-Gly domains of certain +TIPs such as p150glued (dynactin1) or CLIP-170. This network in involved in cell motility for instance, but the nature and the changes in +TIPs-containing complexes under the influence of different extracellular cues and over time are still to be determined. Towards this goal, we use EB1 C-terminal peptides coupled to beads to isolate CAP-Gly proteins containing complexes from total cell lysates, prior to analysis by mass spectrometry. We synthesized peptidic probes corresponding to the extreme C-terminus of EB1, containing or not the C-terminal tyrosine residue necessary for interaction with CAP-Gly domains, and a cysteine added at the N-terminus to immobilize them on bead surface. Linear and reflectron mode MALDI mass spectrometry analyses of these probes showed a mass spectrum characteristic of each peptide. A major product ion due to a preferential fragmentation at proline N-terminus was present in both spectrums. Therefore, by using direct MALDI-TOF analysis of recombinant CAP-Gly domain binding to these immobilized peptides we observed both the peptide linkage on beads and the specific binding of recombinant CAP-Gly domains on tyrosinated probes. This validation of our peptidic probes warranted their use for the isolation of CAP-Gly proteins containing complexes from total cell lysates. We obtained a first proof of principle showing by Western blotting the specific binding of CLIP-170 from HMEC-1 endothelial cells on tyrosinated EB1 probes. Quantitative mass spectrometry based analysis of revealed proteins associating specifically to EB1 last 15 residues. We will use these tools in different cell models and for the search of inhibitors of this peculiar mode of protein-protein interaction.


[P196] Analyse shotgun du sécrétome de cellules épithéliales pour des applications en toxicologie

Carine Darolles1, Laetitia Chardan1, Stamatiki Roussi1, Jean Charles Gaillard1, Nicole Sage1, Jean Armengaud1, Véronique Malard1

1 Laboratoire de Biochimie des Systèmes Perturbés, SBTN, iBEB, DSV, CEA, BP17171, BAGNOLS SUR CEZE CEDEX 30207

Contact: Véronique Malard ([email protected])Keywords: Systems biology, Clinical proteomics

Le terme sécrétome regroupe l’ensemble des protéines libérées par un système biologique dans des conditions données. La sécrétion des protéines est finement régulée et reflète l’état cellulaire. Les approches les plus récentes en protéomique offrent la possibilité d’identifier la majorité des protéines présentes dans un échantillon biologique mais les difficultés techniques rencontrées sont réelles: gérer la dilution des protéines sécrétées dans les grands volumes de fluides biologiques ou de milieu de culture, discriminer les protéines sécrétées des protéines cytoplasmiques éventuellement relarguées en cas de mort cellulaire, et enfin éviter ou du moins limiter, le masquage des protéines sécrétées par celles initialement présentes dans le fluide biologique ou le milieu de culture, notamment les protéines du sérum. Nous étudions le sécrétome des cellules BEAS-2B, une lignée de cellules pulmonaires humaines immortalisées, en réponse à une intoxication au cobalt, métal toxique induisant diverses pathologies respiratoires et cutanées lors d’expositions professionnelles. Une phase d’optimisation a consisté à tester plusieurs milieux de culture appropriés. Pour chaque milieu sélectionné, l’adaptabilité des cellules a été vérifiée en comparaison avec le milieu recommandé via l’estimation de la prolifération, de la survie, et des observations de profils de cycle cellulaire. Nous avons ensuite analysé en spectrométrie de masse en tandem des échantillons de sécrétome obtenus en absence de cobalt. Suite à ces premières étapes, les échantillons de sécrétomes obtenus en présence de cobalt à une dose faiblement toxique ont été générés dans le milieu optimal pour l’analyse shotgun. Nous avons pu identifier 21 protéines sécrétées signant la toxicité du cobalt. Ces protéines représentent des pistes intéressantes de recherche en toxicologie.


[P197] Autoantibody profiling using immunoproteomic analysis of sera of patients with a new type of autoimmune-like hepatitis occurring after bone marrow transplantation.

Elvire Beleoken1, Rodolphe Sobesky1, Jean-Pierre Le Caer3, Jean-Henry Bourhis4, Mylène Sebagh1, Catherine Guettier1, Catherine Johanet1, Didier Samuel1, Eric Ballot1, Jean-Charles Duclos-Vallée1

1 INSERM U785, Hôpital Paul Brousse, 14 Avenue Paul Vaillant Couturier, 94800 Villejuif, France2 Université Paris-Sud, Faculté de Médecine, 63 Avenue Gabriel Péri, 94270 Le Kremlin Bicêtre, France3 CNRS/Institut de Chimie des Substances Naturelles, 1 Avenue de la Terrasse, 91198 Gif-sur-Yvette Cedex, France4 Institut Gustave Roussy, 39 bis rue Camille Desmloulins, 94800 Villejuif, France5 Laboratoire d'Immunologie, Hôpital Saint-Antoine, 184 rue du Faubourg Saint-Antoine, 75012 Paris, France

Contact: Jean-Charles Duclos-Vallée ([email protected])Keywords: Clinical proteomics

Occurrence of auto-immune-like hepatitis developed de novo is exceptionally reported after bone marrow transplantation (BMT). The purpose of this study is to characterize autoantigens recognized by sera of such patients by using serological proteome analysis. Patients and methods. Three patients (one female, two males) received allogeneic BMT for myelodysplastic syndrom (n=1) or chronic lymphocytic leukaemia (n=2). In the year post-BMT, after stopping the immunosuppressive therapy, they developed an auto-immune-like hepatitis according to the hepatic histological features, different from graft-versus-host disease (GVHD), particularly without bile duct injury. Prothrombin times were between 37 and 100%, aminotransferase levels from 13 to 72 times the upper normal limit and bilirubin from 82 to 270 µmol/L. Serology of viral hepatitis was negative. Sera before and during the autoimmune hepatitis (AIH) occurrence were tested on immunoblots performed with two-dimensional electrophoresis resolved proteins of cytosolic, microsomal, mitochondrial and nuclear fractions obtained from rat liver homogenate. Antigenic targets were identified by mass spectrometry.Results. Immunoreactive spots stained by sera contemporaneous with AIH were more numerous and more intensely expressed than those stained by sera taken before the hepatic disorder for all cellular fractions used as antigen. A great pattern heterogeneity depending on the patient was also noted and a total of 259 spots were stained exclusively by sera taken at the moment of hepatic disorder. 227 spots were actually identified, corresponding to 110 different proteins, some spots being isoforms of the same protein. Thirteen of them were common targets of antibodies present in all patient sera and often found in auto-immune disorders.Conclusion. This is the first immunological description of a new type of de novo-AIH occurring after BMT. The thirteen common antigenic targets differ from those reported in de novo-AIH occurring after hepatic transplantation. The existence of an hepatic variant of GVHD can be put under consideration.


[P198] Two Dimensional SEC / RP Capillary LC for Top-down Proteomics Analysis

Claude Netter1, Robert van Ling2, Evert-Jan Sneekes3, Marco Karsten3, Wim Decrop3, Remco Swart3

1 Thermo Fisher Scientific, 26, avenue Duguay-Trouin, 78960 Voisins le Bretonneux, France2 Thermo Fisher Scientific, , Olten, Switzerland3 Thermo Fisher Scientific, , Amsterdam, The Netherlands

Contact: Claude Netter ([email protected])Keywords: Separative analysis methods

Top-down proteomic LC-MS aims at investigating protein structure and post-translational modifications (PTM) through liquid phase separation and MS analysis of intact proteins. The advantage of top-down approaches over bottom-up approaches is the absence of a proteolytic cleavage step. This keeps all protein information within one molecule and does not multiply sample complexity. However, working with intact proteins introduces challenges for the analytical technology used. Proteins are more difficult to separate than peptides using standard LC methods and more difficult to study by MS. Recently, different electron based dissociation techniques, such as ECD and ETD have been successfully applied to intact proteins to obtain sequence and PTM information. The successful application of these techniques in tandem mass spectrometry for protein mixtures requires a separation step but powerful liquid chromatographic methods for proteins are scarcely published and need to be developed and optimized for direct interfacing with mass spectrometry.In this study we have developed a two dimensional capillary scale LC method for the separation of intact proteins. Proteins are separated and fractionated on a capillary size exclusion column. Next, proteins contained in the size fractions are separated on reversed phase capillary monolithic columns prior to UV and MS detection. The method has been optimized with respect to SEC fractionation and RP gradient conditions for standard proteins and complex mixtures.


[P199] Optimizing Particle Size and Column Length, what is the best way to utilize nano UHPLC in proteomics?

Claude Netter1, Robert van Ling2, Evert-Jan Sneekes3, Karsten Dekker3, Bjorn de Haan3, Remco Swart3

1 Thermo Fisher Scientific, 26, avenue Duguay-Trouin, 78960 Voisins le Bretonneux2 Thermo Fisher Scientific, , Olten, Switzerland3 Thermo Fisher Scientific, , Amsterdam, The Netherlands

Contact: Claude Netter ([email protected])Keywords: Separative analysis methods

The development of UHPLC capabilities on nano LC scale has opened up new ways to provide proteomics researchers with the peak capacity they need for their work. UHPLC principles involve the use of smaller particles allowing faster analysis and/or better resolution; it is usually focused on throughput in small molecule analysis. However in proteomics analysis speed is of lesser concern compared to peak capacity. The increased pressures in UHPLC can be used to support increased column lengths as well. With 25 and even 50 cm columns being implemented in routine applications, the 1 meter barrier has become visible. Here we utilize the full potential of nano UHPLC to determine the effects of smaller particles and column length on protein identification.In this study we used different nano columns at the highest possible pressure to separate a complex tryptic digest. The particle size and the length of the column were varied to create columns that operate at upper end of the system pressure limits. All columns were operated at typical nano flowrates of 200-300 nl/min and directly interfaced (ESI) with a mass spectrometer. The gradient length was varied to determine the optimal gradient for each column length. Peak capacity, sequence coverage and protein identifications were used to determine the efficiency of the separation. A smaller particle, often associated with UHPLC, will generate more backpressure. Therefore a 50 cm long column packed with 2 µm particles already operates at 750-800 bars, which is the upper pressure range of the used nano LC instrument. Increasing the particle size to 3 µm allowed column lengths of 1 meter and operation in the same pressure range. Higher temperatures and smaller particles allow even longer columns. When using these extremely long columns, gradients have to be optimized. Running a too steep gradient will not use the full potential of the column. Only when the gradient length is shallow enough the full length of the column could be utilized and peak capacities approaching 1000 were reached.


[P200] «TFA ion suppression» in LC ESI-MS/MS? Beating the dogma with crushing evidences using nano rapid chromatography.

Virginie Salnot1, Laila Sago1, Patrick Mayeux1, François Guillonneau1

1 Plateforme protéomique Université Paris Descartes 3P5, 22 rue Méchain, 75014 Paris2 INSERM u1016, 22 rue méchain, 75014 Paris3 CNRS UMR 8104, 22 rue méchain, 75014 Paris

Contact: François Guillonneau ([email protected])Keywords: Separative analysis methods, Instrumentation, Proteins, peptides and small molecules quantification

Ion suppression is common knowledge when Trifluoroacetic acid (TFA) is used in LC solvents for ElectroSpray Ionisation-MS/MS. However it should also be common knowledge that TFA acts as a much better counter ion for chromatographic resolution in reverse phase LC due to its hydrophobic properties. We show here that both statements are true; however when stationary phases and chromatographers improve concomitantly, TFA-related ion suppression cease to be a «pain in the MS», while Formic acid (FA) remains limited to low abundance and low complexity samples.In this work we present a results’ comparison from similar samples of various concentrations, analysed either with TFA or FA as counter ions in LC solvents. We show evidences of how greatly peptide retention and LC resolution improve with TFA especially when dealing with abundant (concentrated) and complex samples.



[P201] Targeted Protein Quantification in Clinical Samples Using a New Quadrupole-Orbitrap Mass Spectrometer

Elodie Duriez1, Sébastien Gallien1, Nina Khristenko1, Bruno Domon1, Zhiqi Hao2, Markus Kellmann3, Thomas Moehring3, Andreas Huhmer2

1 Luxembourg Clinical Proteomics Center, 1A rue Thomas Edison, 1445 Strassen, Luxembourg2 ThermoFisher Scientific San Jose, 355 River Oaks Parkway, 95134 San Jose, California3 ThermoFisher Scientific Bremen, Hanna-Kunath-Straße 11, 28199 Bremen, Germany

Contact: Elodie Duriez ([email protected])Keywords: Clinical proteomics

IntroductionFor clinical studies, targeted protein quantification is routinely performed on triple quadrupole instruments. In this study, the performance of a novel hybrid mass spectrometer coupling a quadrupole to an orbitrap mass analyzer was evaluated as an alternative to a classical triple quadrupole approach for the evaluation of biomarker candidates in clinical samples. This new hybrid quadrupole / orbitrap instrument offers true high mass accuracy and high resolution capabilities.

MethodsAnalyses were performed on clinical samples from healthy donors. Sample preparation consisted in protein precipitation, trypsin proteolysis, and desalting on C18 reverse phase cartridges. Analysis were performed on a nano-HPLC system (Dionex, Netherlands) coupled with a new hybrid quadrupole/orbitrap instrument (Q-Exactive, ThermoFisher Scientific). Targeted peptides were selected by the quadrupole and eventually transferred into the orbitrap mass analyzer for quantitative analysis in full scan (SIM) mode. Quantitative experiments involving the MS/MS mode were conducted on several different precursor ions fragmented simultaneously. Quantification was carried out post-acquisition using the elution traces of specific fragment ions. For a study of performance comparison, all the experiments were replicated on a triple quadrupole instrument (TSQ Vantage, ThermoFisher Scientific) operated with intelligent-selected reaction monitoring (i-SRM) mode.

ResultsThe different modes of operation of the new hybrid quadrupole / orbitrap instrument were applied to the targeted analysis of proteins, i.e., in full scan (SIM) mode and in MS/MS mode. In contrast to triple quadrupole experiments, the quantification of the fragment ions is performed post-run and thus no a priori knowledge of MS/MS fragmentation pattern is required to design acquisition method.To establish the analytical performance, dilution series of 30 isotopically labeled reference peptides corresponding to three exogenous yeast proteins and ten endogenous human proteins were performed to determine the limits of detection and quantification, and the linear dynamic range of the method. Preliminary results have shown limits of detection below 100 amol.To evaluate the performance of the instrument in complex biological matrices, the reference peptides were spiked in the digested clinical samples to perform dilution curves. Based on existing calibration curves, the amount of corresponding endogenous protein in clinical samples was precisely determined.

ConclusionThis new hybrid quadrupole / orbitrap instrument has significant advantages for clinical application, especially for the unambiguous detection and precise quantification of a large set of candidates in one LC-MS/MS run.


[P202] MzDB: an optimized file format for the efficient analysis of LC-MS datasets

David Bouyssié1, Matthew Chambers2, Sara Nasso3, Odile Burlet-Schiltz1, Bernard Monsarrat1

1 Laboratoire de protéomique et spectrométrie de masse des biomolécules, IPBS, Université de Toulouse, CNRS, 205 route de Narbonne, 31077 Toulouse2 Department of Biomedical Informatics, Vanderbilt University Medical Center, 400 Eskind Biomedical Library, 2209 Garland Ave Nashville, USA3 Institute of Molecular Life Sciences, University of Zurich, Winterthurerstrasse 190, CH-8057 Zurich

Contact: David Bouyssié ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics, Proteins, peptides and small molecules quantification

To overcome issues related to raw data file access the proteomics community produced data file standards such as mzXML [1] or mzML [2]. Although these new formats simplified data sharing among different laboratories, some authors demonstrated [3,4,5,6] that they were not the most efficient solution for high-throughput data processing, such as MS signal extraction in label-free quantitative methods. In order to speed-up data access, indexing strategies have emerged [6] but have not yet been developed into a portable file format.We propose here a new file format, called mzDB, which is a SQLite file with an optimized index for LC-MS 2D range queries. Data can be easily accessed from any programming language with SQLite bindings (all major languages). The main concept of this work relies on the cutting of MS spectra into slices of a given m/z window. Scan slices belonging to the same m/z window are grouped into an entity called run slice. Indexing data through the run slice structure allows performing fast queries in the m/z and time dimensions. More than 30000 MS peptide ion features were extracted in less than 5min from a raw file corresponding to a complex protein mixture (120min nanoLC-MS acquisition).We developed a C++ program which is able to convert vendor raw files into the mzDB format. To avoid the development of manufacturer specific code we used the C++ ProteoWizard framework [7] which handles the main raw data formats.The mzDB format enables the fast processing of a large number of LC-MS raw files which is a critical point for the analysis of emerging proteomic clinical studies.

1: Pedrioli PG et al., Nat Biotechnol. 2004 Nov;22(11):1459-66.2: Martens L et al., Mol Cell Proteomics. 2011 Jan;10(1):R110.000133.3: Lin SM et al., Expert Rev Proteomics. 2005 Dec;2(6):839-45.4: Askenazi M et al., Nat Methods. 2009 Apr;6(4):240-1. 5: Shah AR et al., J Am Soc Mass Spectrom. 2010 Oct;21(10):1784-8.6: Nasso S et al., J Proteomics. 2010 Apr 18;73(6):1176-82.7: Kessner D et al., Bioinformatics. 2008 Nov 1;24(21):2534-6.


[P203] Spectrométrie de masse et sources d’ionisation atmosphérique : une nouvelle manière d’abordée le couplage chromatographique et l’analyse MS 3D.

Hugues Preud'homme1, Jean-Marc Joumier2, Ryszard Lobinski1

1 Laboratoire de Chimie Analytique Bio-Inorganique et Environnement, 2 avenue Angot, 64053 PAU2 WATERS S.A.S., BP 608, 78056 Saint-Quentin en Yvelines cedex

Contact: Hugues Preud'homme ([email protected])Keywords: Organic and inorganic mass spectrometry, Separative analysis methods, Instrumentation

Afin de répondre aux besoins actuels en énergie dans le monde, l’un des grands défis est de tenter de mieux caractériser les sources d’hydrocarbures non conventionnelles, d’améliorer leurs taux de récupération et d’augmenter la rentabilité des champs matures (Khan et al., 2006). De nombreux procédés capables de favoriser et d’augmenter cette récupération sont élaborés depuis plusieurs années. Cependant, ce n’est que grâce à la description précise d’un gisement (communications inter-puits, hétérogénéités, perméabilités, estimation de la quantité d’huile résiduelle à saturation (SOR), etc.) qu’il est possible de définir et d’optimiser les mécanismes de récupération assistée (injection d’eau, de gaz, de polymères, etc.). La surveillance de molécules ou de contaminants chimiques à l’état de traces représente de nos jours, de vastes applications dans le domaine des sciences analytiques, de l’environnement, le développement et l’utilisation raisonnée de nos ressources. Ces techniques, notamment basée sur les sources d’ionisation à pression atmosphérique, sont désormais reconnues comme l’outil d’investigation de choix pouvant s’appliquer aussi au suivi de la qualité des eaux souterraines et de surface. L’utilisation de méthodes de chromatographies rapides en phase gazeuse ou liquide couplées à des analyseurs de masse utilisant ces sources permettent d’envisager le protocole d’analyse sous un autre angle en minimisant le temps de préparation, voire quelque fois en privilégiant l’analyse directe tout en gardant des performances similaires avec une LOQ< 1ng/g.L’UHPLC/MS-MS pour l’analyse directe de traceurs aromatiques halogénés ou organométalliques peut être réalisée en moins de 5 minutes pour des eaux de gisement présentant des taux de salinités allant de 5g/l à 130g/l. Appliquée à l’analyse d’échantillons réels issus de campagnes de traçage en cours, cette approche analytique originale a permis de remplacer avantageusement la technique de référence basée sur une extraction – dérivation - préconcentration (1h30) avant analyse par GC/MS ou GC/MSMS (1h) pour des performances similaires.Une approche similaire peut être employée pour l’analyse d’organométalliques en milieu aqueux ou la technique de référence est la GC-ICPMS. L’apparition d’une source à pression atmosphérique pour chromatographie en phase gazeuse sur les spectromètres de masse de dernière génération permet de réaliser une approche originale an associant les 3 sources à pression atmosphérique (ESI, ICP et APGC) en travaillant avec des conditions chromatographiques identiques et sans limitation en raison de l’utilisation d’une source à pression réduite. Cela facilite grandement l’alignement des chromatogrammes et permet d’effectuer de confirmer une structure d’un inconnu (ESI/ APGC - MS) avec la spécificité du suivi d’éléments traces et d’une quantification sans standards moléculaires (ICP - MS).

Link: www.lcabie.com


[P204] Comparative analyses of protein expression of strain UBSA 355 - Tistlia consotensis, a new species isolated from a terrestrial saline spring

Carolina Rubiano-Labrador1, Sandra Baena1, Jean Armengaud2

1 Unidad de Saneamiento y Biotecnología Ambiental, Departamento de Biología, Pontificia Universidad Javeriana, Carrera 7 n°40-62, POB 56710, 110121 Bogotá, Colombia2 Laboratoire de Biochimie des Systèmes Perturbés, CEA Marcoule, DSV, iBEB, SBTN, LBSP, BP17171, 30207 BAGNOLS-SUR-CEZE, France

Contact: Sandra Baena ([email protected])Keywords: Systems biology, Proteins, peptides and small molecules quantification , Separative analysis methods

The objective of this study is to analyze qualitatively and quantitatively the expression profile of extra and intracellular proteins of strain UBSA 355 - Tistlia consotensis, under different culture conditions. Tistlia consotensis, is a moderate halophilic microorganism identified as a new species of subclass α-proteobacteria, distantly related to genus Thalassobaculum (90% 16S rRNA gene sequence similarity). The proteomic approach contributes to the knowledge on its metabolic pathways, enzymatic potential and its mechanisms of adaptation to specific conditions of growth. We will evaluate different salinity conditions for growth: 0, 0.5 and 4% NaCl (w/v), which correspond to minimal, optimal and maximum concentrations supported by this strain, respectively. In order to achieve greater coverage of the proteome different proteomic strategies are currently under investigation: two-dimensional electrophoresis (2-DE), multidimensional chromatography coupled to tandem mass spectrometry (Mud-PIT) and 1-D gel electrophoresis followed by nanoLC-MS/MS. As the genome of this microorganism is not yet sequenced, novel approaches to interpret proteomic data are carried out. The proteomic profiles from cells grown in different culture conditions should lead to novel insights into the biological responses related with adaptive mechanisms to salinity stress.


[P205] Le couplage Mobilité Ionique - Spectrométrie de Masse (IM-MS) pour le suivi de changements conformationnels induits par la fixation d’un ligand sur une cible protéique.

Stéphanie Petiot1, Jean-Paul Renaud2, Denis Zeyer2, Valérie Vivat Hannah2, Alain Van Dorsselaer1, Cedric Atmanene2, Sarah Sanglier-Cianférani1

1 Laboratoire de Spectrométrie de Masse Bio-Organique (LSMBO), IPHC, Université de Strasbourg, CNRS UMR7178, ECPM - Bat. R5.0 - 25 rue Becquerel, 67087 Strasbourg2 NovAliX, Structural Biology, Bioparc, Bd Sébastien Brant, BP30170, 67405 Illkirch

Contact: Alain Van Dorsselaer ([email protected])Keywords: Ionic mobility

Le couplage Mobilité Ionique / Spectrométrie de Masse (IM-MS) est technique analytique émergente permettant d’apporter des informations structurales sur la taille et la « forme » d’un complexe supramoléculaire, par le biais de mesures de sections efficaces (CCS). Alors que de nombreux articles utilisent le couplage IM-MS pour suivre des changements conformationnels induits par la fixation de protéines sur des complexes multi-protéiques de hauts poids moléculaires [1,2], peu/pas de données sont disponibles dans la littérature sur les possibilités du couplage IM-MS pour le suivi de changements conformationnels induits par la fixation d’une petite molécule (ligand) sur une protéine. Or, dans bien des systèmes biologiques, des changements structuraux fins sont à l’origine d’activités physiologiques importantes. Des travaux antérieurs nous ont permis de montrer dans le cas de complexes de plusieurs centaines de kDa que des changements de conformation conduisant à une modification de l’ordre de 5% de la CCS pouvaient être mis en évidence avec les instruments commerciaux IM-MS de première génération (Synapt HDMS G1, Waters) [3].L’objectif de ce travail est de montrer que le couplage IM-MS constitue une technique analytique de choix pour détecter des changements conformationnels très fins dans le cas de systèmes protéine/ligand. Nous insistons ici sur l’importance de l’optimisation instrumentale pour l’obtention d’une résolution optimale en mobilité ionique. L’importance de ces paramètres instrumentaux sera illustrée au travers de l’exemple du système protéine/ligand Bcl-Xl/ABT-737. La protéine Bcl-Xl (B-cell lymphoma-extra large) est impliquée dans de nombreux cancers du fait de son caractère anti-apoptotique favorisant la prolifération cellulaire [4]. La molécule ABT-737 a été décrite comme capable d’activer l’apoptose en se liant à Bcl-Xl avec une forte affinité (Ki ≤ 1 nM) [5]. Nos premiers résultats montrent que, moyennant une optimisation des paramètres instrumentaux précise et rigoureuse, le couplage IM-MS permet désormais de détecter des changements conformationnels subtils. [1] Ruotolo BT et al., Nat. Protoc., (2008), 3, 1139-1152.|2] Atmanene C et al., Anal. Chem., (2009), 81, 6364-6373.[3] Atmanene C et al., Anal. Chem. (2010), 82, 3597-3605.[4] Witham J. Clin. Cancer. Res. (2007), 13, 7191-7198.[5] Oltersdorf T et al., Nature. (2005), 435, 677-681.


[P206] Coupling of a linear ion trap with a VUV beamline

Alexandre Giuliani1, Francis Canon1, Matthieu Refregiers1, Laurent Nahon1

1 Synchrotron SOLEIL, L'Orme des Merisiers, 91129 Gif-sur-Yvette2 INRA, U1008 CEPIA, Rue de la Géraudière, 44316 Nantes

Contact: Alexandre Giuliani ([email protected])Keywords: Instrumentation

A novel experimental system for tandem mass spectrometry and ion spectroscopy of electrosprayed ions in a linear quadrupole ion trap using VUV synchrotron radiation is presented. The classical activation methods of the precursor ion in tandem mass spectrometry are usually performed via collisions with a gas. However, photon activation can offer a possibility to selectively release large amount of internal energy into the ions of interest, allowing performing spectroscopy on large isolated biological species, as well as on small ligand molecules forming non-covalent complexes. Trapped ions spectroscopy, however, is a rather challenging task because of the limited ion densities, as well as limited available photon fluxes. The synchrotron radiation MS/MS method implies the following sequence of events: 1) electrosprayed ions are injected, selected and stored in the trap; 2) when the desired ion capacity is reached, the beam shutter opens, thus starting the irradiation; 3) after a desired time of irradiation, the shutter intercept the beam; 4) the mass spectrum is recorded; 5) the monochromator is set to the next wavelength and the procedure is repeated. The present experimental setup for spectroscopy of electrosprayed ions was coupled with the DESIRS beamline at the SOLEIL synchrotron radiation facility. The undulator emission allowed measurements in the 4-20 eV photon energy range. The photon beam can be filtered out for high harmonics using a gas filter. The experimental system was based upon a commercial linear quadrupole ion trap («Thermo scientific LTQ XL»), equipped with the ESI probe. Calculations were performed to conceive an optimal overlap between the beam and the trapping region, regarding the size and divergence of the light beam, as a function of the photon energy and the trap distance from the focal point. The synchrotron beam is introduced into the trap through the back lens of the spectrometer. A special frame has been constructed to allow fine-tuning of the position of the spectrometer, ie of the trapping region, with respect to the light beam. The vacuum manifold with a turbo pumping stage has been designed to accommodate pressure difference between the beamline (10-8 mbar) and LTQ (10-5 mbar). The manifold also includes elements for additional filtering of high order radiation, photon flux measurements and photon beam shutter. The shutter has been designed to achieve short (5-10 ms) and reproducible chopping time under high-vacuum conditions. The most recent obtained results include, for the first time on biopolymers, the photodetachment spectroscopy using first-order synchrotron light of peptide polyanions and the first ionization spectroscopy of polycations. Beside the fundamental interest of accessing physical properties of large biological ions isolated in vacuo, the present work could lead to a new, efficient and powerful MS/MS technique.


[P207] Analyse des réponses hépatiques de l’organisme dénutri : approches protéomiques/transcriptomiques

Thierry Wasselin1, Alain Van Dorsselaer1, Fabrice Bertile1

1 Institut Pluridisciplinaire Hubert Curien, LSMBO, CNRS-UdS, 25 rue Becquerel, 67087 Strasbourg

Contact: Fabrice Bertile ([email protected])Keywords: Systems biology, Clinical proteomics

ContexteLa malnutrition et la dénutrition sont au aujourd’hui au rang des menaces les plus grave pour la santé publique. Pourtant le traitement efficace des patients sévèrement dénutris souffre encore d’un manque de connaissance des réponses physiologiques à la privation de nourriture à long-terme. Le foie est essentiel au maintien de l’homéostasie énergétique, à la synthèse de multiples protéines, à la régulation du métabolisme de certaines hormones… Il est l’un des tissus les plus affectés lors de transitions nutritionnelles. Les fonctions hépatiques sont donc probablement altérées dans de telles situations, risquant de compromettre l’intégrité de l’organisme sur le long-terme. ObjectifsL’objectif de cette étude était d’analyser les effets du jeûne prolongé sur le protéome et le transcriptome hépatiques chez le Rat. Les données ont été analysées en relation avec les transitions métaboliques associées à la réponse au jeûne, en comparant la phase 2 (mobilisation des substrats lipidiques) et la phase 3 (dégradation des protéines corporelles) à l’état nourri.MéthodesLes analyses protéomiques ont combiné électrophorèse bidimensionnelle et spectrométrie de masse (MALDI-TOF-MS). Les analyses transcriptomiques ont utilisé des puces à ADN (Affymetrix). Les données « omics » ont été confirmées par d’autres méthodes (Western-blot et Northern-Blot). Des tests fonctionnels ont été réalisés pour renforcer et valider la pertinence biologique des données « omics ». La significativité des réponses a été testée par ANOVA et tests de Tukey.RésultatsLes données montrent que le jeûne prolongé induit, de façon phase-spécifique, des effets délétères pour plusieurs processus biologiques, incluant les mécanismes de défenses contre le stress oxydatif et les processus de « folding » des protéines, mais aussi les fonctions métaboliques. Les tests fonctionnels ont confirmé que les dommages oxydatifs sont fortement augmentés en phase 3, et que le statut énergétique du foie est alors particulièrement altéré.ConclusionsLes réponses adaptatives rapportées par nos données permettent de proposer que le foie est incapable de maintenir des fonctions saines lors d’un jeûne à long-terme. De telles altérations pourraient tout à fait être ressenties par le système nerveux central, qui en retour pourrait stimuler le comportement alimentaire (caractéristique de la phase 3) afin de promouvoir la survie.


[P208] Characterization of serum proteins interacting with nanoparticles

Arnaud Lamarca1, Christian L. Villiers3, Rachel Couderc3, Philippe Bulet1, Patrice N. Marche3

1 Plateforme Biopark, Bâtiment le Forum, 74160 Archamps2 AGe Imagerie et Modélisation, AGIM/UJF CNRS FRE 3405, Pavillon Taillefer, Faculté de medecine de Grenoble, 38706 La Tronche3 Immunologie analytique des pathologies chroniques, INSERM/UJF U823, Rond point de la chantourne, 38706 La Tronche

Contact: Arnaud Lamarca ([email protected])Keywords: Systems biology, Separative analysis methods, Signaling, interactomics and post-translational modifications

Background: The present study has been conducted in line with Cellnanotox (European program). It has already been shown that nanoparticles (NP) can enter the cells, and interfere with the immune system. We previously showed that noncytotoxic, gold NPs significantly modified cytokine secretion (1). During their trafficking through the bloodstream, NPs interact with many plasmatic proteins that may facilitate their interaction with cellular receptors leading to endocytosis or phagocytosis.

Methods: NPs were incubated with fresh human plasma. The plasma proteins trapped by the NPs were subjected to trypsin digestion. The digest was analyzed by direct mass fingerprinting (PMF) with MALDI mass spectrometry (MS). To identify and characterize the NPs interacting plasma proteins, the digest was purified by liquid chromatography,and the different peptides were sequenced by tandem mass spectrometry (MS/MS). Data bank (ExPASy, SwissProt) was interrogated under MASCOT.

Results: We have investigated the interaction of gold and ferricobalt (FC) NPs with human plasma proteins using direct proteolysis and in gel digestion. For gold NPs we observed that plasma proteins from the complement cascade were attached to the NPs, especially opsonin molecules. Different immunoglobulins were identified; among them some are known to interact with pathogen-internalization receptors. In parallel, we used the same strategy using FC NPs in order to determine the specificity of the interactions. We demonstrated, thanks to the differential PMF, that the composition of the NPs can discriminate between human plasma proteins for the interaction.

Conclusion: This study established that NPs, when incubated in fresh human serum, could easily trap circulating proteins involved in processes such as opsonisation and internalization of «foreign elements». This suggests that NPs may interact specifically with cells involved in the immune response. Our goal is to demonstrate if coated proteins are important for NPs internalization and for potential ensuing modification of biological activities.

References: (1) Villiers, L.C., et al. Analysis of the toxicity of gold nanoparticles in the immune system: effect on dendritic cell functions. J Nanopart Res. 2010. 12:55-60


[P209] Identification des cibles protéiques des voies de la thioredoxine et de la glutathione dans les cellules humaines par une stratégie ocSILAC

Giovanni Chiappetta1, Sega Ndiaye1, Michel Toledano2, Joelle Vinh1

1 Spectrométrie de masse biologique et protéomique, USR3149, ESPCI, 10 Rue Vauquelin, 75005 Paris2 LSOC, CEA , Saclay, 91191 Gif-sur-Yvette

Contact: Giovanni Chiappetta ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Introduction. L’identification des proteinse impliquées dans les voies GSH et Trx chez les mammifères est une étape clé pour comprendre les mécanismes moléculairesulés par la biochimie rédox des thiols (1). Dans le but de caractériser l’état d’oxidation des soufres du protéome et le profil d’expression protéiques dans des cellules HELA dans lesquelles l’expression de la thioredoxine reductase 1(TRR1) ou la GSH est inhibée, nous avons développé une stratégie pour localiser les cystéines oxidées et, simultanément, générer les profils d’expression des protéines. Cette stratégie, basée sur la technologie SILAC, est nommée ocSILAC.

Méthodes. La synthèse de GSH est inhibée dans les cellules HELA par exposition 24h à la L-buthionine-[S,R]-sulfoximine. L’expression de la TRR1 est inhibée par des ARNi. Après lyse cellulaire, notre procédure de marquage des soufres impliquant de l’acide trichlorioacétique est utilisée (2). Les soufres réduits sont alkylés avec l’iodoacétamine, et les soufres oxydés sont spécifiquement marqués par le (N-(6-(Biotinamido)hexyl)-3'-(2'-pyridyldithio)-propionamide (biotine-HPDP).

Résultats. La stratégie ocSILAC a été conçue pour enrichir spécifiquement les peptides contenant les cystéines oxydées dans des extraits cellulaires, après un marquage SILAC. Pour cela, 1) les cystéines oxidées sont marquées spécifiquement par la biotine-HPDP; puis 2) les analyses LC MSMS des fragments biotinylés sont réalisées, permettant de suivre l’oxidation des soufres dans deux états cellulaires différents. En raison des changements dans les niveaux d’expression protéiques, qui peuvent induire des biais, les données sont normalisées avec le profil d’expression protéique en utilisant les analyses LC MSMS de la fraction de peptides libres comme référence. La stratégie ocSILAC a été utilisée pour étudier les lignées cellulaires dans lesquelles TRR1 et GSH ont été inhibées. En utilisant cette stratégie, nous avons évalué l’état rédox de plus de 400 résidus cystéine, et quantifié plus de 300 protéines.

Conclusion. ocSILAC est une alternative valide à la stratégie SILAC pour suivre l’oxidatin des soufres (3,4). Le point fort decette stratégie est la possibilité de suivre en même temps les profils d’expression protéiques et le niveau de modifications post-traductionnelles. L’interprétation biologique des données obtenues dans les lignées cellulaires n’exprimant pas GSH et TRR1 est en cours.

References1. Toledano, M.B., et al. (2007). FEBS Lett. 581, 3598–607. 2. Delaunay, A., et al. (2000). EMBO J. 19, 5157–166.3. Leichert LI et al. Proc Natl Acad Sci U S A. 2008 105(24):8197-202.4 Fu C. et al. Mol Cell Proteomics. 2009;8(7):1674-87.


[P210] EIF3 subunits interaction study by hydrogen/deuterium exchange FT-ICR mass spectrometry

Jianqing Wu1, Pierre-Damien Coureux2, Edith Nicol1, Emmanuelle Schmitt2, Yves Méchulam2, Guillaume van der Rest1

1 Laboratoire des Mécanismes Réactionnels, CNRS, UMR7651, Ecole Polytechnique, 91128 Palaiseau, France2 Laboratoire de Biochimie, CNRS, UMR7654, Ecole Polytechnique, 91128 Palaiseau, France

Contact: Jianqing Wu ([email protected])Keywords: Systems biology, High mass and high resolution mass Spectrometry

Cellular cycle is highly regulated to optimally respond to any extracellular stimuli. Transcriptional control has been well studied to identify the components (proteins, RNA, small molecules) involved in that regulation. However, it seems that the mRNA translation is also very well controlled during gene expression. Moreover, the most regulated step occurs during translation initiation, the rate limiting step in protein biosynthesis. This particular step involves the small subunit of the ribosome and many eukaryotic proteins called translation initiation factors (eIF). Among those, the eIF3 complex plays a crucial role in the architecture of the translation initiation complex and is an important target for drug design. Our studies focused of the eIF3 complex of yeast: made of only 5 subunits, it’s a simplified form of the human eIF3 complex (made of 13 subunits). Most of the published data of this complex comes from biochemical and cellular studies, but very little is known of the structural organization of the eFI3 complex. We are currently studying the interactions of 3 subunits of the yeast eIF3 complexes: eIF3i (37 kDa), a domain of eIF3b (11.3 kDa) and a domain of eIF3g (16 kDa) using the bottom-up approach of amide hydrogen/deuterium exchange (HX) combined with FT-ICR mass spectrometry (MS).

HXMS is a powerful tool in protein structure and interaction studies. According to our liquid chromatographic results, while eIF3bC3 and eIF3gC1ΔC does not interact with each other, they can both form dimer complex with eIF3i, and a trimer complex is formed with the present of the three subunits. In the HXMS approach, the individually synthesized subunits were deuterated and then digested by pepsin, followed by immediate nanoLC separation at 0 ºC and FT-ICR-MS analysis to reduce the back-exchange to hydrogen. The deuteration levels of specific peptides at different reaction times were obtained by extracting the mass shifts between deuterated and unlabelled peptide, which leaded to a kinetic curve of the amide exchange for this peptide. A higher level of deuteration reflects either an easier accessibility to the solvent, or a less stable secondary structure. In addition, by comparing the deuteration level of peptides from the isolated subunits and the complexes, the interaction sites can be revealed, as a change in accessibility is expected to arise from quaternary structure formation.

Adequate sequence coverage was achieved using this set-up of nano-flow liquid chromatography system associated with the high sensibility FT-ICR-MS. In addition, the high mass accuracy of FT-ICR-MS enables direct peptide identification of large-size protein complexes based on exact mass and retention times without further need for systematic tandem MS analysis. These are crucial for this protein structural and interaction study in the absence of any crystallographic information.


[P211] Structural analysis of complex lipids using MALDI SpiralTOF-TOF with high precursor ion selectivity

Ayumi Kubo1, Yoshiyuki Ito1, Masahiro Hashimoto1, Masaaki Ubukata2, Jun Tamura1, Jyun Onodera1, Akihiko Kusai3

1 JEOL Ltd., 1-2, Musashino 3-Chome Akishima, 196-8558 Tokyo, Japan2 JEOL USA, Inc., 11 Dearborn Rd., 01960 Peabody, MA USA3 JEOL (EUROPE) SAS, Espace Claude Monet - 1, Allée de Giverny, 78290 Croissy-sur-Seine, France

Contact: Akihiko Kusai ([email protected])Keywords: High mass and high resolution mass Spectrometry, Instrumentation, Systems biology

Structural analysis of lipids is often performed with LC-MS/MS such as ion trap mass spectrometer and quadrupole-TOF hybrid tandem mass spectrometer. These tandem mass spectrometers can observe product ion mass spectra produced by the low-energy collision induced dissociation (LE-CID) at the laboratory frame collision energy of below a few hundred electron volts and obtain some structural information of the analytes. Detailed information of the fatty acid moieties in the analyte molecules, however, cannot be obtained. In contrast, high-energy CID (HE-CID) can cleave C-C bonds and provide detailed information of the fatty acids moieties, such as the positions of double-bonds, branching, and hydroxylation by means of charge-remote fragmentation. The MALDI TOF-TOF combined a SpiralTOF [1] and an offset parabolic reflectron for first and second TOFMS, respectively has been developed. The SpiralTOF, which has 17 m flight path, can select a monoisotopic ion so that each fragment pathway is observed as single peak on product ion spectrum. Furthermore, PSD ions are eliminated by electrostatic sectors inside the SpiralTOF. As a result, fragment pathways using HE-CID are preferentially observed on product ion spectrum. In addition, the SpiralTOF-TOF has a high precursor ion selectivity to catch up a monoisotopic ion.In this study, we report structural analysis of lipids by HE-CID using MALDI-SpiralTOF-TOF tandem MS with high precursor ion selectivity.

[1] Satoh, T.; Sato, T.; Tamura, J. J. Am. Soc. Mass Spectrom. 2007, 18, 1318.

Link: www.jeol.com


[P212] Combining Top down and Bottom up analyses in a single LCMS experiment

Frank Porbeck1, Reinaldo Almeida2

1 Advion BioSciences, Ltd, Koa Hockham Building, CM20 2NQ Harlow,UK2 University of Southern Denmark, Department of Biochemistry and Molecular Biology, Campusvej 55, 5230 Odense,Denmark

Contact: Frank Porbeck ([email protected])Keywords: Separative analysis methods, Signaling, interactomics and post-translational modifications, Instrumentation

In this work we use «bottom up» and «top down» analyses by combining online LCMS with nanoESI infusion for the identification of proteins and characterizing their post-translational modifications during the brewing process. The intact mass measurement and primary sequence determination was performed by online UPLC-MS(MS) with simultaneous fraction collection. The «top down» affords the post-translational modification observation after the UPLC-MS run by automated nanoESI infusion of the previously collected fractions. Since nanoESI consumes just a small amount of the analyte, proteolytic digestion was performed on the remaining sample for «bottom up» analyses. This strategy allows us to full characterise proteins involved during brewing, by intact mass determination, PTM characterisation and the corresponding peptide sequence coverage in a single LCMS experiment.The combination of intact protein chromatography by UPLC with a post column splitting system, showed equal separation power and signal to noise ratio, in comparison with the standard non splitting set up. During the online top down analyses the intact mass could be determined by deconvoluting the charge state envelop. However many proteins have been detected but not identified or with low confidence due to the limited time during the elution. These proteins where then targeted during the offline analyses of the previous collected fractions for fop down MS/MS, but also for intact mass determination of very low abundant species. The offline analyses allowed an unlimited averaging capability and optimisation due to the low sample consumption of nanoESI as well as the specific targeting of post translational modifications. Each protein fraction was then digested and reanalysed by offline bottom up, giving again unlimited time for optimising the condition and averaging during the analyses of the corresponding peptides. The good UPLC separation of the intact proteins lead that the peptides identified in each fraction can just correspond to the proteins found by the top down approach previously, adding another confidence level to the analyses. Furthermore the complexity in each fraction is reduced in a way that no 2 dimension chromatography run is needed. The combined top down and bottom up results facilitated the interpretation of unknown proteins as well as post translational modifications.



[P213] Photoionisation a pression atmospherique de polymeres synthetiques

Véronique Legros1, Bernard Desmazières2, Alexandre Guiliani3, William Buchmann1

1 Université d'Evry val d’Essonne (LAMBE, UMR 8587), Bâtiment Maupertuis, Bd. François Mitterrand, 91025 Evry, France2 Global Bioenergies, 5 rue Henri Desbruyeres, 91030 Evry, France3 DISCO beamline, Synchrotron SOLEIL , L’Orme des Merisiers, Saint-Aubin, 91192 Gif-sur-Yvette, France

Contact: William Buchmann ([email protected])Keywords: Organic and inorganic mass spectrometry, Separative analysis methods

La photoionisation à pression atmosphérique (APPI) est une technique d’ionisation prometteuse pour l’analyse par spectrométrie de masse des polymères synthétiques. Cette technique consiste à nébuliser une solution contenant l’échantillon à analyser, à pression atmosphérique, puis à ioniser l'échantillon à l’aide de photons émis par une lampe dans l’UV. Couplée à des techniques de séparation liquide, elle peut fournir de nouvelles opportunités pour la caractérisation des polymères, tout spécialement pour les polymères de faible poids moléculaire, ou pour les polymères difficilement ionisables par les méthodes d’ionisation habituelles (MALDI, ESI), typiquement les polymères les moins polaires. En effet, à la différence de la technique ESI, la technique APPI permet l’utilisation de solvants de faible polarité nécessaires pour dissoudre les polymères les plus apolaires. Le processus d’ionisation en phase gazeuse rend possible l’ionisation de ces espèces, pour lesquels les techniques ESI et MALDI pourraient se révéler inefficaces. Les spectres de masse sont relativement simples à interpréter, puisque seuls des ions monochargés sont générés. Ainsi il n’y a pas de superposition possible entre différents états de charge comme c’est le cas en ESI. Toutefois, des fragmentations peuvent se produire. Un intérêt majeur de l’APPI réside aussi dans sa capacité à pouvoir jouer le rôle d’interface avec les principales méthodes chromatographiques. La compatibilité avec un plus large panel de solvants qu’en ESI permet d’envisager des couplages, suivants les principaux modes chromatographiques: phase inverse, phase normale, et chromatographie d’exclusion stérique. Par principe, le couplage LC/MS apporte de nombreux avantages : il permet l’identification des composés dans les pics chromatographiques sans ambigüité, limite les effets de suppression de signal et les superpositions entre les espèces isobares, problème fréquemment rencontré avec les méthodes MS directes. Si la technique APPI semble prometteuse pour l’analyse des polymères, les mécanismes d’ionisation (ou de fragmentation) ne sont en revanche pas encore bien compris. Pourtant la compréhension de ces mécanismes, est essentielle pour obtenir une estimation fidèle des poids moléculaires moyens et des indices de polymolécularité. Les sources commerciales APPI utilisent typiquement des lampes Krypton dont l’énergie des photons est prédéterminée (10eV et 10.6eV). Dans ce contexte, le comportement en APPI de divers polymères standards (polyéthers, polyméthylmétacrylate, polysiloxane, polystyrène…) sera abordés au travers de quelques exemples. Les mécanismes d'ionisation ont notamment été étudiés en utilisant le rayonnement synchrotron SOLEIL qui offre l'opportunité de pouvoir étudier le phénomène d’ionisation en fonction de l'énergie du photon.

Link: http://www.lambe.univ-evry.fr/


[P214] Liquid chromatography-mass spectrometry assay for the identification and absolute quantification of the apelin peptides in human plasma and bovine colostrum.

Cédric Mesmin1, François Fenaille1, François Becher1, Eric Ezan2

1 CEA, iBiTec-S, Service de Pharmacologie et d’Immunoanalyse, CEA Saclay, Bât 136, SPI/LEMM, 91191 Gif sur Yvette2 CEA, iBEB, Service de biochimie et toxicologie nucléaire, CEA Marcoule, BP 17171, F-30207 Bagnols-sur-Cèze

Contact: Cédric Mesmin ([email protected])Keywords: High mass and high resolution mass Spectrometry, Proteins, peptides and small molecules quantification

Apelin peptides are of great interest owing to their involvement in physiological and pathological processes and have been proposed as novel biomarkers for heart failure. The main circulating forms have been reported as bearing the 12 (apelin-12), 13 (apelin-13), 17 (apelin-17) and 36 (apelin-36) C-terminal amino acids of the 55-aminoacid proapelin. Immunoassays are the most widely used method to quantify apelin peptides in biological fluids. They commonly involve antibodies targeted against their common C-terminal part. Using such tests that cannot discriminate one form from the others, a wide range of plasmatic concentrations has been reported, i.e. from 20 to 4000 pg/mL. Such concentration range as well as the inability to individually quantify each form prevents the clinician from easily distinguishing healthy subjects from patients with a known heart failure and identifying a clear biomarker. Therefore, we have recently developed a multiplexed liquid chromatography-tandem mass spectrometry (LC-MS/MS, MRM mode) method to simultaneously quantify the 5 putative apelin peptides in human plasma. Ten different plasma samples were analyzed both with a commercial immunoassay and our mass spectrometric method. Immunoassay have revealed immunoreactive apelin concentrations around 200-400 pg/mL in theses samples. However, despite the high level of sensitivity of our approach in the pg/mL range, we were not able to detect any of the expected apelin peptide.These results question the nature and/or the concentration of circulating apelin peptides as well as the specificity of the immunoassays that have hitherto been used for clinical applications. Determination of these forms in human plasma is a particularly challenging task and is currently ongoing in our laboratory, due to the low concentrations of these peptides. An untargeted approach involving both high-resolution/high-mass accuracy mass spectrometry (LTQ-Orbitrap) and carefully optimized extraction methods has been used to identify potential circulating forms. In parallel, the same untargeted approach has been applied to bovine colostrum, a matrix known to contain high apelin levels (~ng/mL). The untargeted method efficiency was proved by highlighting 48 different endogenous apelin peptides in bovine colostrum. Eleven of those peptides were consistently observed in all the colostrums tested but each of the 48 forms has highly variable relative abundances. Based on these results and complementary data obtained following degradation of apelin-55 in plasma, we are now developing a multiplexed LC-MRM assay targeting more than 20 putative forms for a more sensitive screening of apelin peptides in human plasma.During this presentation, we will show how mass spectrometry techniques can represent useful and efficient tools to identify and further quantify biomarkers in biofluids.


[P215] Identification of liver immuno-markers in hepatocellular carcinoma

M. Ramzan1, N. Sturm1, K. Arafah2, P. Arvers3, E. Jouvin-Marche1, J-P. Zarski1, V. Leroy1, F. Berger1, P. Bullet2, P. Marche1

1 Immunologies Analytiques des pathologies chroniques, Inserm/UJF U823, Rond-point de la Chantourne, 38706 La Tronche2 Plateforme BioPark, Bâtiment LE FORUM, 74160 Archamps3 Institut de recherche biomédicale des armées, CRSSA, Avenue des Maquis du Grésivaudan, 38702 La Tronche4 Laboratoire de Nanomédecine et cerveau, Inserm/UJF U836, Chemin Fortuné Ferrini, 38706 La Tronche5 AGe Imagerie et Modélisation, AGIM/UJF CNRS FRE 3405, Pavillon Taillefer, Faculté de médecine de grenoble, 38706 La Tronche

Contact: K. Arafah ([email protected])Keywords: Clinical proteomics, Imaging mass spectrometry

Background: Hepatocellular carcinoma (HCC) incidence is increasing worldwide. Most HCC occur in chronic hepatitis associated to liver inflammation with increases of liver infiltrating lymphocytes (LILs) outside the tumor: A molecular characterization of LIL associated to HCC cirrhotic liver requires screening precise histological regions (lymphoid aggregates, portal tracts and septa).

Methods: HCC livers, 18 patients infected by hepatite C virus (HCC-HCV) and 16 abusing alcohol (HCC-OH), were analyzed with anti-CD3, -CD4, -CD8 and -CD20 antibodies for determining LILs in fibrous septa (FS) and parenchymatous (Pa) nodules of cirrhotic zones (CZ). The proteomes of CZ were analyzed by SELDI-MS. Statistical tool (PLS-DA) highlighted the differential ion markers obtained in the 2 patient groups. The relevant peaks were detected by liquid chromatography (LC) MALDI-MS in tissue lysates and investigated by MALDI imaging (MSI).

Results: Most of LILs found inside the FS and less abundant in the Pa. LILs were higher in the CZ of HCC-HCV than of HCC-OH group. SELDI-TOF-MS analysis showed homology of protein profiles between sample duplicates. Among 105 identified peaks, 16 were more and 9 were less abundant in HCC-HCV vs HCC-OH group. Variable Importance for the Projection (VIP) plot combining molecular and cellular parameters showed highly significant parameters including the 4 types of LILs described beyond and 2 clinical parameters. Highest VIP scores showed 3 protein ions significantly more expressed in HCC-HCV than in HCC-OH group clustered with CD3 and CD8 cells. High numbers of CD8 cells were also associated with tumor recurrence. In parallel, LC MALDI-MS and MSI on liver slices yielded to convergent data.

Conclusion: Orthogonal proteomics allowed molecular identification of potential markers in HCC. MSI gives complementary results about tissue distribution of markers inside the LILs and is indicative of HCC recurrence after liver resection, providing new insights in prognosis.


[P216] Non linear effects on Kinetic Method Measurements

Sandrine Bourgoin-Voillard1, Denis Lesage1, Carlos Afonso1, Françoise Fournier1, Emilie-Laure Zins2, Claude Pepe2, Peter B. Armentrout3, Jean-Claude Tabet1

1 Institut Parisien de Chimie Moléculaire (UMR CNRS 7201) - FR 2769 UPMC univ Paris 06, 4 place Jussieu, 75005 Paris2 Laboratoire de Dynamique Interactions et Réactivité LADIR (CNRS UMR 7075), UPMC univ Paris 06, 4 place Jussieu, 75005 Paris3 Department of Chemistry, University of Utah, , Utah 84112 Salt Lake City, USA

Contact: Denis Lesage ([email protected])Keywords: Organic and inorganic mass spectrometry

The original Cooks’ kinetic method was the landmark for comparisons of thermochemical data by tandem mass spectrometry.[1] It constitutes an elegant approach for the determination of thermochemical data such as proton affinity (PA) and gas-phase acidity (ΔH°acid). The method is based on the dissociation of heterodimers and the PA or ΔH°acid of functionalized compounds (A0) is obtained relative to reference compounds (Ai) with known PA or ΔH°acid values.In the literature, several non-linear effects have been evidenced upon the use of the kinetic method. In fact it has been shown by Vékey and Drahos that the first kinetic method plot (ln(k1/k2 vs ΔH°)) is not strictly linear.[2] Such non-linearity necessarily induces a reduction in the accuracy of the measurements as they are based on linear regression analyses. This behavior appeared to be very strong for small molecules presenting a large entropy effect. This non-linear deviation is reinforced at high activation energies. Non-linear deviations have been also evidenced in the second kinetic method plot (e.g. GAapp(A0) vs Teff). These non linear effects have been interpreted as resulting from artifacts occurring at high or low energy conditions[3] or resulting from the existence of various isomeric forms within the dimer.[4] In this work, we are interested in non-linear effects occurring in the second plot used for the extended kinetic method treatment. The example discussed herein concerns ΔH°acid determination of substituted phenols. Phenolic compounds have been investigated to determine their thermochemical properties. In particular, we report here, ΔH°acid and ΔΔS° values of halogenated phenols determined by proton exchanges with carboxylic acids. In addition, experimental data have been compared with those obtained from DFT calculations and RRKM simulations using Crunch[5] and Masskinetics[6] softwares. It is shown that the approximations done and experimental conditions required to apply the extended kinetic method are not always consistent with those advised by the method.

[1] Cooks RG and Kruger TL, J. Am. Chem. Soc., 1977, 99: 1279[2] Drahos L and Vekey K, J. Mass. Spectrom., 2003; 38: 1025Drahos L, Peltz C and Vékey K, J. Mass. Spectrom., 2004; 39: 1016[3] Wenthold PG, J. Am. Soc. Mass Spectrom. 2000; 11, 601[4] Fournier F, Afonso C, Fagin AE, Gronert S and Tabet JC, J Am Soc Mass Spectrom 2008; 19 (12), 1887[5] Rodgers MT and Armentrout PB, J. Chem. Phys., 1997; 106, 4499[6] Drahos L and Vékey K, J. Mass Spectrom., 2001; 36: 237


[P217] The Dictyostelium macropinocytic proteome: a step towards a deep analysis of macropinocytosis dynamics

Agnès Journet1, Sabine Brugière1, Agnès Chapel1, Syvie Kieffer1, Christophe Bruley1, Yves Vandenbrouck1, Christophe Masselon1, Gérard Klein1, Laurence Aubry1

1 CEA, IRTSV, Laboratoire Biologie à Grande Echelle , 17 rues des martyrs, 38054 Grenoble, France2 INSERM, U1038, , 38054 Grenoble, France3 Université Joseph Fourier, , 38000 Grenoble, France

Contact: Sabine Brugière (sabine.brugiè[email protected])Keywords: Systems biology, High mass and high resolution mass Spectrometry, Bioinformatics et biostatistics dedicated to proteomics

Dictyostelium discoideum is a simple haploid eukaryote that shares many functions and molecular features with macrophages and dendritic cells, in particular their endocytic capacities (phagocytosis and macropinocytosis). Endocytosis serves various functions ranging from the internalization of nutrients to the regulation of signaling cascades by altering the accessibility of membrane signaling receptors to their downstream effectors. Because of its phylogenetic proximity with higher eukaryotes and the conservation of the protein networks underlying the endocytic process, identification of the repertoire of Dictyostelium proteins residing on or associated with the macropinocytic pathway is of immediate interest to further dissect this essential mechanism. As a preliminary step to this goal, we established the inventory of proteins implicated in the macropinocytic pathway by using a magnetic purification procedure resulting in a high degree of purity, coupled to a mass spectrometry-based proteomics. Dictyostelium macropinocytic compartments were isolated after loading with colloidal iron and then purified on a magnet as described in [1]. Proteins were separated by electrophoresis on denaturing gels and subjected to in-gel trypsin digestion. MS-MS data were acquired on an LTQ-Orbitrap mass spectrometer coupled to a nano-HPLC. 103 analyses were performed including technical replicates. Mascot search results were filtered using a two-step process leading to an overall false discovery rate of 1.95% at the peptide level. Filtering and grouping of the multiple occurrences of a particular peptide led to an inventory of 18,395 distinct peptides corresponding to a final list of 2,251 non-redundant proteins, the DdEndo list (deposited in the Pride database). Bioinformatics analyses indicated that the most abundant proteins present in this list associated with signaling, vesicular trafficking and cytoskeleton. 23% featured membrane-spanning domains while around 30% were without any references, neither annotations nor associated prediction. Compared with recent studies [2, 3], the DdEndo list displays an enhanced depth of coverage, in particular for membrane-embedded proteins, validating our purification method. The building of this library of peptide identifications enables further high throughput label-free quantitative analyses and paves the way for a future organellar proteomics approach of the dynamics of macropinocytosis.

1. Aubry, L., Klein, G., Purification techniques of subcellular compartments for analytical and preparative purposes. Meth. Mol. Biol. 2006, 346, 171-185.2. Boulais, J. et al., Molecular characterization of the evolution of phagosomes. Mol. Syst. Biol. 2010, 6, 423.3. Gotthardt, D. et al., Proteomics fingerprinting of phagosome maturation and evidence for the role of a Galpha during uptake. Mol. Cell. Proteomics 2006, 5, 2228-2243.


[P218] Chloroplast quantification: use of a software environment – hEIDI - for the management and the exploration of MS/MS data

Claire ADAM1, Myriam FERRO1, Véronique DUPIERRIS1, Anouk EMADALI1, Magali COURT1, Christophe BRULEY1, Norbert ROLLAND2, Daniel SALVI2

1 CEA, iRTSV, Laboratoire d’Etude de la Dynamique des Protéomes, Grenoble, F-38054, France ; INSERM, U880, Grenoble, F-38054, France ; Université Joseph Fourier, Grenoble, F-38054, France, 17 rue des Martyrs, 38000 Grenoble, France2 CEA, iRTSV, Laboratoire de Physiologie Cellulaire Végétale, Grenoble, F-38054, France ; CNRS, UMR5168; INRA, UMR1200, F-38000 Grenoble, France; Université Joseph Fourier, Grenoble, F-38054, France, 17 rue des Martyrs, 38000 Grenoble, France

Contact: Claire ADAM ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics, Proteins, peptides and small molecules quantification

Many proteomic investigations imply sample fractionation and/or different sample preparation, in order to get the best proteome coverage. Consequently many analyses are likely to be generated in the context of a specific project and the many corresponding results (identifications, quantification etc.) have to be compiled. In order to manage both identifications and spectral counts related to several LC-MS/MS analyses, we developed a software suite dedicated to Mascot-generated results. A first module called IRMa (Identification of Results from Mascot ; Dupierris et al ., Bioinformatics, 2009) allows both automatic and manual validation of Mascot identification results corresponding to a single analysis. Validated results can be exported either in documents (Excel or PDF formats) or in a relational database. The so-generated documents can be customized in order to contain information (list of peptides, false positive rate, annoted spectra etc.) that is compliant to proteomics journals guidelines. If IRMa validated results are stored in a relational database a second module called hEIDI (Exploration and Interpretation Data Identification) is able to handle multiple analyses. Using a user-friendly interface hEIDI allows different analyses to be compiled in order to retrieve the list of non-redundant protein groups. Moreover hEIDI allows direct comparison of groups of analyses to be performed, on the basis of the protein groups and of spectral counting. This is of particular interest if one wants to compare two pools of samples (mutant vs. wild type strains ; test of analytical conditions etc.).The versatility of such a tool will be presented through the quantitative analyses of chloroplast sub-fractions. This experiment represents around 500 LC-MS/MS analyses performed on a high resolution mass spectrometer that have been used to set up the AT_CHLORO database (http://www.grenoble.prabi.fr/at_chloro/). This database stores information for proteins identified in different sub-fractions obtained from A. thaliana chloroplasts (Ferro et al., 2010), in particular subplastidial localization. To obtain this localization, highly purified fractions of envelope, stroma and thylakoids were obtained and spectral counting was used to classify proteins according to their sub-plastidial localization. Using statistical analysis, the localization of 819 proteins, that are present in the AT_CHLORO, was determined.

Link: http://biodev.extra.cea.fr/docs/heidi


[P219] High-throughput proteogenomics of an extra large group of marine microorganisms

Joseph Alexander Christie-Oleza1, Guylaine Chaussinand1, Jean Armengaud1

1 Laboratoire de Biochimie des Systèmes Perturbés, CEA Marcoule, DSV, iBEB, SBTN, LBSP, BP17171, 30207 BAGNOLS-SUR-CEZE, France

Contact: Joseph Alexander Christie-Oleza ([email protected])Keywords: Systems biology, Bioinformatics et biostatistics dedicated to proteomics

The structural and functional annotation of microbial genomes is nowadays relying on automatic pipeline systems. The key for an accurate annotation consists in blending biochemical evidences to the genome interpretation. In this work we applied high-throughput proteogenomics to a member of the abundant group of marine bacteria, Roseobacters, as a seed to better annotate the whole clade. We extensively characterized the proteome of Ruegeria pomeroyi by searching over 1.1 million MS/MS spectra against a six-frame translated genome database. A large dataset of peptides (over 600,000 assigned MS/MS spectra) was obtained. We identified 2006 polypeptides among which 34 are encoded by Open Reading Frames (ORFs) that had not previously been annotated. From the pool of «one-hit-wonders», i.e. those ORFs specified by only one peptide detected by tandem mass spectrometry, we could confirm the probable existence of five additional new genes after proving that the corresponding RNAs were transcribed. We also evidenced the most N-terminal peptide of 486 polypeptides from which 64 were at first badly annotated. By extending these re-annotations to the other 36 Roseobacter isolates sequenced till date (ortho-proteogenomics), we propose the correction of the assigned start codons of 1,082 homologous genes in the clade. Moreover, we evaluated the genome expression of Ruegeria pomeroyi under several natural environmental conditions revealing the versatility of the bacterium to adapt to anthropogenic influence, poor nutrient concentrations or the presence of the natural microbial community. Comparative proteogenomics consisting in the analysis of several Roseobacter strains opens new perspectives for improvements of genome annotation. Our proteogenomic efforts will increase reliability of future annotation of marine bacteria genomes.


[P220] Multiplex ligand fishing in human plasma using SUPRA-MS approach : Surface Plasmon Resonance Array – Mass Spectrometry

Fabien Remy-Martin1, Marven El Osta2, Géraldine Lucchi2, Rabah Zeggari1, Alain Rouleau1, Thérèse Leblois1, Wilfrid Boireau1, Patrick Ducoroy2

1 FEMTO-ST MN2S Université de Franche-Comté, 32 rue de l'Observatoire, 25000 Besançon2 CLIPP IFR100 CHU Université de Bourgogne, 1 rue du Professeur Marion, 21000 Dijon

Contact: Marven El Osta ([email protected])Keywords: Imaging mass spectrometry, Clinical proteomics

Background: The combination of immunoassay with MS has been revisited recently and opens a promising way for the complete characterization of targeted proteins in comparison with conventional methods like ELISA (1,2,3). We recently implemented a new strategy to detect and identify proteins of interests, in multiplex format, in plasma at low femtomole level combining Surface Plasmon Resonance Array-Mass Spectrometry (MALDI) directly onto the chip without elution step.

Methods: Biochip engineering has been developed to assess high level of antibody grafting in macro array format (4 x 4 spots) and prevent non-specific adsorption in complex media. The multiplexed capture analyses of antigens in plasma were performed through SPRi-Plex apparatus (HORIBA scientific). The steps of reduction, digestion of proteins captured on chip and the deposition of matrix were performed by the IMAG PREP technology. The spots of proteins and peptides were analyzed by MALDI UltrafleXtreme using the MS and MS/MS mode.Results: After optimization of procedures, the level of detection of Lag 3 antigen in plasma is 10 nM by SPRi. The robust methods of treatment of biochip after SPR analysis allow the identification and characterization of antigens by MS and MS/MS analysis. The results show a good correlation between the quantities of protein captured on the chip (~3 to 7 femtomol/mm2) and the number of peptides detected and the identification Mascot score.Conclusion: We demonstrate the capacity of this new Platform analysis «Supra-MS» to detect and characterize proteins in human plasma, in multiplex format. One application of this platform is the detection and quantification of human protein variants described as potential biomarker of disease.

References: 1) Bellon et al, Anal Chem, 2009, 81, 7695-77022) Boireau et al. Biosen Bioelec, 2009, 24, 1121-11273) Trenchevska et al J Proteome Res, 2010, 9(11):5969-73.



[P221] Phosphorylation events in response of iron stress in Arabidopsis

Mathilde Decourcelle1, Valérie Rofidal1, Michel Rossignol1, Sonia Hem1, Claude Nespoulous1

1 Laboratoire de Protéomique Fonctionnelle, 2 place Pierre Viala, 34060 Montpellier cedex, France

Contact: Mathilde Decourcelle ([email protected])Keywords: Signaling, interactomics and post-translational modifications

Environmental stimuli activate a wide range of signaling pathways involving reversible post-translational modifications of proteins, leading to the cellular responses. In plants, iron is involved in most of the cellular redox reactions and in electron transfer chains. In order to both sustain growth and avoid the toxicity of free cellular iron, a fine-tuning of import, storage and remobilization to and from the ferritins, the ubiquitous iron storage proteins coded by the AtFer1 gene, is required [1]. Thus identification of the proteins playing a role in these essential processes for optimal plant productivity is of a primordial interest. An excess of iron in the medium is known to induce successive post-translational events [2], leading to the increase in the AtFer1 transcript level. Among these, a phosphorylation event was proven to occur early in the transduction sequence.Phosphorylation is one of post-translational modifications (PTM) the most involved in cell signaling and phosphoproteomics technologies recently displayed a maturity convenient for functional investigations. The progress in enrichment strategies and the powerful of mass spectrometry today allow in-depth and large-scale proteomic analysis that generate protein data sets of still more big size [3, 4]. In plant, although being yet not so large as in mammals, the reported phosphoproteomes begin to have a sufficient size [5,6,7] to undertake comparative quantitative studies in Arabidopsis allowing the identification of discrete proteins potentially involved in response to stresses.Here, we propose a workflow for both the characterization of the phosphoproteome from an Arabidopsis whole cell lysate and the analysis of its responses to a stimulus using a label-free LC-MS strategy. Phosphopeptides enrichment was performed using combination of SCX and TiO2 chromatographies. The mass spectrometry analysis was done using a high resolution Q-TOF mass spectrometer coupled to a nanoflow HPLC ChipCube. With this strategy, over than 1000 phosphorylation sites were routinely identified with a high confidence score. One third of them was novel in comparison to the largest reported phosphoproteomes [5, 6]. In addition, label free quantification indicated that several sites were differentially up or down regulated after iron treatment. Results are discussed in terms of the possible involvement of identified candidates in response to this stress.

1. Briat, J.F., et al., Ann Bot (Lond), 2009.2. Arnaud, N., et al., J Biol Chem, 2006. 281(33): p. 23579-88.3. Lemeer, S. and A.J. Heck. Curr Opin Chem Biol, 2009. 13(4): p. 414-20.4. Rigbolt, K.T., et al., Sci Signal, 2011. 4(164): p. rs3.5. Sugiyama, N., et al., Mol Syst Biol, 2008. 4: p. 193.6. Reiland, S., et al., Plant Physiol, 2009. 150(2): p. 889-903.7. Grimsrud, P.A., et al., Plant Physiol, 2010. 152(1): p. 19-28.

Link: http://www1.montpellier.inra.fr/proteome/index.htm


[P222] Insource decay et Pseudo MSn de protéines par MALDI TOF iontrap

Lyna Sellami1, Claude Villard1, Therese Schembri1, Mathew E. Openshaw2, Pascale Barbier1, Omar Belgacem2, Daniel Lafitte1

1 plateforme protéomique Timone, 27 boulevard Jean Moulin, 13005 Marseille, France2 Kratos Analytical - Shimadzu, Wharfside, Trafford Wharf Road, M17 1GP Manchester, UK

Contact: Lyna Sellami ([email protected])Keywords: High mass and high resolution mass Spectrometry, Instrumentation

L’in source decay (ISD) a récemment été appliquée à des protéines à haut poids moléculaire (dépassant les 60 KDa). Nous montrons une méthode peu commune qui consiste à isoler des fragments issus du MALDl-ISD de l’human serum albumin (HSA) et de l’hTau40 (Tau) en induisant une fragmentation sélective (jusqu'à 3 cycles) tout en gardant une haute résolution aussi bien sur l’ion parent sélectionné que sur ses fragments. Cette technique a permis de séquencer les parties N et/ou C terminales de ces deux protéines. Les fragments ISD obtenus sous vide poussé (10-7 mbar) sont ensuite sélectionnés dans la trappe où s’effectuent les cycles ms/ms suivants. L’analyseur TOF a été employé pour acquérir les données en mode MS et MSn. Nous avons utilisé l’HSA et la Tau comme preuve de principe, la proteine totale a été soumise à l’ISD dans le spectromètre puis les fragments ont été accumulé dans la trappe avant d’être fragmenté. Et pour finir, l’ISD et la Pseudo MSn ont été réalisé sur la Tau oxydée au NaOCl pour identifier une modification post traductionnelle.


[P223] Nouvelle methodologie en LC MALDI

Sega NDIAYE1, Giovanni Chiappetta1, Emmanuelle Demey1, Yann Verdier1, Iman Haddad1, Joelle Vinh1

1 Laboratoire de Spectrometrie de Masse Biologique et Proteomique, 10 rue Vauquelin , 75005 Paris

Contact: Sega NDIAYE ([email protected])Keywords: Systems biology

La LC MALDI n'a longtemps été que peu utilisé pour l'analyse protéomique en raison de sa durée trop importante, celle-ci additionnant le temps de la chromatographie avec le temps d'analyse seules quelques applications nécessitent son utilisation tel que l'iTRAQ.Nous avons évalué la LC-MALDI par rapport aux techniques d'électrospray. Nous avons montré que la combinaison d'une analyse LC MALDI avec une analyse LC-ESI permet d'augmenter la couverture de séquence protéique et peptidique, certains peptides étant identifiés spécifiquement dans les analyses LC-MALDI. Outre ces informations complémentaires. La LC MALDI s'est révélé 2 à 3 fois plus répétable que l'ESI.Nous avons également développé la 2D LC MALDI et l'avons comparé à la 2D LC ESI avec des résultats montrant également une complémentarité des techniques.L'installation d'une source MALDI sur l'Orbitrap (Thermo) qui est un appareil de haute précision et d'une grande sensibilité, a ouvert une nouvelle dimension à l'analyse en LC-MALDICependant cette combinaison nécessite une durée d'analyse plus longue que le TOF/TOF due principalement au temps nécessaire pour réaliser des MS/MS interprétables. Pour palier à ce problème nous avons mis au point un moyen élégant et original d'associer les deux spectromètres de masse en combinant ce qui fait leur force, c'est à dire ka précision et la sensibilité de l'Orbitrap et la rapidité d'éxécution des MS/MS pour le MALDI TOF/TOF tout ceci à partir des mêmes dépots.


[P224] Proteomic approaches for discovering biomarkers of diabetic nephropathy

Laurence Molina1, Randa Ben Ameur1, Nicolas Salvetat1, Capucine Bolvin1, Chamseddine Kifagi1, Fayçal Jarraya2, Claude Granier1, Franck Molina1

1 SysDiag, UMR3145 CNRS / Bio-Rad, Cap delta, 1682 rue de la Valsière, CS 61003, 34184 Montpellier, France2 Nephrology Department and LIA 135, CHU Hédi Chaker, Route el Ain, 3000 Sfax, Tunisie

Contact: Franck Molina ([email protected])Keywords: Clinical proteomics, Bioinformatics et biostatistics dedicated to proteomics

One of the major problems facing clinical nephrology currently throughout the world is an exponential increase in patients with end-stage renal disease (ESRD), which is largely related to a high incidence of diabetic nephropathy (e.g. 36.9% of all US patients with end-stage renal disease have a diabetic nephropathy). However, it is currently impossible to reliably predict which and when diabetic patients will develop nephropathy and progress to kidney failure. Microalbuminuria (MA), defined as urinary albumin excretion of 30-300 mg/day, is the current first clinical evidence of incipient diabetic nephropathy. But recent studies have proved it has inadequate specificity. Proteomics has evolved into a high-throughput, analytical discipline used to analyze complex biological data sets. Since many years now, many proteomic studies on the discovery of new markers of diabetic nephropathy were conducted. it is hoped that these studies will unveil biomarkers earlier and more specific than microalbuminuria is. The aim of the present work is to comprehensively review, especially in terms of biostatistics and bioinformatics analysis, the available proteomics studies devoted to DN biomarker discovery.

Link: http://www.sysdiag.cnrs.fr/


[P225] Développements méthodologiques en analyse protéomique pour l’établissement du protéome membranaire de cellules souches cancéreuses issues de gliomes

Sarah Lennon1, Jean-Michel Saliou1, Emilie Audran2, Hervé Chneiweiss3, Christine Carapito1, Alain Van Dorsselaer1, Jacques Haiech2, Sarah Sanglier-Cianférani1

1 Laboratoire de Spectrométrie de Masse BioOrganique (LSMBO), IPHC, CNRS UMR7178, Université de Strasbourg, ECPM - Bat. R5.0 - 25 rue Becquerel, 67087 Strasbourg2 Institut Gilbert Laustriat, CNRS UMR 7175, Université de Strasbourg, , 67400 Illkirch3 Plasticité gliale et tumeurs au cerveau, Inserm UMR 894, Université Paris Descartes, , Paris

Contact: Sarah Sanglier-Cianférani ([email protected])Keywords: Clinical proteomics, Bioinformatics et biostatistics dedicated to proteomics, Systems biology

Les gliomes concernent l’ensemble des tumeurs du système nerveux central. Malgré les avancées en chirurgie médicale et dans les thérapies médicamenteuses, ces tumeurs restent difficiles à traiter. Très récemment, la présence de cellules souches cancéreuses (CSC) au sein de ces tumeurs a été mise en évidence (1). Du fait de leur résistance aux traitements de chimio/radio-thérapies actuels et de leur capacité à sommeiller pendant une longue période de temps, les CSC pourraient être à l’origine des rechutes et sont donc des cibles intéressantes pour la recherche de nouveaux biomarqueurs thérapeutiques (1). En effet, jusqu’à présent, les protéines identifiées en tant que biomarqueurs de CSC ne sont pas réellement pertinentes. Par exemple, le CD133, potentiel biomarqueur de CSC du gliome, n’est exprimé que dans 50 % des cas (2).

L’objectif global de ce projet est la recherche de biomarqueurs de CSC du gliome. Cette première partie de notre étude a pour but de réaliser une cartographie la plus complète possible du protéome membranaire d’une lignée de CSC du gliome (TG01) par protéomique. L’approche développée se base sur une séparation des protéines sur gel 1D, suivie par une analyse nanoLC-MS/MS. Chaque étape de cette stratégie a été optimisée afin d’assurer un maximum d’identifications avec un niveau de confiance élevé. Une attention particulière a été portée à la préparation de l’échantillon (analyse de la préparation membranaire avec et sans fractionnement par précipitation au sulfate d’ammonium) et à la répétabilité des analyses nanoLC-MS/MS. L’intérêt de l’utilisation de deux moteurs de recherche (Mascot et Omssa) pour augmenter la confiance accordée aux identifications en analyse protéomique est également présentée.

La combinaison de toutes ces analyses a permis d’identifier plus de 2900 protéines dont 599 ont une annotation « plasma membrane ». Parmi ces dernières, 61 clusters de différentiation, molécules de surface intéressantes pour leur application en clinique, ont été identifiés. Cette étude a permis d’augmenter la sensibilité de détection par rapport à des études protéomiques précédentes: plusieurs protéines, telles que EGFR et CD221, qui n’avaient jamais été vues précédemment3, mais, dont le rôle important dans les gliomes a été démontré par immunohistochimie, ont pu être détectées. Ces premiers résultats de protéomique seront comparés aux résultats d’analyses transcriptomiques.

1.Clevers, H., Nat Med 17, 313-319 (2011).2.Patru, C. et al., BMC Cancer 10, 66 (2010).3.Deighton, R.F. et al. Brain Pathol 20, 691-703 (2010).


[P226] Développement de micro-nano-technologies pour l'interface cerveau-biomarqueurs

Affif Zaccaria1, Ali Bouamrani1, François Berger1

1 GIN Inserm U836, Chemin Fortune ferrini, 38700 La Tronche

Contact: Affif Zaccaria ([email protected])Keywords: Clinical proteomics

L’évolution des outils d’analyse protéomique, en particulier le développement de la spectrométrie de masse (MS), a permis de réaliser des progrès majeurs dans l’étude de protéomes complexes. La forte sensibilité de détection et la rapidité d’analyse expliquent l’engouement actuel pour cette technologie comme outil de recherche et d’identification de biomarqueurs protéiques pathologiques. La découverte de ces biomarqueurs est un enjeu biomedical crucial pour : - un diagnostic précoce - le monitoring d’une pathologie - le suivi thérapeutique ouvrant ainsi la voie à une médecine plus personnalisée. La mise en évidence de ces biomarqueurs passe idéalement par l’analyse tissulaire qui permet d'accéder aux informations biologiques pertinentes provenant directement du foyer pathologique. Dans les pathologies cérébrales, face à l’inaccessibilité du tissu et l’invasivité des biopsies, la recherche de biomarqueurs se focalise sur l’analyse des fluides biologiques périphériques, se retrouvant confrontée à la complexité et à la grande gamme dynamique de ces fluides. Les stratégies actuelles reposant sur le pré-fractionnement de l'échantillon sont peu compatibles avec la protéomique clinique à haut débit. Pour répondre à ces limitations, des ruptures technologiques permettant d'adapter ces approches aux impératifs cliniques sont indispensables. Pour cela les micro-nano-technologies apportent des solutions alternatives prometteuses.

Nous avons ainsi montré que l'utilisation de nanobilles magnétiques limite de manière significative la capture des protéines majoritaires et apporte une solution pour la capture de sous-protéomes minoritaires en fonction de leur taille et des modifications chimiques de surface. Le développement de structures associant ces nanobilles et un polymère biocompatible permettant ainsi un contact entre les billes et le sous-protéome circulant, constitue un véritable bioréacteur d’interaction et de capture in vivo. De plus, la reproductibilité observée lors d'une analyse haut débit en font un outil adapté à la protéomique clinique.En parallèle, le développement et l'utilisation d'un outil d'empreinte tissulaire basé sur la technologie du silicium a permis de mettre en évidence la capture de protéines cérébrales en limitant considérablement la lésion tissulaire occasionnée par rapport à une biopsie conventionnelle. L'ingénierie de l'outil adapté aux outils de micro-chirurgie actuels permet de réaliser des empreintes tout en conservant la spatialité des structures cérébrales abordées lors des interventions chirurgicales sans modifier les procédures standards.


[P227] Using mass spectrometry to find partners of the thyroid sodium/iodide symporter (NIS).

Didier MARCELLIN1, Jean-Charles GAILLARD2, Elisabeth DARROUZET1, Jean ARMENGAUD2, Thierry POURCHER3

1 Laboratoire des Transporteurs en Imagerie et Radiothérapie en Oncologie, SBTN, iBEB, Centre Atomique de Marcoule, 30207 Bagnols sur Cèze2 Laboratoire de Biochimie des Systèmes Perturbés, SBTN, iBEB, Centre Atomique de Marcoule, 30207 Bagnols sur Cèze3 Laboratoire des Transporteurs en Imagerie et Radiothérapie en Oncologie, SBTN, iBEB, UNSA, CAL, Faculté de médecine, 28 av de Valombrose, 06107 Nice

Contact: Didier MARCELLIN ([email protected])Keywords: Systems biology, Signaling, interactomics and post-translational modifications

NIS is a membrane protein responsible for the accumulation of iodide into the thyroid follicle. Iodide is then used for T3 and T4 hormones synthesis. NIS properties are also widely used for the radiotherapy of thyroid cancers and their metastases, and its expression by gene therapy could widen even more its medical application.In our laboratory we are interested in studying human NIS post-translational regulation. Indeed, the functional expression of this symporter is finely regulated by a control of its subcellular localization and its recycling. Such regulation most likely involves interactions with other proteins.In order to identify such potential partners we decided to use crosslink on whole cells over-expressing hNIS in order to freeze the interactions. This step is followed by immunoprecipitation using in-house monoclonal antibodies against hNIS, and subsequent analysis by mass spectrometry.Different aspects of this protocol will be discussed including comparative studies of various magnetic beads for immunoprecipitation, and preliminary results will be presented. The next step will consist in applying this modus operandi directly on human thyroid tissue samples, cancerous or not, from the Antoine Lacassagne Center tissues library in Nice (France).


[P228] Use of False Detection Rate in proteomic data merging and optimization of the selection of identification results

François Allain1, Jean Armengaud1, Olivier Pible1

1 CEA, DSV, IBEB, SBTN, Laboratoire de Biochimie des Systèmes Perturbés, CEA Valrho, BP17171, 30207 Bagnols sur Ceze

Contact: Olivier Pible ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics

Identification results based on MS/MS spectra assignments for large scale proteomic experiments must be provided with a measure of identification certainty such as a False Detection Rate (FDR) as specified in the current guidelines of the Mol Cell Proteomics journal. The estimation of False-positives in a large experiment is not trivial. We designed a tool, called FDRfox, which will allow the merging of different datasets at a given confidence level. We rely here on results provided by the Mascot engine (Matrix Science) using a decoy database. Setting as initial input a final protein FDR value, the tool will use a uniform peptidic FDR level between datasets, rather than a uniform p_value (significance threshold in the Mascot software). This will immunize from inter-assay fluctuations. Protein FDR will either be based on proteins identified with 1 or 2 peptides. FDRfox is seamlessly interfaced with Mascot, and will provide the individual p_values of each data subset resulting after merging in the global protein identification results at the target protein FDR.


[P229] N-terminal oriented proteogenomics of Roseobacter desnitrificans

Céline Bland1, Joseph A. Christie-Oleza1, Emie Durighello1, Bernard Fernandez1, Jean-Charles Gaillard1, Jean Armengaud1

1 Laboratoire de Biochimie des Systèmes Perturbés, SBTN, iBEB, DSV, CEA Marcoule BP17171, 30207 Bagnols sur Cèze cedex

Contact: Céline Bland ([email protected])Keywords: Proteins, peptides and small molecules quantification

High-throughput proteomic data can be used to verify the coding regions of a genomic sequence and refine its annotation (Armengaud, 2009). One of the main problems in automatic annotation is the identification of the start codons, being the estimated error rate superior to 10%. Thus, start codon reannotation becomes one of the main issues of proteogenomics. Labelling the N-terminus of intact proteins using N-tris(2,4,6-trimethoxyphenyl)phosphonium acetic acid N-hydroxysuccinimide ester (TMPP-Ac-OSu) has proved a reliable method to ascertain protein N-termini (Gallien et al., 2009). The advantages of TMPP-derivatized N-terminal peptides are i) an increase of the hydrophobic character of the product, increasing its retention time in reverse phase chromatography, ii) an improvement of their ionization efficiency due to the introduction of a fix positively charged group, and iii) a much simplified fragmentation pattern that must be considered during analysis. After a first application on the Deinococcus deserti bacterium where non-canonical translation initiation codons have been discovered (Baudet et al., 2010), we analyzed another bacterium, namely Roseobacter desnitrificans, a specie belonging to the Roseobacter clade, which is a key component of surface marine ecosystems. Our first results show that amongst 291 unique proteins with N-terminal signature obtained by MS/MS, 212 were observed with a TMPP label. Specific exploration of non-canonical translation initiation codons will be performed with larger datasets.


[P230] VUV-photodissociation of peptides in the gas phase probed by synchrotron radiation

Francis Canon1, Aleksandar Milosavljevic1, Pascale Sarni-Manchado4, Véronique Cheynier4, Guillaume Van der Rest5, Laurent Nahon1, Alexandre Giuliani1

1 Synchrotron SOLEIL, L’orme des Merisiers, 91192 Gif-sur-Yvette2 INRA, U1008, CEPIA, , 44316 Nantes3 Institute of Physics Belgrade, University of Belgrade, Pregrevica118, 11080 Belgrade4 INRA,UMR1083 SPO, 2, place Viala, 34060 Montpellier5 Laboratoire DCMR, UMR 91128, Ecole Polytechnique, 91128 Palaiseau

Contact: Francis Canon ([email protected])Keywords: Organic and inorganic mass spectrometry, Instrumentation

Determination of peptide sequence is of paramount importance in proteomics and in studies regarding proteins. The quest for an efficient technique of fragmentation that is not influenced by the peptidic sequence is still relevant today. To address this issue, we have developed a new technique of tandem mass spectrometry. We present here our first results regarding this new technique called dissociative photoinization (DPI). Briefly, a Thermo LTQ XL ion trap was coupled to a VUV beamline at the SOLEIL synchrotron radiation facility. Monochromatized photons were introduced into the ion trap, thus allowing the ion of interest to be irradiated.We have studied the fragmentation of the Substance P induced by this technique. Substance P is a 11 amino-acid peptide (1347Da), which has been often used by the past as a model peptide. As a consequence, its pattern of fragmentation induced by different technique of tandem mass spectrometry is well-documented 1,2. Our investigation has been pursued on a model protein, IB5, which is a human salivary proline rich-protein whose function is to scavenge tannins 3. IB5 is a 70 amino-acid protein with a molecular weight of 6923Da.5 To study the ability of this technique to localize posttranslational modifications, we have recorded the MS/MS spectrum of different modified peptides.These results are the first report on photoionization of kDa species in the gas phase. Our data are discussed with respect to previous electron impact ionization measurements 1,4. These results demonstrate the main advantages of this technique, which are the quantity of analytical information that it provides, the ability to generate ion fragments from peptides with low charge-state and the capacity to localize posttranslational modifications (PTMs).

(1) Fung, Y. M. E.; Adams, C. M.; Zubarev, R. A. J. Am. Chem. Soc. 2009, 131, 9977-9985.(2) Reilly, J. P. Mass Spectrom. Rev. 2009, 28, 425-447.(3) Canon, F.; Giuliani, A.; Paté, F.; Sarni-Manchado, P. Analytical and Bioanalytical Chemistry 2010, 398, 815-822.(4) Budnik, B. A.; Tsybin, Y. O.; Håkansson, P.; Zubarev, R. A. J. Mass Spectrom. 2002, 37, 1141-1144.(5) Canon, F.; Paté, F.; Meudec, E.; Marlin, T.; Cheynier, V.; Giuliani, A.; Sarni-Manchado, P. Analytical and Bioanalytical Chemistry 2009, 395, 2535-2545.


[P231] Liquid Extraction Surface Analysis (LESA) combined with nESI-MS for direct sampling of planar tissues

Reinaldo Almeida1, Daniel Eikel3, Simon Prosser3, Jack Henion3, Christer Ejsing1

1 University of Southern Denmark, Department of Biochemistry and Molecular Biology, Campusvej 55, 5230 Odense, Denmark2 Advion Biosciences Ltd, Koa Hockham Building, CM20 2NQ Harlow,UK3 Advion BioSystems, Inc, 19 Brown Road, 14850 Ithaca NY , USA

Contact: Reinaldo Almeida ([email protected])Keywords: Imaging mass spectrometry, Instrumentation, Separative analysis methods

The direct analyses of biological tissues require atmospheric pressure surface sampling/ionization of small sample volumes, where analytes can be directly analyzed from a variety of surface types without sample preparation. Liquid extraction surface analysis combined with nano-electrospray mass-spectrometry (LESA-nESI-MS) is a complementary analytical approach to other surface-oriented MS methods such as DESI, LDI, DART or MALDI imaging MS, where a liquid micro junction surface sampling probe is used to extract the analyte directly from a surface.A small solvent droplet is placed on the tissue area of interest for analyte extraction and then aspirated into a conductive pipette tip for automated chip based nano electrospray infusion using the Advion TriVersa Nanomate.Here we applied LESA to different surfaces like whole body animal slices in early stage toxicology studies, Dried Blood Spot Cards (DBS) for drug and drug metabolite monitoring studies and Thin layer chromatography (TLC) for determination of small drug molecules.

Thin mouse tissue slices pre dosed with sulforafane or propranolol, were investigated for the analysis of drug and drug metabolite distribution of whole body and compared with control tissue. The parent drug ( SFN / Propranolol) and the phase II metabolites (SFN-GSH,SFN-NAC / Hydroxypropranolol-glucuronide) were screened in MRM mode in different thin tissue sections ( lung, liver, kidney, brain ) from the dose and control mouse. Excellent signal to noise ratio could be achieved.For the analyses of drug and drug metabolites from Dried Blood Spot Cards, standards of small drug molecules were spiked to blood samples and spotted in 15ul aliquots onto Whatman DBS collection cards and allowed to dry. Using a 10 compound mix as well as these compounds individually we were able to demonstrate a LOQ of 10-100 ng/mL depending upon the nanoelectrospray response of the selected compounds. Theoptimized extraction-spray solvent was determined to be 80% Methanol: 20% Water + 0.1% Formic Acid. This solvent mixture provided a satisfactory compromise between efficient surface extraction of the drugs from the DBS matrix as well as providing good spray characteristics for the nanoelectrospray experiments.For the determination of Small Drug Molecules from Thin Layer Chromatography Plates Venlafaxine and its O-desmethylvenlafaxine and N-desmethylvenlafaxine metabolites were selected as test articles. 500 ng levels of these three compounds were applied at the origin of a silica gel TLC plate (Merck). From these experiments it was demonstrated that the applied 500 ng levels of each of these small drug molecule compounds readily produced acceptable MS and MS/MS mass spectra data allowing confirmation of their known structures. These same three compounds were added to control human urine and cleaned up by C-18 SPE to provide a series of urine extracts. The observed spots on the TLC Plate for each compound were then robotically 'sampled' by the NanoMate and their corresponding nano electrospray SRM transitions (m/z 279>260>215; m/z264>246>201, and m/z 265>246>215, respectively, were monitored by MS/MS/MS using a Bruker HCT ion trap. Under these conditions acceptable MS/MS/MS data to 100 ng/mL concentration were achieved.



[P232] Analyse protéomique des complexes HIF2 dans les mélanomes : identification de régulateurs clés du développement mélanocytaire.

Anne-Lise Steunou1, Manuelle Ducoux-Petit3, Eric Clottes2, Anne Gonzalez-de-Peredo3, Bernard Monsarrat3, Monique Erard2, Odile Burlet-Schiltz3, Laurence Nieto4

1 Laboratoire Cancer, Centre de Recherche du Centre Hospitalier Universitaire de Québec, 9, rue Mc Mahon, 2784-2, 2784-2 Québec, Canada, G1R 2J62 Biophysique Structurale, Institut de Pharmacologie et de Biologie Structurale, UMR 5089, 205 route de Narbonne, 31077 Toulouse Cedex 43 Protéomique et Spectrométrie de Masse des Biomolécules, Institut de Pharmacologie et de Biologie Structurale, UMR 5089, 205 route de Narbonne, 31077 Toulouse Cedex 44 Université Toulouse III - Université Paul Sabatier, 118 route de Narbonne, 31062 Toulouse cedex 95 Microenvironnement, Cancer et Adipocyte, Institut de Pharmacologie et de Biologie Structurale, UMR 5089, 205 route de Narbonne, 31077 Toulouse Cedex 4

Contact: Manuelle Ducoux-Petit ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Proteins, peptides and small molecules quantification , Bioinformatics et biostatistics dedicated to proteomics

De faibles pressions en oxygène sont une caractéristique commune aux tumeurs solides. L’hypoxie locale contribue à la progression tumorale et diminue la réponse aux radio et chimiothérapies. Les facteurs de transcription HIF (Hypoxia Inducible Factor) sont des régulateurs clés de l’adaptation cellulaire à l’hypoxie dans les cellules normales mais également dans des conditions pathologiques telles que le développement tumoral.Les protéines HIF sont hétérodimériques : une sous-unité alpha(type 1 ou type 2) régulée par la pression partielle en oxygène, associée à HIF-1beta, exprimée de façon constitutive. Les protéines HIF sont impliquées dans la transformation oncogénique des mélanomes (1), et certaines études ont montré que leur surexpression dans les mélanomes cutanés était corrélée à un mauvais pronostic vital pour les patients (2). Dans le but de mieux comprendre l’implication des protéines HIF dans le développement des mélanomes, nous avons cherché à mettre en évidence les partenaires spécifiques des protéines HIF (1 et 2) dans ce contexte cellulaire.Pour cela, des lignées de mélanome (501-Mel) surexprimant de façon stable soit HIF-2alpha (ou HIF-1alpha) soit le vecteur vide ont été établies. La stratégie utilisée combine une immunoprécipitation des complexes contenant HIF-2alpha suivie d'une analyse protéomique quantitative différentielle label-free (contre une immunoprécipitation contrôle) sur un LTQ-Orbitrap XL (3). Des partenaires connus des HIF ont été ainsi isolés (HIF-1beta ou le co-activateur transcriptionnel P300) mais ce travail a surtout permis de mettre en évidence de nouveaux interactants parmi lesquels un grand nombre de régulateurs de la transcription. Parmi eux, validés par des expériences de co-immunoprécipitations, se trouvent des acteurs majeurs de la régulation de l'expression génique dans les mélanomes : MITF (Microphthalmia-associated Transcription Factor) et Sox10, régulateurs clé de la mélanogenèse, la protéine beta-caténine, protéine dérégulée dans environ 30% des mélanomes ainsi que TFAP2A, qui a un rôle lors de la transformation de mélanocyte en mélanome. Ces protéines sont impliquées dans le contrôle de la prolifération ou de la différenciation cellulaire. L’interaction entre HIF-2alpha et ces protéines s’accompagne d’un phénotype hyper-pigmenté et d’un retard de prolifération cellulaire.L’étude de l’interactome de HIF-1alpha a mis en évidence que deux des partenaires identifiés pour HIF-2alpha, Sox10 et TFAP2A n’interagissent pas avec HIF-1alpha. De plus, les modifications de pigmentation et de croissance cellulaire observées chez les cellules surexprimant HIF-2alpha, ne sont pas présentes dans les cellules surexprimant HIF-1alpha. Ces résultats suggèreraient un effet anti-tumoral pour HIF-2alpha et pro-tumoral pour HIF-1alpha. L’injection en sous-cutanée de cellules surexprimant soit HIF-1alpha soit HIF-2alpha à des souris Nude pourrait alors confirmer ou infirmer notre hypothèse.


[P233] Caractérisation et localisation d'insaturations de céramides par cationisation aux adduits cuivrique en ESI/MS

Danielle LIBONG1, carlos Afonso2, Denis LESAGE2, Sandra ALVES2, Arlette BAILLET1, Pierre CHAMINADE1, Jean Claude TABET2

1 Groupe de Chimie Analytique EA4041de l'Université Paris SUD, Faculté de Pharmacie, 2 rue jean Baptiste Clément, 92220 Châtenay Malabry2 UMPC-Université pierre et Maris Curie, 4, place de Jussieu , 75252 Paris

Contact: Danielle LIBONG ([email protected])Keywords: High mass and high resolution mass Spectrometry, Organic and inorganic mass spectrometry, Instrumentation

Les lipides sont des molécules essentielles à la vie de la cellule, ils agissent à différents stade : protection, compartimentation, signalisation, trafic membranaire et réserves d’énergie. Pour ces raisons la lipidomique est un domaine de recherche en pleine expansion, qui offre l’occasion unique d’analyser le rôle complexe des lipides dans le processus cellulaire. La diversité moléculaire des lipides est très importante, si l’on considère la complexité des membranes biologiques et la grande variété des molécules de signalisation. Il existe différentes classes lipidiques qui se caractérisent par la nature de leur tête polaire tel que les triglycérides, phospholipides ou céramides. Chaque lipide présente un grand nombre d’espèces moléculaires qui se différencient par la longueur de la chaine d’acide gras et le nombre d’instaurations. Or il a été démontré l’importance du positionnement et du nombre d’instaurations sur l’activité biologique des lipides.

L’intérêt pour la localisation des doubles liaisons contenues dans les chaînes d’acide gras n’est pas nouveau. De nombreuses méthodes de caractérisation de la localisation des doubles liaisons ont été référencées dans la littérature, les plus classiques s’effectuent en CPG-MS. Parce que la majorité des lipides complexes sont peu volatils, il est souvent nécessaire d’hydrolyser la tête polaire. En MS/MS il est possible de localiser les insaturations à partir d’ions négatifs par collisions de haute énergie par un processus à charge piégée. Le but de cette étude est de développer une méthode rapide d’identification de l’ensemble des classes lipidiques en LC/ESI-MS. Par le biais de la cationisation en mode électrospray il est possible d’augmenter d’une part le rendement d’ionisation des lipides apolaires difficilement détectables en électrospray et d’autre part de caractériser le positionnement et le nombre d’insaturations sur les chaines d’acides gras.

Une méthode utilisant les adduits cuivriques en ESI a été développée sur différents céramides, lipides très impliqués dans les phénomènes de mort cellulaire et de compartimentation du stratum cornéum. Cette méthode a permis la caractérisation et le positionnement du nombre d’insaturations sur les chaines d’acide gras. L’objectif est d’adapter cette méthode à toute les classes de lipide afin qu’elle puisse être utile à un vaste champ d’application allant de l’étude de la composition membranaire des microorganismes en parasitologie jusqu’à diagnostic de maladies métaboliques et génétiques


[P234] Mise au point d'une analyse quantitative label-free ciblée d’isoformes de protéines dans un échantillon enrichi

Laïla Sago1, Celia Dechavanne3, Florence Migot-Nabias3, Virginie Salnot1, Marjorie Leduc1, Patrick Mayeux1, François Guillonneau1

1 Plateforme Protéomique Université Paris Descartes (3P5), 22 rue Méchain, 75014 Paris2 INSERM u1016, 22 rue Méchain, 75014 Paris3 IRD, UMR 216 (IRD/UPD), 4 avenue de l'Observatoire, 75006 Paris4 CNRS UMR 8104, 22 rue Méchain, 75014 Paris

Contact: François Guillonneau ([email protected])Keywords: Proteins, peptides and small molecules quantification , Separative analysis methods, Instrumentation

La quantification sans marquage par nanoLC-MS est une application récente de la spectrométrie de masse aux projets de recherche. Le développement de cette approche, à partir d’un modèle de quantification basé sur la détection et la quantification d’isoformes de protéines d’intérêt diagnostique nous a permis de comprendre les paramètres qui entrent en jeux dans ce type d’approche. La quantification label-free repose sur la comparaison de l’intensité des signaux obtenus au niveau MS pour un temps de rétention donné pour chacun des échantillons à comparer. Un logiciel adapté réalise la comparaison d’évènements (m/z associé à un temps de rétention) au sein de différents échantillons en les alignant dans la dimension du temps de rétention. Pour l’approche label-free, il est nécessaire que le système soit optimisé. Nous avons donc evalué différents paramètres. L’analyse de réplicats a mis en évidence la reproductibilité de notre système notamment en ce qui concerne la chromatographieAinsi, à travers les différentes analyses exposées, nous avons pu montrer que le couplage nRSLC-LTQ orbitrap velos utilisé au sein de la plateforme était en adéquation avec les besoins de ce type de quantification à condition de définir une stratégie d’analyse solide.Les résultats obtenus montrent qu’il est possible de quantifier les différentes isoformes d’une même protéine si tant est que les peptides discriminants sont accessibles, moyennant des optimisations d’enrichissement et de digestion.



[P235] Liquid Extraction Surface Analysis (LESA) combined with nESI-MS for direct sampling of planar tissues

Reinaldo Almeida1, Daniel Eikel3, Simon Prosser3, Jack Henion3, Christer Ejsing1

1 University of Southern Denmark, Department of Biochemistry and Molecular Biology, Campusvej 55, 5230 Odense, Denmark2 Advion Biosciences Ltd, Koa Hockham Building, , CM20 2NQ Harlow,UK3 Advion BioSystems, Inc, 19 Brown road, 14850 Ithaca NY , USA

Contact: Reinaldo Almeida ([email protected])Keywords: Systems biology, Instrumentation, Systems biology

The direct analyses of biological tissues require atmospheric pressure surface sampling/ionization of small sample volumes, where analytes can be directly analyzed from a variety of surface types without sample preparation. Liquid extraction surface analysis combined with nano-electrospray mass-spectrometry (LESA-nESI-MS) is a complementary analytical approach to other surface-oriented MS methods such as DESI, LDI, DART or MALDI imaging MS, where a liquid micro junction surface sampling probe is used to extract the analyte directly from a surface.A small solvent droplet is placed on the tissue area of interest for analyte extraction and then aspirated into a conductive pipette tip for automated chip based nano electrospray infusion using the Advion TriVersa Nanomate.Here we applied LESA to different surfaces like whole body animal slices in early stage toxicology studies, Dried Blood Spot Cards (DBS) for drug and drug metabolite monitoring studies and Thin layer chromatography (TLC) for determination of small drug molecules.

Thin mouse tissue slices pre dosed with sulforafane or propranolol, were investigated for the analysis of drug and drug metabolite distribution of whole body and compared with control tissue. The parent drug ( SFN / Propranolol) and the phase II metabolites (SFN-GSH,SFN-NAC / Hydroxypropranolol-glucuronide) were screened in MRM mode in different thin tissue sections ( lung, liver, kidney, brain ) from the dose and control mouse. Excellent signal to noise ratio could be achieved.For the analyses of drug and drug metabolites from Dried Blood Spot Cards, standards of small drug molecules were spiked to blood samples and spotted in 15ul aliquots onto Whatman DBS collection cards and allowed to dry. Using a 10 compound mix as well as these compounds individually we were able to demonstrate a LOQ of 10-100 ng/mL depending upon the nanoelectrospray response of the selected compounds. Theoptimized extraction-spray solvent was determined to be 80% Methanol: 20% Water + 0.1% Formic Acid. This solvent mixture provided a satisfactory compromise between efficient surface extraction of the drugs from the DBS matrix as well as providing good spray characteristics for the nanoelectrospray experiments.For the determination of Small Drug Molecules from Thin Layer Chromatography Plates Venlafaxine and its O-desmethylvenlafaxine and N-desmethylvenlafaxine metabolites were selected as test articles. 500 ng levels of these three compounds were applied at the origin of a silica gel TLC plate (Merck). From these experiments it was demonstrated that the applied 500 ng levels of each of these small drug molecule compounds readily produced acceptable MS and MS/MS mass spectra data allowing confirmation of their known structures. These same three compounds were added to control human urine and cleaned up by C-18 SPE to provide a series of urine extracts. The observed spots on the TLC Plate for each compound were then robotically 'sampled' by the NanoMate and their corresponding nano electrospray SRM transitions (m/z 279>260>215; m/z264>246>201, and m/z 265>246>215, respectively, were monitored by MS/MS/MS using a Bruker HCT ion trap. Under these conditions acceptable MS/MS/MS data to 100 ng/mL concentration were achieved.



[P236] Etude protéomique de deux lignées divergentes de porc (CMJR) et mise en relation avec les qualités sensorielles de la viande de porc.

Thierry Sayd1, Sylvie Blinet1, Philippe Gatellier1, Christophe Chambon2, Bénédicte Lebret3, Helene Gilbert4

1 QuaPA-BPM, INRA de Theix, 63122 St Genes Champanelle2 PFEM, INRA de Theix, 63122 St Genes Champanelle3 SENAH, INRA St Gilles, 35590 St Gilles4 LGC, INRA chemin de Borde-Rouge, 31326 CASTANET-TOLOSAN CEDEX

Contact: Thierry Sayd ([email protected])Keywords: Systems biology

Les qualités de la viande sont des caractères complexes reposant sur les propriétés physiologiques du muscle et en particulier sur les protéines qui le composent. L’analyse protéomique permet de mieux comprendre les mécanismes biologiques qui sous-tendent les qualités et fournit des indicateurs permettant de les prédire. Une sélection divergente sur la CMJR (consommation moyenne journalière résiduelle) chez le porc Large White, a été entreprise à l’INRA. Dès la génération 3, des réponses à la sélection ont été observées sur les caractères de composition corporelle et de qualité technologique de la viande, la lignée CMJR- (animaux « sous-consommateurs ») présentant des pourcentages de longe et de jambon supérieurs, ainsi qu’un pH ultime plus bas et une luminance de la viande accrue, soit une moindre qualité technologique de la viande, relativement à la lignée CMJR+.L’objectif de notre étude est de quantifier l’impact de la sélection sur la CMJR sur les composantes technologiques et sensorielles de la qualité de la viande (longe) et de les relier aux propriétés musculaires : composition biochimique du tissu musculaire et de la viande après maturation à l’aide de l’analyse protéomique du muscle Longissimus afin d’identifier des voies métaboliques explicatives des différences musculaires biochimiques ou sensorielles entre lignées. Dans un deuxième temps nous mettrons en relation les profils protéiques obtenus à des critères d’oxydation (protéines/lipides) influençant les qualités sensorielles des viandes.Ce travail se fonde sur une population expérimentale constituée de 48 porcs appartenant à aux deux lignées CMJR. Sur ces animaux, nous avons réalisé plusieurs mesures (chimiques, physiques et sensorielles) pour la caractérisation des qualités de la viande. Des gels d’électrophorèse 2D ont été réalisés sur la fraction la plus soluble des protéines des muscles longissimus dorsi de ces 48 animaux. L’analyse des gels a été réalisée à l’aide du logiciel SamSpots. Dans un premier temps, nous avons comparés les profiles protéiques de ces deux lignées par ANOVA. Puis nous avons exploré par analyse des corrélations, les liens entre les profils protéiques obtenus avec des mesures d’oxydation (Taux de Carbonyles Protéiques et TBA) réalisé après conservation et chauffage sur ces 48 animaux.Les spots d’intérêt ont été identifiés par spectrométrie de masse. Une interprétation biologique des résultats a été proposée.


[P237] Développement d’une méthode de caractérisation du peptidome plasmatique

Delphine CENTENO1, Didier VIALA1, Thierry SAYD2, Jérémy PINGUET4, Norredine HAFNAOUI 3, Claudia BICH1, Estelle PUJOS-GUILLOT 1, Christophe CHAMBON 1

1 Plateforme d’Exploration du Métabolisme (PFEM), INRA de Clermont-Ferrand, site de Theix, 63122 Saint-Genès Champanelle2 UR370 QuaPA, INRA de Clermont-Ferrand, site de Theix, 63122 Saint-Genès Champanelle3 UMR1019 NH, INRA de Clermont-Ferrand, site de Theix, 63122 Saint-Genès Champanelle4 Laboratoire de Pharmacologie, CHU Gabriel-Montpied, 58 Rue Montalembert, 63000 Clermont-Ferrand

Contact: Christophe CHAMBON ([email protected])Keywords: Separative analysis methods, Clinical proteomics

Le plasma, et plus particulièrement le protéome plasmatique, fait l’objet d’une attention particulière, avec de nombreux projets qui tentent de le caractériser et de mettre en évidence des biomolécules d’intérêts. C’est un défi difficile en raison de la complexité du mélange et, à ce jour, encore très peu de travaux ont véritablement aboutis à la découverte et la validation de biomarqueurs pouvant être exploités à grande échelle. L’étude d’une sous-fraction de ce protéome plasmatique est une solution pour accéder à un champ exploratoire moins complexe. Ainsi, nous avons choisi d’étudier la fraction protéomique de faible masse moléculaire du plasma, appelée le peptidome plasmatique. Néanmoins, appréhender cette fraction reste encore un challenge important car la fraction peptidomique est en mélange avec une quantité importante d’autres molécules et en premier lieu, les protéines qui sont très majoritaires. Dans cette étude, nous avons évalué si la méthode de précipitation des protéines utilisée classiquement dans les problématiques de dosages des petites molécules dans le plasma, peut également être utilisée comme méthode de référence pour l’étude du peptidome. Pour cela, nous l’avons comparée avec des méthodes simples de préparation comme l’ultrafiltration ou la purification SPE.Les différentes fractions peptidomiques obtenues sont analysées par spectrométrie MALDI-TOF (DE-PRO, ABSciex) et ESI-IT (LTQ Velos,ThermoFisher). Les résultats obtenus sont étudiés à la fois sur l’exhaustivité de l’empreinte peptidique obtenue mais aussi dans le cadre de la mise au point d’une étude encore plus spécifique sur les peptides phosphorylés du peptidome. Nous présenterons un workflow le plus approprié permettant à la fois d’obtenir efficacement un sous-protéome peptidique mais aussi un sous-peptidome des peptides phosphorylés avec l’utilisation d’une micro-colonne contenant une résine de dioxyde de titanium. Ce phospho-peptidome apparaît très intéressant car le rôle des peptides phosphorylés libérés dans la circulation sanguine est encore peu exploré du fait de la difficulté de mettre au point une méthode de purification efficace dans ce milieu complexe.


[P238] Proteomic mapping of glyphosate-exposed human HaCaT keratinocytes using two-dimensional electrophoresis and atomic force microscopy

Céline Heu1, Géraldine Lucchi1, Alexandre Berquand4, Patrick Ducoroy1, Céline Elie-Caille1, Laurence Nicod1

1 plateforme proteomic CLIPP, CLIPP CGFL 1 rue du Professeur Marion BP 77980 , 21019 Dijon2 Laboratoire de Biologie Cellulaire EA 4267 Université de Franche Comté, UFR SMP Place Saint Jacques, 25030 Besancon Cedex3 Institut FEMTO-ST UMR 6174 CNRS, Université de Franche Comté, 32 avenue de l'observatoire, 25044 Besancon Cedex4 Brucker Nano Surfaces Division, Dynamostrasse , 19, 68165 Mannheim (Germany)

Contact: Céline Heu ([email protected])Keywords: Systems biology, Instrumentation

The epidermal differentiation and the different cell death programs need to be well orchestrated to maintain skin homeostasis and the biological barrier function. Environmental chemical aggressions can lead to a deregulation of one of these mechanisms and consequently to cutaneous pathologies. We previously showed that glyphosate, an extensively used herbicide, caused cytotoxic effects on cultured human keratinocytes, affecting their antioxidant capacities and impairing morphological and functional cell characteristics through an apoptosis phenomenon. The aim of the present study was to investigate the cytosolic and membrane proteomic profiles of human HaCaT keratinocytes in order to measure the cytoxic effects of glyphosate. Different incubation periods and glyphosate concentrations were performed on HaCaT cells, followed by two-dimensional electrophoresis in conjunction with MALDI-TOF/TOF mass spectrometry analysis. The data showed significant modifications in the expression of proteins known to be implying in intracellular oxidative stress mechanisms. AFM has been established as a versatile tool for imaging topography and measurements of mechanical properties on living cells. An original and complementary study by the QFM-based Peak Force™ QNM™ technology offers the opportunity to perform proteomic mapping on living cell membrane, using coated tip with specific antibodies. This strategy will allow us to reinforce results obtained with the classical proteomic study on living cells. This AFM technology has been already used to obtain topography images and high resolution characterization of the individual cell mechanical properties on our epidermal in vitro model. Eventually a better understanding of the glyphosate-induced deleterious mechanisms will help us in making a relevant choice of antioxidant molecules able to reverse the cellular impairments.


[P239] Etude de la bioaccumulation et de la métabolisation de la fluoxétine dans des invertébrés benthiques par Micro-QuEChERS-NanoLC-Nano-ESI-MS/MS

Audrey Buleté 1, Robert Baudot1, Laure Wiest1, Marion Gust2, Jeanne Garric2, Cécile Cren-Olivé1

1 Service Central d'Analyse-UMR5280ISA, chemin du canal, 69360 Solaize2 Laboratoire Ecotoxicologie biologie du CEMAGREF, 3 bis quai Chauveau , 69336 Lyon

Contact: Audrey Buleté ([email protected])Keywords: Proteins, peptides and small molecules quantification

La fluoxetine est un antidépresseur largement utilisé, retrouvé fréquemment dans les écosystèmes aquatiques. Cette molécule présente des effets différents sur la reproduction de deux espèces gastéropodes, Potamopyrgus antipodarum et Valvata piscinalis.Récemment, elle a été mesurée dans des poissons en aval des rejets d'effluents indiquant une capacité de bioaccumulation élevée chez les vertébrés de la faune aquatique. Toutefois, aucune donnée n'est disponible sur le devenir et le métabolisme de médicaments chez les invertébrés. Pour mieux comprendre la sensibilité interspécifique (espèce dépendante), la bioaccumulation de la fluoxétine et sa métabolisation in vivo en norfluoxétine sont à explorer chez P. Antipodarum et V. Piscinalis.Ce type d'étude nécessite le développement d'outils analytiques pour l'extraction et pour l'analyse de traces de fluoxétine et de norfluoxétine dans des matrices environnementales comme les invertébrés benthiques d’eau douce, gastéropodes ne pesant que quelques milligrammes. La complexité et la très faible quantité de l’échantillon rendent d’autant plus délicates, aussi bien l’étape d’extraction que l’analyse proprement dite. En effet, les substances recherchées à l’état de traces dans des matrices complexes de si petite taille nécessitent la miniaturisation des techniques existantes et l’utilisation de technologies de pointe : la nano chromatographie liquide couplée à la spectrométrie de masse en tandem (nano-LC-nano-ESI MS/MS) permet d’augmenter la sensibilité des analyses, de diminuer ainsi les limites de détection et de pouvoir répondre à ces enjeux écotoxicologiques. Ainsi, l’utilisation de technologies de pointe est nécessaire pour rechercher des traces de médicaments dans des matrices complexes comme les gastéropodes.Dans ce but, nous avons établi une stratégie analytique qui consiste en une seule extraction pour la fluoxétine et la norfluoxétine basée sur la méthode QuEChERS, suivie d'une analyse par nano-LC-MS/MS. En effet, la nanochromatographie couplée à la spectrométrie de masse en tandem (nano-LC-nano-ESI MS/MS) augmente la sensibilité, réduit la quantité d'échantillon initial requise et constitue un bon outil pour répondre à cette question écotoxicologique.

Les objectifs de cette étude sont (i) de déterminer si la fluoxétine a été bioaccumulée dans les escargots après exposition à cette dernière; (ii) d'évaluer sa métabolisation in vivo en norfluoxétine; (iii) d'évaluer la variabilité interspécifique de bioaccumulation et de biotransformation de la fluoxétine, afin de mieux comprendre les différences de sensibilité entre P. Antipodarum et V. Piscinalis.De plus, la méthode, développée à l’échelle d’un individu permet d’envisager une intégration des données dans une approche métabonomique permettant de caractériser et de paramétrer la diversité des réponses biologiques obtenues.


[P240] Modifications post-traductionelles de Pin1 dans des Tauopathies

Yann Verdier1, Sabiha Eddarkaoui2, Emmanuelle Demey-Thomas1, Nicolas Sergeant2, Luc Buée2, Joëlle Vinh1

1 Laboratoire de Spectrométrie de Masse et protéomique USR 3149 CNRS ESPCI ParisTech, 10 rue Vauquelin, 75005 Paris2 Centre Jean Pierre Aubert, IMPRT, Univ. Lille II, 1, Place de Verdun, 59045 Lille Cedex

Contact: Yann Verdier ([email protected])Keywords: Systems biology, Clinical proteomics

Un pré requis de la déphosphorylation des phospho-sérines ou des phospho-thréonines suivis de résidus prolines est l’isomérisation des liaisons peptidiques imidiques précédant le résidu proline. Ce mécanisme est assuré par une peptidyl-prolyl cis/trans isomerase nommé Pin1. Par ces isomérisations, Pin1 régule la fonction d’un nombre croissant de cibles, dont la protéine Tau associée aux microtubules, qui est hyperphosphorylé et agrégée dans les neurones en dégénérescence dans la maladie d’Alzheimer et les Tauopathies.

En utilisant un modèle de neuroblastome SY5Y exprimant de façon inductible la protéine Pin1, et ces mêmes cellules traitées avec 125 nM acide okadaïque, des analyses de western blot en 2D ont montré que la présence de cinq isoformes de Pin1, variant principalement par leur point isoélectrique.

Afin d’identifier les modifications post-traductionnelles responsables de ces isoformes, ces isoformes isolées de gels 2D ont été analysés par MALDI TOF, MALDI Orbitrap, et LC FT MS.

Ces analyses ont permis de mettre en évidence que plus de cinq résidus de Pin1 peuvent être modifiés, en particulier par des oxydations et des acétylations N terminales. Des analyses complémentaires visant à préciser la relation entre la spécificité de ces modifications et les pathologies Tau, en particulier dans la maladie d’Alzheimer, constituent la suite de ces travaux.


[P241] Développement d’une approche métabolomique pour le dépistage de stéroïdes anabolisants dans l’urine équine

Natali Stojiljkovic1, Patrice Garcia1, Marie-Agnès Popot1, Yves Bonnaire1, Alain Paris2, Christophe Junot3, Jean-Claude Tabet4

1 Laboratoire des Courses Hippiques (LCH), 15 rue de Paradis, 91370 Verrières le Buisson, France2 Met@risk INRA, 16 rue Claude Bernard, 75231 Paris Cedex 053 Commissariat à l'Energie Atomique (CEA, LEMM), Centre de Saclay, Bat 136, 91191 Gif-sur-Yvette Cedex4 Laboratoire de Chimie Structurale Organique et Biologique (LCSOB), UMR 76 13, Bat F72, 4 place Jussieu, 75252 Paris Cedex 05

Contact: Natali Stojiljkovic ([email protected])Keywords: High mass and high resolution mass Spectrometry

Les travaux par approche métabolomique relatifs à la détection de l’administration d’hormone de croissance chez le cheval et ceux concernant la détection du clenbutérol chez les bovins ont montré l’intérêt de cette approche pour notre contexte de recherche.Ainsi, nous orientons notre étude vers un profilage métabolique urinaire non ciblé afin de prendre en compte l’ensemble des perturbations détectées suite à l’administration de stéroïdes anabolisants, pour mettre en évidence leur utilisation chez le cheval. L'objectif est d’évaluer le potentiel d’une telle approche dans le dépistage de stéroïdes anabolisants. Le stanozolol, un stéroïde anabolisant exogène, a été choisi pour démontrer l’application de cette méthode à une matrice biologique très complexe qui est l’urine de cheval.Afin de différencier une population non traitée d'une population traitée au stanozolol, une phase animale appropriée a été réalisée afin d'étudier les variations physiologiques du profil métabolomique. Pour cela, 14 juments ont été suivies pendant près d'un an et des échantillons d'urine ont été recueillis deux fois par mois. Ensuite, 14 juments de l'étude précédente ont été impliquées dans le protocole d'administration. Deux groupes de 5 juments ont reçu un traitement chronique de stanozolol (4 fois tous les 4 jours) à deux doses différentes, par IM. Les 4 autres juments ont reçu le véhicule d’administration. Les échantillons ont été collectés pendant huit mois.Pour cette étude, notre choix d’analyseur s’est porté sur un hybride quadripôle-temps de vol (micrOTOF-QII, Bruker) du fait de ses caractéristiques nécessaires pour la recherche des biomarqueurs dans une approche globale (résolution, précision en masse, vitesse de scan, MS/MS et gamme dynamique). L’electrospray a été choisi comme mode d’ionisation en positif et négatif. Le couplage a été effectué avec un système HPLC (Ultimate, Dionex), avec une colonne chromatographique Uptisphere C18 (100 *2,1 mm, 2,2 µm) avec un temps d’analyse de 25 min. La préparation des échantillons consiste en une précipitation à l’acétonitrile. Les conditions de traitement des données avec le logiciel XCMS et les analyses statistiques multivariées avec le logiciel SIMCA P (Umetrics) ont aussi été définies.Les résultats qui en découlent ont permis de mettre en évidence une modification du métabolome des chevaux après traitement au stanozolol. Les facteurs physiologiques qui influent fortement le métabolome ont été minimisés en choisissant des chevaux du même sexe, du même âge et de même race, mais on a observé d’autres facteurs (individuels, saisonniers et environnementaux) qui modifient de façon significative le métabolome des chevaux. Ces résultats semblent montrer que certains de ces facteurs peuvent masquer l’information liée aux perturbations métaboliques entrainées par l’administration de substances prohibées et qu’ils sont donc à prendre en considération.


[P242] Spéciation des métaux et des métalloïdes dans des plantes modèles par l’association des couplages LC ICP-MS et LC ESI-LTQ Orbitrap MS

Laurent Ouerdane1, Paulina Flis1, Ryszard Lobinski1

1 Laboratoire de Chimie Analytique Bio-inorganique et Environnement, UMR5254 Université de Pau et des Pays de l'Adour / CNRS, 2 avenue du président Angot, 64000 Pau, France

Contact: Laurent Ouerdane ([email protected])Keywords: Organic and inorganic mass spectrometry, Separative analysis methods

Habituellement complexés ou liés à des molécules organiques, de nombreux métaux et métalloïdes jouent un rôle essentiel dans le métabolisme des plantes, en particulier pour l’activité enzymatique et la préservation des structures de la cellule. D’un autre côté, un excès de métaux peut provoquer une toxicité importante en se substituant aux métaux essentiels présents dans les enzymes ou par simple dommage oxydant. S’adaptant aux conditions des sols, les plantes ont développé des mécanismes pour augmenter ou diminuer sélectivement l’incorporation et l’accumulation des métaux dans leurs tissus permettant au fragile équilibre entre essentialité et toxicité d’être maintenue en produisant des métabolites complexant les métaux, des protéines membranaires impliquées dans le transport de métaux et leur séquestration dans des compartiments pour leur stockage.Dans les plantes, les métabolites impliqués dans le transport et le stockage des métaux essentiels n’ont que très peu été étudiés jusqu’à maintenant. De toute évidence, la faible concentration de ces complexes métalliques et leur labilité variable durant la préparation des échantillons et les séparations chromatographiques sont les principales raisons à ce manque d’informations. Pour permettre des analyses de spéciation, les résultats obtenus soit par couplage LC ICP MS à cellule de collision (information élémentaire sensible et non interférée) ou LC-ESI LTQ Orbitrap MS (information moléculaire sensible et à haute résolution).Le travail d’identification fut ainsi simplifié y compris avec des échantillons non purifiés et faiblement concentrés en métaux, ce qui permit d’obtenir des informations plus significatives sur la forme réelle des espèces métalliques dans les échantillons originaux. De nombreuses espèces métalliques (une cinquantaine) purent ainsi être identifiées pour la première fois dans des plantes modèles Pisum sativum (le petit pois), Arabidopsis halleri et des céréales et ceci pour de nombreux métaux ou métalloïdes (Fe, Zn, Cu, Se, Mo, Ca, Mg, Ni, Co, Mn…).


[P243] Développement d’un spectromètre FTICR transportable associé à une source d’ionisation ambiante pour la détection de composés peu volatils

Joël Lemaire1, Clotilde Le Vot1, Hélène Mestdagh1, Pierre Boissel2, Gérard Mauclaire2, Michel Héninger2

1 Laboratoire de Chimie Physique, Bâtiment 350 Université Paris Sud, 91405 Orsay, France2 AlyXan, Bâtiment 207B Centre Universitaire d'Orsay, 91405 Orsay, France

Contact: Joël Lemaire ([email protected])Keywords: Instrumentation, Organic and inorganic mass spectrometry

La spectrométrie de masse FTICR repose sur l’utilisation de champs magnétiques intenses et homogènes. Ceux-ci sont aujourd’hui souvent réalisés avec des aimants supra conducteurs qui permettent de réaliser des champs élevés (jusqu’à 15 Tesla disponibles commercialement) et avec une très grande homogénéité (variation relative de quelques ppm dans le volume de la cellule). Mais ils ont comme désavantage un coût élevé tant à l’achat qu’à l’entretien (en raison des fluides cryogéniques nécessaires à leur fonctionnement) et un poids élevé ce qui en fait des instruments certes très performants mais nécessairement fixes dans un laboratoire.Nous nous sommes orientés vers la réalisation d’instruments basés sur des aimants permanents structurés, qui permettent d’obtenir des champs compris entre 1 et 1.5 Tesla avec des homogénéités relatives de l’ordre de 10-3 dans le volume de la cellule. Ces instruments ne cherchent pas à concurrencer les FTICR à supraconducteurs dans les domaines de la protéomique ou de la pétroléomique où ceux-ci excellent. Nous visons la détection de molécules plus petites, les composés organiques volatils, en mettant à profit la haute résolution pour distinguer les molécules différant par leur formule chimique même lorsqu’elles ont des masses nominales identiques.Ceci est essentiel pour les applications dans le domaine de la surveillance environnementale ou dans celui de la sécurité car des molécules toxiques et inoffensives peuvent avoir la même masse nominale.Nous avons déjà démontré les performances qui peuvent être obtenues en utilisant des structures de Halbach (cylindrique générant un champ transverse) et en mettant en œuvre l’ionisation chimique à partir de différents précurseurs dans la cellule ICR. Les limites de détection obtenues sont toutefois de l’ordre de la ppm et les composés très peu volatils présents à l’état de trace peuvent se perdre dans les lignes d’introduction.C’est pourquoi nous avons développé une nouvelle configuration compacte basée sur un aimant générant un champ coaxial avec l’axe principal de la structure magnétique cylindrique. Avec cette configuration les ions peuvent être formés à l’extérieur du champ magnétique. Nous avons choisi de les produire à pression atmosphérique, dans des conditions ambiantes, par réaction à partir des atomes excités métastables générés dans une source à décharge. Les ions sont transférés de la pression atmosphérique jusqu’à 10-8 mbar dans la cellule ICR grâce à une introduction pulsée et l’utilisation de deux hexapoles, le premier pour mettre les ions en paquet et le deuxième pour les guider vers l’enceinte contenant la cellule ICR.Les premiers résultats sur diverses molécules présentes à l’état de trace dans l’air seront présentés.


[P244] Proteomic dissection of the Arabidopsis thaliana vacuolar proteome. New insights into the composition and molecular mass of protein complexes of plant vacuole.

Nolwenn Jarno1, Sylvie Kieffer-Jaquinod1, Florent Villiers1, Jérôme Garin1, Christophe Bruley1, Michel Jaquinod1, Jacques Bourguignon1

1 Laboratoire d'Étude la Dynamique des Protéome, BGE, iRTSV, 17 rue des Martyrs, 38000 Grenoble, France

Contact: Nolwenn Jarno ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Systems biology, Separative analysis methods

The vacuole is a multifunctional organelle characteristic of plant cells, playing a centralrole in cellular physiologies. The vacuole allows the storage of many metabolites, ensurescare of turgor pressure, pH regulation and ionic homeostasis via the storage or release ofsolutes and ions through transporters present at the vacuolar membrane, the tonoplast.Among functions, the vacuole has a key role in cellular protection by neutralizing thecompounds that could interfere with the normal metabolic pathways processes. It allowssequestration or degradation of xenobiotics and toxic compounds. Cellular detoxificationmainly dependents on the vacuole, but the mechanisms of transport and storage of toxicsin the vacuole is still unclear. To identify proteins involved in these mechanisms we havedeveloped a procedure to prepare intact highly purified vacuoles. We used protoplastsisolated from Arabidopsis thaliana cell cultures. Based on the specific activity of thevacuolar marker α-mannosidase, preparations showed the necessary degree of purity forproteomic study.We were interesting in the characterization of the soluble and membrane vacuolarfractions. Analysis of the vacuolar sap has identified over 500 proteins, 70% of them areenzymes. Behinds the 950 tonoplastic proteins described around 130 transporters werecharacterized.To go into insight the vacuolar proteome fine location of proteins were carried out by theuse of shave-and-conquer concept and quantification based on spectral counting. Wereassessed acute vacuolar protein location (ie full membrane or associated to the externalor internal membrane) and vacuole/extravacuole distribution of some soluble protease.Using biochemical and proteomics approaches, we present the first evidence of activeproteasome / subtilase degradative pathway associated to the plant tonoplaste. Then tolook into the supra molecular proteins organization blue-native polyacrylamide gelelectrophoresis (BN/SDS-PAGE) was used. We applied this dividing method in nativecondition to reveal the presence of putative complexes in the soluble and tonoplasticvacuolar proteome such as complexes of ubiquitin specific peptidase and proteasomesystem.Altogether, the present proteomic work constitutes the basis to study the dynamics of thevacuolar proteome in response to several stresses.


[P245] La Satisfaction client sur les plateformes d’analyses protéomiques

Céline Fleury1, Myriam Ferro1, Yohann Couté1, Christophe Bruley1

1 CEA, iRTSV, Laboratoire d’Etude de la Dynamique des Protéomes, Grenoble, F-38054, France ; INSERM, U880, Grenoble, F-38054, France ; Université Joseph Fourier, Grenoble, F-38054, France., 17 rue des Martyrs, 38054 Grenoble

Contact: Céline Fleury ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics

Réaliser des demandes d’analyse en satisfaisant aux exigences initiales du client public ou privé dans les délais impartis est une prérogative de chaque plateforme d’analyse, gage d’une certaine expertise et d’utilité pour la collectivité scientifique.

Mais comment mesurer cette satisfaction et la perception qu’a le client de la plateforme ? Quels sont les outils pour améliorer et augmenter la performance du service ? La norme ISO 9001 version 2008 en fait une obligation de part ses exigences au chapitre 8.2.1.

Dans le cadre de la mise en œuvre d’une démarche qualité au sein du laboratoire EDyP, nous montrerons quelques exemples de moyens de mesure de la satisfaction client sur la plateforme EDyP-Service (CEA/Grenoble) et les actions d’amélioration mise en place suite aux remarques des clients.


[P246] Comparaison des sources d’ionisation APCI et ESI pour le suivi d’additifs utilisés dans la formulation de conditionnements plastiques alimentaires et pharmaceutiques

Charlène Pouech1, Robert Baudot1, Laure Wiest1, Didier Léonard2, Cécile Cren-Olivé1

1 ISA, UMR 5280, Service Central d’Analyse du CNRS, Echangeur de Solaize, 69360 Solaize, France2 ISA, L.S.A - Laboratoire des Sciences Analytiques, UMR 5180, Bâtiment CPE, Université Claude Bernard Lyon 1, 43 Boulevard du 11 Novembre 1918, 69622 Villeurbanne cedex, France

Contact: Charlène Pouech ([email protected])Keywords: Organic and inorganic mass spectrometry

Au cours de ces dernières années, l'engouement non négligeable pour les emballages à base de polymères s’explique par leur caractère malléable, incassable, solide, léger, recyclable, transformable et leur remarquable rapport qualité/prix. L’industrie polymère est désormais en mesure de produire des emballages plastiques de meilleure qualité et répondant aux exigences requises dans les secteurs alimentaires et pharmaceutiques grâce notamment à l’incorporation de substances, appelées additifs, à des polymères naturels ou synthétiques.Cependant, l’inertie d’un emballage est rarement totale vis-à-vis du contenu. Différents phénomènes d’interactions peuvent effectivement se produire entre le contenant et le contenu. La migration, aussi appelé le relargage, correspond au phénomène le plus inquiétant pour la santé du consommateur. En effet, la migration des additifs, présents initialement dans l’emballage, vers l’aliment ou la solution pharmaceutique peut alors altérer la qualité du produit, ou le rendre toxique. Les industries alimentaires et pharmaceutiques se soucient alors de ce phénomène, et le maîtrisent. Elles imposent ainsi dans leurs domaines respectifs le nombre d’additifs, la nature des additifs ainsi que les teneurs maximales autorisées à incorporer dans les produits finis.Une méthode de référence en HPLC-UV existe d’ores et déjà pour identifier et quantifier le relargage d’un certain nombre d’additifs à échelle industrielle. Cependant, la présence généralement à l’état de traces d'additifs dans les produits contenants nécessite le développement de méthodes beaucoup plus sensibles et spécifiques. Dans ce contexte, nous avons choisi de développer une méthode multi résidue en HPLC-MS/MS. Néanmoins, la difficulté de l’analyse des additifs réside dans la grande variété de leurs propriétés physico-chimiques telles que leur masse moléculaire, leur polarité, leur thermolabilité et leur solubilité dans les solvants organiques. Une comparaison des sources d’ionisation APCI et ESI s’impose alors. L’étude technique a pour but de déterminer le mode d’ionisation optimal, mode pour lequel les limites de détection et de quantification seront les plus faibles pour le suivi de la migration d’additifs autorisés dans les deux domaines d’application et de certains de leurs produits de dégradation. L’optimisation de cette méthodologie analytique permettra de documenter la présence d'additifs dans des emballages aussi bien alimentaires que pharmaceutiques.


[P247] Analyse multi-résidue d’hormones libres, conjuguées et de perturbateurs endocriniens dans les organes sexuels de rat par QuEChERS et LC-MS/MS

Mikaël Tournier1, Charlène Pouech1, Laure Wiest1, Florent Lafay1, Cécile Cren-Olivé1

1 Service Central d'Analyse (SCA), UMR5280 CNRS, Chemin du Canal, Echangeur de Solaize, 69360 Solaize, France

Contact: Mikaël Tournier ([email protected])Keywords: Proteins, peptides and small molecules quantification

Apparue à la fin du XXème siècle, la notion de Perturbateurs Endocriniens désigne un composé xénobiotique à propriété hormono-mimétique. Il s’agit en fait d’une substance exogène pouvant avoir un impact sur l’équilibre hormonal d'organisme et qui a des effets nocifs sur la santé de cet organisme et de ses descendants. L’activité perturbatrice endocrinienne est reconnue lorsque la relation de causalité entre l’exposition à une substance soupçonnée être perturbatrice endocrinienne et les effets néfastes sur la santé ont été mis en évidence et prouvés. Le Bisphénol A, la Vinclozoline, l’Atrazine et le Méthoxychlore sont ainsi suspectés d’être des perturbateurs endocriniens. Afin d’étudier l’impact de ces molécules sur le système hormonal et la différenciation sexuelle, le suivi de la balance androgènes/estrogènes dans les organes reproducteurs (ovaires et testicules), par exemple, de rats exposés à ces contaminants s’impose. Or, si des méthodes d’analyse ont été décrites pour la quantification de perturbateurs endocriniens dans différentes matrices environnementales, la littérature se révèle très pauvre en ce qui concerne les matrices biologiques et plus particulièrement les organes reproducteurs. Les détections et quantifications de contaminants organiques dans ce type de matrices sont de véritables défis analytiques compte tenu de la diversité des substances dangereuses recherchées, de leur présence généralement à l’état de traces, de la complexité des matrices biologiques qui rend délicate l’étape d’extraction. Dans ce contexte, il est nécessaire de développer une méthode d’analyse permettant d'extraire, de détecter et de quantifier à la fois les perturbateurs endocriniens et les hormones permettant de suivre la balance androgènes/estrogènes induisant respectivement les caractères sexuels masculins et féminins. Les androgènes recherchés sont : la Testostérone (T) et l’Androstènedione (A). Les estrogènes recherchés sont : l’Estrone (E1), l’Estradiol (E2) et leurs métabolites sulfo- et glucuro-conjugués associés (E1S et E2S ; E1G et E2G). L’étape clé de ces analyses reste la préparation des échantillons, aussi avons nous optimisé cette étape par l'utilisation d'une technique innovante QuEChERS. La stratégie analytique adoptée ensuite est basée sur l’analyse en LC-MS/MS afin d’obtenir des limites de quantification compatibles avec les études engagées : de 20 à 60 pg/g. L’optimisation de cette méthodologie analytique a permis de documenter l'effet de perturbateurs endocriniens sur la balance hormonale de mammifères.


[P248] Differential proteomics for the evaluation of the effect of environmental culture conditions on the protein expression of somatic embryos from Pinus pinaster

Martine Beaufour1, Alexandre Morel2, Caroline Teyssier2, Luc Harvenght3, Jean-François Trontin3, Marie-Anne Lelu-Walter2, Philippe Label2, Martine Cadene1

1 Centre de Biophysique Moléculaire, CNRS UPR4301, rue Charles Sadron, 45071 Orléans cedex 2, France2 UAGPF, INRA , 2163, avenue de la Pomme de Pin - CS 40001 – Ardon, 45075 Orléans Cedex 2 France3 LBT, FCBA, Nangis Domaine de l’Etanço, 77370 Nangis France

Contact: Martine Beaufour ([email protected])Keywords: Systems biology

Context:In order to get insights into the physiological mechanism underlying the development of somatic embryos of the maritime pine (Pinus Pinaster), experiments at different stages of embryos maturation and different water availability conditions were undertaken to identify protein markers. To our knowledge, this is the first proteomic investigation on somatic embryos of Pinus pinaster. We will highlight in this presentation the effect of environmental culture conditions on the protein profile.

Method:Embryo cultures and 2D gels of the corresponding protein extracts were processed by INRA’s team. The maturation of the embryos was realised in presence of either low or high gellan gum concentrations.The two cultures were harvested at one week of maturation. Following numerical analysis of 2D gels, only the statistically significant spots were excised from the gel. These spots were subjected to enzymatic proteolysis followed by nanoLC-ESI-IT (CID) mass spectrometry analysis and database searching. As we are dealing with an unsequenced organism, identifications were performed with nucleotide databases based on expressed sequence tags (EST) or on tentative consensus sequences (TC) and protein databases.

Results:More than 1428 proteins were reproducibly detected on each gel. At 1 week of maturation, the abundances of 82 spots detected in analyses of embryos matured at the two gellan gum concentrations significantly differed. Among them, the corresponding proteins of 54 spots were reliably identified by LC-MS/MS, and were found to be mainly involved in «Carbohydrate metabolism» and «Genetic information processing» according to KEGG taxonomy. The database searching methods will also be discussed.

Outlook: This work will be expanded to other factors influencing embryo development with the aim to facilitate species propagation. The results will be combined with the evaluation of gene expression and sequencing of corresponding RNAs.

Acknowledgement: This work was funded by the Region Centre Embryome project (n°33000111).


[P249] Study of the chloroplast proteome during the ripening of tomato fruit.

Isabel Egea1, Cristina Barsan1, David Bouyssié3, Elie Maza1, Carole Pichereaux4, Michel Rossignol4, Mohamed Zouine1, Wanping Bian1, Alain Latche1, Jean-Claude Pech1

1 Université de Toulouse, INP-ENSA Toulouse, génomique et Biotechnologie des Fruits, Avenue de l'Agrobiopole, 31326 Castanet-Tolosan2 INRA, Génomique et Biotechnologie des Fruits, Chemin de Borde rouge, 31326 Castanet-Tolosan3 Université de Toulouse, UPS, IPBS, Plateforme protéomique, 205, route de Narbonne, 31077 Toulouse4 Fédération de Recherches 3450, Agrobiosciences, Interactions et Biodiversité, 24 chemin de Borde Rouge, 31326 Castanet-Tolosan

Contact: Jean-Claude Pech ([email protected])Keywords: Systems biology, Proteins, peptides and small molecules quantification , Bioinformatics et biostatistics dedicated to proteomics

Fruit ripening is accompanied by macroscopic events such as changes in color, texture and flavors that render the fruit attractive to consumers. At the cellular level, alterations are particularly evident at the headquarters of the photosynthetic organelle, the chloroplast. Throughout the maturation process, it undergoes molecular rearrangements that result in morphological changes.. In particular, a loss of chlorophylls and a re-ordering of the plastid structure occur that participate in the conversion of a chloroplast into a chromoplast.In the present study we have studied the changes in the proteome during the transition from chloroplast to chromoplast in ripening tomato fruit. Three developmental stages have been selected according to the color changes: an early stage, mentioned as "mature-green", an intermediate stage named "breaker" corresponding to the initiation of red color and finally a "red" stage corresponding to the fully ripe fruit. For each stage, plastids were purified by density gradient separation. Total proteins were extracted, separated by one-dimensional electrophoresis, digested with trypsin and the peptides were finally analyzed by chromatography (nano-HPLC, Dionex) coupled to a mass spectrometer (Orbitrap). The identification of proteins using the MASCOT tool was facilitated by the recent availability of genome annotated database of tomato. For quantification by label-free ("Spectral counting") and its statistical validation, 3 biological replicates were performed for each stage.The whole results corresponding to nearly 3000 proteins was sorted and compared using the "MapMan" and "Proteincenter» tools. Proteins were classified into metabolic functions and quantitative changes were evaluated during the chloroplast_to chromoplast transition. Besides confirming the breakdown of the photosynthetic system and the increase in the carotenoid biosynthetic pathway, our data indicate that several functions present in the chloroplast persist in the chromoplast while others undergo profound re-orientations. These data will now allow a better description of the molecular processes involved in the differentiation of this organelle and will provide new molecular targets for understanding the regulation of fruit ripening and development of sensory quality.


[P250] Assay development on the NanoPro Platform: 4E-BP1 and 4E-BP2.

Uyen Nguyen1, Annegret Bodge1

1 Cell Biosciences, 3040 Oakmead Village Drive, CA 95051 Santa Clara - USA

Contact: Uyen Nguyen ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Clinical proteomics, Instrumentation

Assay development on the NanoPro Platform: 4E-BP1 and 4E-BP2

Uyen Nguyen Research Associate, Annegret Bodge Director R&D -Cell Biosciences

Abstract :We present the development of novel immunoassays for the translational repressor proteins 4E-BP1 and 4E-BP2 using NanoPro technology. Both the PI3 kinase / Akt pathway and FRAP / mTOR kinase pathway regulate 4E-BP1 activity, making 4E-BP1 a focal point for these two important signaling pathways. 4E-BP2 regulation is poorly understood, partially due to the lack of specific anti-phospho 4E-BP2 antibodies. Our assay, developed on the Cell Biosciences NanoPro platform, enables detailed differential investigation of 4E-BP1 and 4E-BP2 phosphorylation and signal transduction.

Link: www.cellbiosciences.com


[P251] Proteomic identification of calumenin as a G551D - CFTR associated protein.

Mehdi Taiya1, Pascal Trouve2, Ling Teng2, Nathalie Benz2, Mathieu Kerbiriou2, Olivier Mignen2, Claude Ferec4

1 Service commun de spectrometrie de masse, Universite de Bretagne Occidentale, 06, avenue Victor Le Gorgeu, 29200 Brest2 Inserm, U613, 46, rue Felix Le Dantec , 29218 Brest3 Universite de Bretagne Occidentale, Faculte de Medecine et des sciences de la sante, 22, rue Camille Desmoulins, 29200 Brest4 Etablissement Francais du Sang - Bretagne, 46, rue Felix Le Dantec , 29200 Brest5 C.H.U. Brest, Hopital Morvan, Laboratoire de Genetique Moleculaire, 02, avenue Foch , 29200 Brest

Contact: Mehdi Taiya ([email protected])Keywords: Systems biology

Cystic fibrosis (CF) is the most common lethal autosomal recessive disease in the Caucasian population, and is due to mutations in the cystic fibrosis transmembrane conductance regulator (CFTR) gene. To date, over 1700 mutations have been identified in the CFTR gene. Among these mutations, the CF-causing missense mutation G551D-CFTR (approx. 5% of cases) exhibits normal expression on the cell surface but it is associated with severe disease due to its altered channel activation. The aim of the present study was to identify specific interacting proteins of G551D-CFTR. Membrane proteins from Wt-CFTR and G551D-CFTR expressing cells were extracted and resolved by 2D-gel electrophoresis (2-DE). Mass Spectrometry revealed that calumenin was only present in the proteins extracted from G551D-CFTR expressing cells. Co-immunoprecipitations showed that calumenin is linked to Wt- and to G551D-CFTR. The amount of bound calumenin was higher in G551D-CFTR protein complex than in wt-CFTR complex. Nevertheless, its basal expression was not modified in G551D-CFTR expressing cells when compared to Wt-CFTR. Calumenin associated proteins were resolved by 2-DE and the spots were analyzed by MS. The results indicated that calumenin is bound to chaperons, cytoskeleton proteins and Grp78/Bip which is involved in the Unfolded Protein Response (UPR). Therefore, we showed a calumenin-CFTR interaction and we suggest that calumenin maybe involved in the G551D-CFTR maturation and trafficking pathway. Finally, we suggest that UPR may be triggered independently of the retention of G551D-CFTR in the ER.

Link: http://www.genetic-brest.fr/


[P252] Etude de la symbiose chimiotrophe chez Bathymodiolus azoricus: une approche métaprotéomique

Cléa BAUVAIS1, Isabelle BOUTET2, Arnaud TANGUY2, Emmanuelle DEMEY3, Joëlle VINH3, Jean MARY1

1 Ecophysiologie des invertébrés marins en milieu extrêmes, UMR CNRS - UPMC 7144, Place George Teissier, 29 282 Roscoff, France2 Génétique de l'adaptation aux milieux extrêmes, UMR CNRS - UPMC 7144, Place George Teissier, 29 282 Roscoff, France3 Spectrométrie de masse biologique et protéomique, SMBP CNRS USR 3149, 10 rue Vauquelin, 75005 Paris, France4 Univ Paris Diderot, Sorbonne Paris Cité, UFR des Sciences du vivant, 5 rue Thomas Mann, 75013 Paris

Contact: Jean MARY ([email protected])Keywords: Systems biology, Systems biology

Les sources hydrothermales, situées sur les dorsales océaniques, présentent des conditions environnementales a priori hostiles au développement de la vie (températures élevées, faibles taux d’oxygène, pression élevée, importantes concentrations en métaux et composés réduits, absence de lumière). Ces sites hébergent cependant une faune endémique très abondante. L’étude proposée ici se concentrera sur l’espèce Bathymodiolus azoricus qui est un bivalve colonisateur des sites de la ride médio-Atlantique.B. azoricus a développé des adaptations physiologiques uniques pour faire face aux conditions hydrothermales. Par exemple, la mise en place d’une symbiose non obligatoire avec des gamma-protéobactéries thiotrophes (SOX) et méthanotrophes (MOX), au sein de cellules spécialisées du tissu branchial, les bactériocytes. Ces bactéries permettent à leur hôte de coloniser des environnements riches en sulfure et en méthane. La production primaire des symbiotes à partir de ces composés réduits assure l’apport nutritif nécessaire à la survie de l’hôte.Une approche de métaprotéomique comparée (électrophorèse bidimentionnelle et spectrométrie de masse, MALDI-TOF/TOF) sur des tissus branchiaux de B. azoricus collectés sur les sites Menez Gwen et Rainbow aux paramètres physicochimiques bien définis (concentration en sulfure et méthane, pH, température) a été menée.Ceci a permis d’identifier des protéines de l’hôte et des symbiotes différentiellement exprimées en fonction des sites d’étude et de la charge symbiotique des individus, dans la perspective de mieux comprendre la mise en place de la symbiose, la régulation de la charge symbiotique et ses conséquences au niveau protéique chez B. azoricus.


[P253] Etude de la distribution spécifique de sels de benzalkonium par imagerie par spectrométrie de masse : Application à la pharmacocinétique oculaire chez le lapin.

Raphael Legouffe1, Nicolas Desbenoit2, Grégory Hamm1, Christophe Baudouin2, Alain Brunelle3, Isabelle Fournier4, Olivier Laprévote3, Maxence Wisztorski4, Françoise Brignole-Baudouin2, Jonathan Stauber1

1 ImaBiotech, Campus Cité Scientifique, 59655 Villeneuve d’Ascq, France2 Institut de la Vision, INSERM, UMR_S968, 17 rue Moreau, 75012 Paris, France3 Institut de Chimie des Substances Naturelles, Centre de recherche de Gif, CNRS, Avenue de la Terrasse, 91198 Gif-sur-Yvette, France4 Laboratoire de Spectrométrie de Masse Biologique Fondamentale et Appliquée (FABMS), EA 4550, Université de Lille, Université de Lille, 59655 Villeneuve d’Ascq, France5 Chimie Toxicologie Analytique et Cellulaire, EA 4463, Faculté des Sciences Pharmaceutiques et Biologiques, Université Paris Descartes, 4 Avenue de l’Observatoire, 75006 Paris, France

Contact: Grégory Hamm ([email protected])Keywords: Imaging mass spectrometry

Les chlorures de benzalkonium (BAK) sont les conservateurs les plus largement utilisés dans les collyres, présents généralement sous forme de sel de benzododecinium (C12) et myristalkonium (C14). Ils permettent d’améliorer la pénétration des composés actifs. Cependant, certaines études ont reporté un possible effet toxique de ces derniers au niveau de la surface oculaire et plus particulièrement dans le cadre de traitements de longue durée comme celui contre le glaucome [1]. Ainsi, l’imagerie par spectrométrie de masse est utilisée afin de caractériser la distribution spatiale des BAKs et évaluer leur impact physiologique au niveau moléculaire. Cette étude a été réalisée sur des yeux de lapin instillés avec des solutions de BAKs pendant différents temps de cinétique (1 ou 5 mois) et nous as permis de détecter deux types d’ions m/z 304.32 et m/z 332.36 correspondant respectivement au BAK C12 et C14. Une approche multi-technique a été choisie afin de mener ces travaux utilisant la spectrométrie de masse MALDI-TOF, le TOF-SIMS [2] ou encore le MALDI-Orbitrap. Cela a permis de faciliter la détection d’un large panel de composés (petites molécules, lipides [2], peptides, etc…) et d’accéder aux plus hautes résolutions spectrale et latérale. Cette présentation sera consacrée plus précisément aux résultats d’imagerie MALDI-TOFMS. Nous discuterons de la localisation spécifique et de l’accumulation des BAKs dans certaines zones histologiques d’intérêt (cornée, angle iridocornéen, conjonctive, limbe,…) connues pour être des régions inflammatoires de l’œil. L’apport de la haute résolution latérale sera démontré sur deux régions de l’œil particulièrement importantes que sont le trabéculum et le nerf optique. Nous pointerons également une différence fine de comportement des deux types de BAK suivant leur structure. De plus, leur présence sera validée par des études structurales par spectrométrie de masse en tandem ou assimilées. Par exemple, le mode FAST-SRM permettra de suivre un fragment spécifique d’un composé, dans notre cas, m/z 212.42 (fragment du BAK C12) et ainsi valider sa distribution au niveau des structures oculaires précédemment citées. Des expériences croisées ont également été menées entre deux laboratoires utilisant différents spectromètres de masse MALDI-TOF et modes de déposition de matrice afin de valider ces données. L’imagerie par spectrométrie de masse apparait donc comme un outil de choix pour l’étude de la distribution de composés connus pour avoir des effets délétères et peut être utile dans le cadre d’étude préclinique dans les domaines pharmacologique et toxicologique.

1 Baudouin, C., Detrimental effect of preservatives in eyedrops: implications for the treatment of glaucoma. 2008, Blackwell Publishing Ltd. p. 716-726.2 Desbenoit, N., SMAP 2011, Avignon


[P254] Biocontrol proteomics:Implication of the pentoses phosphates pathway in the antagonist effect of Pichia anomala against Botrytis cinerea on apple.

Anthony Kwasiborski1, Jenny Renaut2, Philippe Lepoivre1, M. Haïssam Jijakli1

1 Unit of plant pathology, GxABT, University of Liège, rue des déportés, 2, 5030 Gembloux, Belgium2 Department of Environment and Agro-Biotechnology, CRP Gabriel Lippmann, 41, rue du Brill, 4422 Belvaux, Luxembourg

Contact: Anthony Kwasiborski ([email protected])Keywords: Systems biology

The growing interest of the consumers for the wholesome food and the protection of the environment as well as the development of resistant pathogens to pesticides, stimulate the interest of growers to apply biological control methods. Pichia anomala strain K was previously identified as an efficient biocontrol agent of the main apple pathogens, Botrytis cinerea and Penicillum expansum. Further study demonstrated the complexicity of the mode of action of P. anomala against B. cinerea. A cDNA-AFLP and gene disruption study revealed implication of exo-β-1,3-glucanases in the mode of action of P. anomala strain Kh6 (a haploid form of P. anomala strain K displaying the same biocontrol properties). However, these studies suggested also implication of other factors. The present study aims to increase our knowledge of the mode of action of P. anomala strain Kh6 against B. cinerea using an in situ approach allowing the triple interaction, host/pathogen/antagonist and the proteomic tool allowing to study the ultime expression of the genome without a priori.One 50mm wound per apple were covered by a membrane and inoculated by a P. anomala suspension then by B. cinerea or not. Samples were collected during the exponential and stationary phase to identify the early and later responses to the presence of B. cinerea. After extraction, proteins were separated on 2-D gels. Spots influenced by the presence of B. cinerea in exponential and stationary phases were identified by MALDI-ToF.One hundred five and sixty spots of proteins were influenced by the presence of B. cinerea in exponential and stationary phases respectively. In exponential phase, P. anomala Kh6 in absence of B. cinerea uses mainly the glycolysis pathway, whereas in presence of pathogen, it orientates its energetic metabolism to the oxidative phosphorylation and sets up the pentose phosphate pathway. Thanks to this new orientation, P. anomala Kh6 probably obtains energy and nucleic acids allowing to colonize the wound as fast as in absence of B. cinerea and prevents the use of nutrients by the pathogen. In stationary phase, no differences in the P. anomala Kh6 energetic metabolism, in absence and in presence of B. cinerea were observed. During that phase, P. anomala Kh6 seems to use the alcoholic fermentation in order to face the nutrients impoverishment of the substrate.


[P255] Urinary exosomes : improved method for clinical applications

Ida Chiara Guerrera1, Matthieu Bourderioux2, Cerina Chhuon1, Diane-Lore Vieu2, Gabrielle Planelles2, Bernard Escudier3, Arnaud Mejean4, Thao Nguyen-Khoa2, Aleksander Edelman2

1 Proteomic Platform Necker, 156 rue de Vaugirard, 75015 Paris, France2 U845, INSERM, 156 rue de Vaugirard, 75015 Paris, France3 Institut Gustave Roussy, 114 rue Edouard Vaillant, 94508 Villejuif, France4 Hôpital européen Georges Pompidou, 20 rue Leblanc, 75015 Paris, France

Contact: Cerina Chhuon ([email protected])Keywords: Clinical proteomics, Separative analysis methods

Urinary exosomes are microvescicules excreted into urines from epithelial cells in urinary tract. Exosomes are a useful, non-invasive source of biomarkers in many diseases including renal cell carcinoma (RCC). Many challenges have been encountered while studying exosomal proteins. Among them, the presence of the most abundant soluble protein in urine, Tamm Horsfall Protein (THP). THP forms large filaments that may entrap exosomes and hamper the identification of less abundant proteins. The aim of present study was to establish a robust and rapid protocol for preparation of exosomes by selectively excluding the THP from the sample of exosomal proteins.First urinary miction were collected in sterile container containing antiprotease. Next, to obtain a preparation enriched in exosomes, the samples were treated according to the reference protocol with slight modifications. Subsequently, the samples were fractionated using OFF-GEL to separate THP from the rest of the proteins. Fractions obtained were separately digested and analysed by nanoHPLC-LTQ Orbitrap, maximizing the number of identification in the minimum time of analysis.THP protein was successfully removed. In the remained samples, we have identified similar number of proteins as reported by others (1171 vs 1132). The protocol was shorter and we have significantly reduced the MS analysis time. We have identified for the first time proteins that have been previously proposed as markers of a nephritic syndrome or markers of RCC. Furthermore, our method allowed to discriminate the intracellular membrane anchored THP and the secreted THP.We have established a protocol for the analysis of urinary exosomes which is suitable for screening urinary samples from patients.


[P256] Couplage de techniques analytiques à la spectrométrie de masse pour l’identification de peptides en mélanges complexes

Christelle Harscoat-Schiavo1, Cédric Paris2, Xavier Framboisier1, Evelyne Ronat-Heit1, Ivan Marc1

1 Laboratoire Réactions et Génie des Procédés U.P.R. C.N.R.S. 3349, I.N.P.L., Nancy université, Plateforme Sciences de la Vie et Santé, 13, rue du bois de la Champelle, 54500 Vandœuvre-lès-Nancy2 Laboratoire d'Ingénierie des Biomolécules, ENSAIA, I.N.P.L., Nancy université, 2, avenue de la Forêt de Haye, 54505 Vandœuvre-lès-Nancy Cedex

Contact: Xavier Framboisier ([email protected])Keywords: Separative analysis methods

L’hydrolyse enzymatique de protéines végétales conduit à un mélange complexe de peptides de tailles et propriétés variées. Les petits peptides, < 1000 g/mol, présentent un grand intérêt pour les industries alimentaires, pharmaceutiques par leurs propriétés physico-chimiques et leurs bioactivités potentielles. Il est nécessaire de mettre en place des stratégies rationnelles de séparation afin d’adapter les étapes de purification, de caractérisation et d’identification en fonction des peptides ou fractions peptidiques d’intérêt, en vue de leur utilisation. Le séquençage est la méthode la plus précise, mais n’est pas adaptée aux mélanges complexes puisqu’elle requiert l’isolement préalable des molécules. Plusieurs techniques analytiques ont été développées afin de séparer les peptides selon leurs propriétés de charge, d’hydrophobie et d’hydrophilie. Ces séparations ont été modélisées afin de caractériser et de prédire les propriétés physico-chimiques d’un peptide à partir de son élution. La spectrométrie de masse utilisée ici en couplage avec la chromatographie liquide (colonne C18 ou HILIC) comporte deux analyseurs qui travaillent en série et/ou en parallèle. Il s’agit d’une trappe ionique linéaire (LTQ) qui permet de réaliser des études par filiation du peptide concerné c'est-à-dire de fragmenter n fois l’ion parent de la molécule d’intérêt, cassure à partir du COOH terminal, et d’une trappe ionique électrostatique (Orbitrap) qui permet l’accès à la masse exacte des composés avec une résolution maximale de 100.000 pour une masse de 400 uma.Le Laboratoire a mis au point un logiciel d’aide à l’identification de petits peptides en mélanges complexes, dont l’objectif est de prédire au mieux leur composition élémentaire en acides aminés. Il s’appuie sur les informations obtenues par combinaison des techniques de séparation et leur couplage à la spectrométrie de masse. D’une part, la masse détectée (+/- intervalle de tolérance) est utilisée pour établir la liste de toutes les combinaisons en acides aminés correspondant à cet intervalle de masses. D’autre part, les modèles établis pour chacune des séparations sont utilisés en parallèle pour trier la liste initiale de combinaisons possibles établie selon la masse. Ces listes classées sont ensuite confrontées pour aboutir aux combinaisons les plus probables. La stratégie d’identification des peptides se fait en deux étapes : • l’analyseur Orbitrap apporte une connaissance sur la masse exacte qui est utilisée directement dans le logiciel permettant une réduction très importante de la fenêtre de masse (de l’ordre de 20 ppm), • l’analyseur LTQ permet la confirmation de la séquence en acides aminés du peptide considéré.Le logiciel a été appliqué à des solutions de peptides synthétiques et est en cours d’expérimentation pour l’identification de peptides d’un mélange complexe réel issu de l’hydrolyse enzymatique d’une protéine végétale.

Link: http://lrgp.ensic.inpl-nancy.fr/index.php?id=286


[P257] Structural identification by mass spectrometry and antibacterial activity of a peptide from the venom of the Brazilian ant Tetramorium bicarinatum

Aline RIFFLET1, Sabine GAVALDA1, Nathan TENE1, Jérôme ORIVEL2, Jérôme LEPRINCE3, Laure GUILHAUDIS4, Eric GENIN5, Angélique VETILLARD1, Michel TREILHOU1

1 Equipe d'accueil "Venins et Activités Biologiques" EA4357, CUFR Champollion, place de Verdun, 81012 cedex 09 Albi2 CNRS, UMR Ecologie des Forêts de Guyane, Campus Agronomique BP 316, 97379 cedex Kourou3 Inserm U982, PRIMACEN Institut Fédératif de Recherches Multidisciplinaires sur les Peptides (IFRMP 23), Université de Rouen, 76821 Mont-Saint-Aignan4 Equipe de Chimie Organique et Biologie Structurale UMR 6014 CNRS, Institut de Recherche en Chimie Organique Fine (IRCOF), IFRMP 23, Université de Rouen, 76821 Mont-Saint-Aignan5 ThermoFisher Scientific, 16 avenue du Québec, 91963 Courtaboeuf

Contact: Michel TREILHOU ([email protected])Keywords: Bioinformatics et biostatistics dedicated to proteomics, Signaling, interactomics and post-translational modifications, Systems biology

With more than 14 700 species described, ants represent an interesting source for new drugs discovery. Works on a few ant species have yielded many compounds with a variety of novel and potent activities. We studied the venom of a tropical ant, Tetramorium bicarinatum, a terrestrial ant from Brazil. The biological activities and biochemical characterization of the active fraction were investigated on staphylococci.After fractionation of the crude venom by RP-HPLC, MS analysis of an active fraction revealed the presence of two different peptides: the first one, Peptide-1 was represented by the multicharged ions: [M+2H]2+ = 1107.72 and [M+3H]3+ = 738.7. The second peptide was identified with the following ions: [M+H]+ = 1572.1 and [M+2H]2+ = 787.00. These two compounds co-eluted and could not be separated by HPLC. Sequences were determined by de novo sequencing using LTQ-Orbitrap mass spectrometry and confirmed by Edman degradation. Peptide 1 was a 20 amino acid residues and was C-terminally amidated as the majority of peptides from the venom of insects implemented in databases. Peptide 2 was a 15 amino acid residue and was also amidated. Antibacterial activity against Staphylococci aureus and xylosus strains was evaluated using the active HPLC fraction of crude venom then validated with synthetic replicates. Only peptide 1 was active. Interestingly, this peptide had a linear structure, exhibited no meaningful similarity with any itemized peptides from venoms and showed a potent and broad antibacterial activity similar to mellitin, an antimicrobial peptides AMP widely used in microbiological screening. Circular dichroïsm showed 44% of helicoïdal organisation in 8 mM of SDS solution. Among all the new AMPs recently found, this novel small cationic antimicrobial peptide that we have named Bicarinalin, would be a good candidate for development of new antibiotic drugs against bacterial resistant strains.

Link: http://www.univ-jfc.fr/equipesrecherche/venins-activites-biologiques-vacbio-ea-4357-albi


[P258] Nouvelle interface CESI pour l'analyse de dregues

John Hudson1, Michel Anselme1

1 Beckman-Coulter, 33,rue des Vanesses, 95942 Villepinte

Contact: Michel Anselme ([email protected])Keywords: Instrumentation

In forensic drug analysis there is always a need for increased sensitivity.In this work we apply a prototype sheathless interface for capillary electrophoresis-ESI-Mass spectrometry (CE-MS)The ruggedness of the HSPS interface was tested in the exploration of the urine metabolic profile after ingestion and metabolism of the antimalarial drug: chloroquine


[P259] Separation of Fucosylated, non-fucosylated, and complex Carbohydrates By capillary eletrophoresis

Sushma Rampal1, Michel Anselme1

1 Beckman-Coulter, 33 rue des vanesses, 95942 Villepinte

Contact: Michel Anselme ([email protected])Keywords: Separative analysis methods

In order to gain in comprehensive understanding of therapeutic MAB, it is necessary to critically caracterize glycosylation associated with them. We develop methodology by which fucosylated,afucosylated,sialylated and complex antennary oligosaccharides can be differentiated from one another


[P260] Caractérisation de protéines entières par couplage indirect CIEF/MALDI-MS

Michael Biacchi1, Nina Pourhassan1, Yannis FRANCOIS1, Emmanuelle Leize-Wagner1

1 Laboratoire de Dynamique et Structure Moléculaire par Spectrométrie de Masse, LDSM2, UMR-CNRS 7177, Institut de Chimie, Université de Strasbourg , 1 rue Blaise Pascal, 67000 Strasbourg2 Laboratoire Biochimie Toxicologie, CHR Metz Thionville, Hôpital Bel Air, 1 Rue du Friscaty, 54100 Thionville

Contact: Yannis FRANCOIS ([email protected])Keywords: Separative analysis methods

La caractérisation fine de protéines intactes apparaît comme un des défis les plus importants pour les sciences analytiques. En effet, depuis quelques années, la production et la demande d’analyse de protéines intactes ont fortement augmentées, notamment dans l’industrie biopharmaceutique. De nos jours, les approches classiques mettant en jeu des couplages chromatographiques avec la spectrométrie de masse (MS) répondent à cette problématique. Cependant, comme toutes techniques, ces méthodes présentent certaines limites, notamment en terme de haute masse, d’hydrophobicité et de détermination du point isolélectrique (pI).Le couplage de l’isoélectrofocalisation en mode capillaire (CIEF) avec la MS apparaît comme une alternative aux techniques chromatographiques classiques.En effet, la CIEF est une méthode utilisant les propriétés de l’électrophorèse capillaire, dans le but de séparer les peptides et les protéines suivant leur pI. L’élaboration sous champs d’un gradient de pH à l’aide d’une solution d’ampholytes permet dans un premier temps une étape de focalisation des protéines suivant leur pI. Une deuxième étape de mobilisation sous champs par l’application d’une faible pression permet leur détection en MS. Cette méthode couplée à la MS permet une caractérisation orthogonale en terme de pI et de masse des protéines. Cette étude a été réalisée sur un couplage CIEF avec une source d’ionisation laser assistée par matrice (MALDI). En effet, le MALDI a pour avantage d’être plus tolérant avec les conditions de tampon et de sel utilisés en CE, et notamment pour les ampholytes. Par conséquent, le couplage indirect CIEF/MALDI-MS avec collecteur de fraction a été mis en place au laboratoire. Les conditions de séparation ont été optimisées sur un mélange de protéines modèles (myoglobine, leucine, alcohol deshydrogenase, albumine bovin).


[P261] Data independent MALDI ion mobility acquisition for the analysis of tryptic peptides for Proteomic and MALDI Imaging applications

Emmanuelle Claude1, Mark Towers1, Marie-Claude Djidja2, James Langridge1

1 Waters Corporation, Atlas Park, Simonsay, M22 5PP Manchester, UK2 The Institute Cancer of Research, 123 Old Brompton Road, SW7 3RP London, UK

Contact: Emmanuelle Claude ([email protected])Keywords: Ionic mobility, Imaging mass spectrometry

IntroductionAnalysis of tryptic peptides by matrix assisted laser desorption/ionisation (MALDI) mass spectrometry, typically involves acquiring an MS experiment first. If identification of the digested protein is not possible by peptide mass fingerprint (PMF), MS/MS analysis of specific peptides would be attempted. This can be time consuming and in the case of MALDI imaging, it may not allow localisation of the tryptic peptides. Identification in imaging experiments is carried out after processing the MS data. Here we are proposing a novel data independent way of acquiring data where MS and MS/MS information are acquired within the same experiment, without any selection of the precursors using ion mobility separation (IMS) to carry out an orthogonal separation of peptides in the gas phase.

MethodsData were acquired using the MALDI SYNAPT G2 where tri-wave has separate ions according to their ion mobility in the gas phase. Peptides, from in solution digest, 2-D gel electrophoresis or tissue section are separated both by m/z and ion mobility. Within the same MALDI-IMS experiment, the mass spectrometer is alternated between low collision energy applied to the transfer collision cell and elevated energy, to induce peptide fragmentation. As the fragmentation occurs after the IMS, the precursor at low energy will have the same drift time as its fragments from the elevated energy scan.The complex dataset is subsequently processed where the data from both low and elevated energy is aligned, and correlation between parent and fragment ions is made.

Preliminary dataThe first part of the study will focus upon the analysis of excised spots from 2D- gels, in-gel digested. The extracted solution will be mixed with matrix and spotted onto a MALDI target. Data is processed manually and peak lists (.pkl) are generated for each sample where multiple precursor information is included. PMFs from the low energy are also processed into a text file for protein identification using MASCOT. The MOWSE scores between the two types of analysis are compared. This step will test the speed and robustness of the technique as well as its limitations.The second part of the study will be focus on data acquired directly from tissue section where proteins have been tryptically digested in-situ and analysed by MALDI imaging. Here adjacent pixels had low and elevated CE applied. Ion images of the peptides can be displayed showing their distribution throughout the tissue. The same dataset can then also be processed for identification of the tryptic peptide where regions of specific drift time were selected.

Novel aspect Improved methodology for tryptic peptide identification with data independent MALDI analysis using orthogonal ion mobility separation


[P262] Etude des complexes d’actinides en solution : apport de la spectrométrie de masse electrospray

Laurence Berthon1, Nicole Zorz1, Julie Muller1, Geoffroy Ferru1, Cecile Marie2, Manuel Miguirditchian2

1 DEN/DRCP/SCPS/Laboratoire des Interactions Ligands Actinides, marcoule, 30200 bagnols sur Cèze, France2 DEN/DRCP/SCPS/laboratoire d'élaboration des procédés de séparation, marcoule, 30200 bagnols sur Cèze, France

Contact: Laurence Berthon ([email protected])Keywords: Organic and inorganic mass spectrometry

Dans le cadre du traitement du combustible nucléaire usé, le CEA mène des recherches sur la séparation des actinides par extraction liquide-liquide. Cette opération est un phénomène complexe dont les mécanismes d’interaction des différents constituants du système biphasique (extractants, diluants, complexants, solutés…) ne sont pas encore parfaitement décrits. Pour améliorer la connaissance des systèmes chimiques mis en œuvre, des études de spéciation moléculaire sont nécessaires aussi bien en phase aqueuse qu’en phase organique. Ces études de spéciation visent à mieux décrire les équilibres d'extraction mais également à améliorer la compréhension de l’affinité et la sélectivité des molécules extractantes. Pour cela, les complexes formés entre les solutés et les ligands (extractant ou complexant) sont caractérisés par différents techniques complémentaires. La spectrométrie de masse à ionisation électropray est une technique de choix permettant d’obtenir des informations sur la structure (stœchiométrie) et la stabilité des complexes ainsi que sur la sélectivité des molécules extractantes. Pour étudier des solutions radioactives contenant des actinides, un spectromètre de masse a été adapté et connecté à une boite à gants dans l’installation Atalante du CEA Marcoule.Les résultats présentés illustrent la caractérisation par spectrométrie de masse electrospray des complexes formés entre les actinides tels que l’uranium (VI), l’américium (III)ou le plutonium (IV) et plusieurs ligands d’intérêts.


[P263] A new strategy for studying structural transitions in proteins developed by Tyrosine-targeted spin labeling and EPR spectroscopy

Sabrina Lignon1, Régine Lebrun1, Brigitte Meunier-Gontero1, Magali Lorenzi2, Carine Puppo2, Marlène Martinho2, Elisa Mileo3, Sylvain Marque3, Bruno Guigliarelli2, Valérie Belle2

1 Plate-forme Protéomique de l'Institut de Microbiologie de la Méditerranée, CNRS-IFR88, Marseille Protéomique, 31 Chemin Joseph Aiguier, 13402 Marseille cedex 20, France2 Bioénergétique et Ingénierie des Protéines UPR 9036, CNRS & Aix-Marseille Université, Institut de Microbiologie de la Méditerranée, 31 Chemin Joseph Aiguier, 13402 Marseille cedex 20, France3 Laboratoire Chimie Provence, LCP-UMR 6264, Université de Provence, case 521, Avenue Escadrille Normandie-Niemen, 13397 Marseille cedex 20, France

Contact: Sabrina Lignon ([email protected])Keywords: Signaling, interactomics and post-translational modifications, Organic and inorganic mass spectrometry

Structural transitions in proteins, and especially in the flexible and disordered ones, are studied by Site Directed Spin Labeling EPR spectroscopy which conventionally uses nitroxide probes functionalized to target cysteine residues (1). Cysteine residues are rare amino acids in proteins and they have frequently functional roles. They are involved in structural elements such as disulfide bridges or in the binding of metal cofactors, therefore grafting of the nitroxide probe to residues other than cysteines is required. We describe here the first results of tyrosine-targeted spin labeling on a chloroplast protein of 12 kDa, so-called CP12, having a unique tyrosine and 4 cysteine residues involved in two functional disulfide bridges (2). A three-component Mannich-type reaction was performed leading to a labeling of 70(10)% of the protein. Electrospray and MALDI-ToF mass spectrometry analyses showed that the tyrosine residue was labeled. The global structure of the modified CP12 was not affected by the chemical modification as demonstrated by CD spectroscopy. The interaction with its physiological partner GAPDH, as previously described (3), could also be achieved by in vitro reconstitution assay. EPR spectroscopy of the labeled protein showed a very high mobility of the probe that still remained very mobile after complex formation with GAPDH. In this work, we demonstrate for the first time that a nitroxide probe can be selectively grafted on tyrosine residues by using the Mannich-type reaction. This demonstration opens the way to the study of proteins carrying functional cysteine residues by spin labeling EPR spectroscopy.1-Erales J, Lorenzi M, Lebrun R, Fournel A, Etienne E, Courcelle C, Guigliarelli B, Gontero B, et Belle V. A new function of GAPDH from Chlamydomonas reinhardtii : A thiol/disulfide exchange reaction with CP12. 2009, Biochemistry, vol. 48, pp. 6034-6040.2- Lorenzi M, Puppo C, Lebrun R, Lignon S, Roubaud V, Martinho M, Mileo E, Tordo P,. Marque R.A S, Gontero B, Guigliarelli B et Belle V. Tyrosine-targeted spin labeling and EPR Spectroscopy: an alternative strategy for studying structural transitions in proteins. 2011, accepted in Angewandte Chemie.3-Erales J, Lignon S, et Gontero B. CP12 from Chlamydomonas reinhardtii : a permanent specific "chaperone-like" protein of glyceraldehyde-3-phosphate dehydrogenase. 2009, J. Biol. Chem., vol. 284, pp. 12735-12744.


[P264] Liquid Extraction Surface Analysis (LESA)of proteins on tissue sections.

Jusal Quanico1, Julien Franck1, Maryna Kuzminska1, Michel Salzet1, Isabelle Fournier1, Maxence Wisztorski1

1 Laboratoire de Spectrométrie de Masse Biologique, Fondamentale & Appliquée, FABMS, USTL, Université Lille Nord de France – Université Lille 1 Bât SN3, 1er étage, 59655 Villeneuve d'ascq, France

Contact: Jusal Quanico ([email protected])Keywords: Imaging mass spectrometry, High mass and high resolution mass Spectrometry, Separative analysis methods

A method for the mass spectrometry (MS) analysis of proteins after in situ enzymatic digestion-generated peptides was developed employing liquid extraction surface analysis (LESA) using the Advion TriVersa NanoMate platform. This ambient surface sampling technique extracts analytes by making a single droplet of solvent in contact with the sample surface, creating a liquid microjunction where extraction of the analyte occurs. The extract is then aspirated and introduced to the ion source. Because the platform is an auxiliary device, it can be online-coupled with a variety of atmospheric pressure ion sources. We also developed the possibility to use it offline for analyses by using vacuum ion source like MALDI. The capability of LESA to analyze exogenous small molecules and lipids has been demonstrated. In this work, the LESA technique was used offline, enabling the extraction of protein digests from frozen and formalin-fixed, paraffin embedded (FFPE) rat brain tissue sections after trypsin digestion. LESA allowed the in situ extraction of localized digested peptides and thus enabled the profiling of proteins in the tissue sections analyzed. Although it offers a lesser spatial resolution compared with MSI techniques like matrix-assisted laser desorption/ionization (MALDI) imaging, LESA allowed for the collection of extracts and their further treatment prior to introduction to the mass spectrometer. As an example, the extracted peptides were subjected to solid phase extraction for salt removal and introduced to a nano-high performance liquid chromatography (nano-HPLC) for further separation. LESA can thus serve as a complementary MS ambient surface sampling technique that can be used to provide further information needed in peptide analysis.


[P265] «Genoproteomilks»: A strategy combining genomic and proteomic tools to qualify the protein fraction of milks

Guy Miranda1, Leonardo Bianchi1, Amélie Pinard1, Céline Henry2, Alain Guillot2, Tania Klein3, Patrice Martin1

1 INRA, UMR1313 Unité Génétique Animale et Biologie Intégrative, équipe « Lait, Génome & Santé », Domaine de Vilvert, Bâtiment 221, 78350 Jouy-en-Josas, France2 Plateforme d’Analyse Protéomique Paris Sud-Ouest (PAPPSO), Domaine de vilvert, 78350 Jouy-en-Josas, France3 UPRA Tarentaise , 40 rue du Terraillet , 73190 Saint Baldoph, France

Contact: Patrice Martin ([email protected])Keywords: Systems biology, Separative analysis methods, Proteins, peptides and small molecules quantification

Over the past 40 years, dairy cattle have been selected mainly on milk and total protein yield. Selection was carried out at the expense of overall milk quality, as well as health and fertility of high-producing dairy cows. Moreover, the process of genetic selection itself leads to a loss of genetic variability that is particularly severe in highly specialized breeds. Awaiting the application of genomic selection on a large scale, some functional traits, such as fertility, resistance to pathogens, longevity and milk quality have been implemented to breeding programs to warrant acceptable fertility, welfare of dairy cows and sustained milk production, opening new valorization fields.

For many years, milk has been considered as a raw material of which processing or «cracking» concentrated most of the added value. More recently, emphasis has been put on milk elementary components since many of them, in particular fatty acids and peptides, have putative or actual positive effects on human health. There is nowadays a growing interest to accurately measure elementary milk components, including proteins, at low cost, to identify genetic, and to a less extent environmental factors, affecting milk protein gene expression. This would make it possible to design effective tools to obtain milk with the desired composition.

Genetic variants of milk proteins have been shown to impact milk composition both at the qualitative and quantitative levels, and determine nutritional as well as technological properties of milks. It is therefore crucial to be able to characterize precisely milk protein composition. Several techniques have been used to estimate the variation in concentration, post-translational modification (phosphorylation and glycosylation) and genetic polymorphism of milk proteins, including liquid chromatography and capillary electrophoresis. Here we present a novel and powerful approach combining LC-MS and exon re-sequencing that proved to be particularly effective to provide a detailed description of the milk protein fraction in the French Tarine cattle breed in which a new beta-casein genetic variant has been identified.


[P266] Mechanistic aspect of the maleic anhydride grafting onto fatty double bonds: Evidence of radical addition reactions by mass spectrometry

O. Zovi1, C. Loutelier-Bourhis2, L. Lecamp1, C. Bunel1, C. Lange1

1 INSA de Rouen UMR CNRS 6270 PBS FR CNRS 3038, avenue de l’Université, 76 801 Saint-Etienne-du-Rouvray Cedex2 Université de Rouen UMR CNRS 6014 COBRA FR CNRS 3038 , rue Tesnières , 76 821 Mont- Saint-Aignan Cedex

Contact: C. Loutelier-Bourhis ([email protected])Keywords: Systems biology

The grafting of maleic anhydride onto fatty double bond is a usefull method to functionalize polymers or biomolecules such as triglycerides molecules [1,2]. However, although some mechanisms involved in grafting reaction have been proposed [3,4], the structures of the grafted products have not been actually well defined. In this study, the thermal grafting of maleic anhydride onto (un)saturated fatty esters without use of initiator was characterized and the structure of the products determined. The resort to several mass spectrometric techniques including GC/MS, LC/MSn and accurate mass measurements permitted to establish that various addition mechanisms occured during the grafting reaction; (i) radical addition either onto the double bond or at the allylic position followed by combination or elimination reaction and (ii) Diels Alder addition between diunsaturated fatty acyl chains and maleic anhydride could be evidenced.

[1] Feldman D. J. Macromol. Sci. Part A: Pure Appl. Chem. 2005; 42: 587-605.[2] Ciardelli F., Coiai S., Passaglia E., Pucci A., Ruggeri G. Polym. Int. 2008; 57: 805-836.[3] Passaglia E., Coiai S., Augier. S. Progress Polym. Sci. 2009; 34: 911-947.[4] Nakason C., Kaesaman A., Supasanthitikul P. Polym. Testing. 2004; 23: 35-41.


[P267] HPTLC-MS, couplage d’une méthode de chromatographie liquide à haut débit avec la spectrométrie de masse. Que choisir aujourd’hui ?

Gerda Morlock1, Pierre Bernard-Savary2, Aziz Filali-Ansary3

1 Université de Hohenheim, , 70599 Stuttgart, Allemagne2 Chromacim SAS, L'ancienne Eglise, 38340 Pommiers-la Placette, France3 DSAR Sanofi-Aventis 1,Avenue Pierre Brossolette 91385 Chilly-Mazarin, France

Contact: Pierre Bernard-Savary ([email protected])Keywords: Organic and inorganic mass spectrometry, Instrumentation, Separative analysis methods

Le congrès d’HPTLC, qui a eu lieu à Bâle début Juillet a été un énorme succès avec un nombre de participants qui a doublé depuis la dernière édition en 2008. Ceci est en partie dû aux récents développements en matière de couplage de cette méthode avec la spectrométrie de masse. Cette contribution écrite se propose de présenter l’état de l’art et ses perspectives à court terme envisagées sous l’angle du couplage à la spectrométrie de masse et du haut débit. L’HPTLC est particulièrement adaptée au haut débit du fait de sa rapidité, comparativement à l’UPLC qui fait actuellement référence. Quelques exemples comparatifs sur des méthodes actuelles viennent confirmer cette situation par des chiffres. Ceci confirme l’idée selon laquelle un équipement d’HPTLC réalise approximativement le travail de trois équipements d’HPLC, ce qui s’explique par le fait que la séparation est faite en parallèle, et par le fait qu’aucune étape de rinçage n’est nécessaire entre les échantillons, quelle que soit la matrice associée. Dans de nombreux cas certaines étapes de préparation d’échantillon peuvent être simplifiées, voire carrément supprimées. Cette contribution décrit également les différentes solutions pour le couplage avec la spectrométrie de masse. Elle différencie deux catégories d’interfaces selon qu’elles fonctionnent par élution ou bien par désorption du composé. Des études comparatives ont été réalisées et les limites de détection sont du niveau de ce que l’on peut observer en densitométrie dans le spectre UV d’absorption ou de fluorescence. Cependant, une bonne reproductibilité nécessite un minimum de précautions. Mais finalement le couplage avec l’HPTLC reste simple et efficace. Grâce aux nouvelles interfaces HPTLC-MS, un certain nombre de laboratoires risquent donc fort de s’intéresser à l’HPTLC, considérée comme une nouvelle méthode.R. Cody, J. Laramee, H. Dupont Durst, Anal Chem 77 (2005) 2297-2302U. Jautz, G. Morlock, J Chromatogr A 1128 (2006) 244-250H. Luftmann, M. Aranda, G. Morlock, Rapid Commun Mass Spectrom 21 (2007) 3772–3776

Link: www.hptlc.com


[P268] DBS-MS 500, automate pour l’échantillonnage à haut débit pour 500 cartes à la fois. Fiabilité, rapidité et sensibilité des premiers résultats

Pierre Bernard-Savary1

1 Chromacim SAS, L'ancienne Eglise, 38340 Pommiers-la Placette, France

Contact: Pierre Bernard-Savary ([email protected])Keywords: Instrumentation, Proteins, peptides and small molecules quantification , Systems biology

La méthode d’analyse des constituants du sang basée sur une goutte de sang séché sur papier filtre, appelée du sigle DBS pour Dried Blood Spot, est en plein essor actuellement dans différents secteurs, et principalement pour les essais cliniques..Fort d’une expérience de plus de 50 ans dans les appareils automatiques de manipulation d’échantillons liquides et d’analyse, la société Suisse Camag s’est lancée dans ce domaine dans le cadre de l’exploitation d’un ingénieux brevet. Ce brevet d’extraction en phase liquide dans un substrat en couche mince était initialement prévu pour un usage en Chromatographie sur Couche Mince (CCM) ou HPTLC (high-performance thin-layer chromatography) pour sa version performante. Le congrès de cette spécialité, pour laquelle Camag justifie sa réputation de leader, s’est déroulé début Juillet à Bâle en Suisse [1].Cette contribution écrite se propose de présenter les solutions technologiques développées par la société Camag ainsi que les premiers résultats très encourageants des premiers tests effectués de ce robot qui sera commercialisé en fin d’année 2011.La méthode proposée présente de nombreux avantages. Les principaux sont une économie de temps et de coût très importants en comparaison de la méthode de référence par HPLC ou UPLC MS. Ceci est du au transfert direct de l’analyte de la bande de papier vers le spectromètre de masse.Un autre avantage est le gain de sensibilité qui est supérieur à 10x, également du fait de l’extraction directe. [1] www.hptlc.com

Link: http://www.camag.com/v/products/dbs-extraction-device/video.html


Participants list


This list is based on registration on August 23th. A list of participants which registered after this date will be available at the office desk (Salle des gardes room (n°1 on plan page 12))

-A-Miss Christelle ABSALON - INSTITUT DES SCIENCES MOLECULAIRES : [email protected] Claire ADAM - CEA : [email protected] Annie ADRAIT - IRTSV/BGE/EDYP U1038 CEA-GRENOBLE : [email protected] Carlos AFONSO - UPMC/IPCM : [email protected] Rima AIT-BELKACEM - PIT2 : [email protected] Ahmad AL ALI - INSERM DRPA05 : [email protected] Renaud ALBIGOT - IPBS-CNRS : [email protected] Florian ALBRIEUX - UNIVERSITE CLAUDE BERNARD LYON 1 : [email protected] Pascale ALIPRANDI - METABOLIC EXPLORER : [email protected] François ALLAIN - DSV/IBEB/SBTN : [email protected] Lionel ALMERAS - IRBA ANTENNE MARSEILLE : [email protected] Christine ALMUNIA - DSV/IBEB/SBTN : [email protected] Valérie ALOIN - DSV/IBEB/SBTN : [email protected] Béatrice ALONSO - DSV/IBEB/SBTN : [email protected] Béatrice ALPHA - BAZIN - DSV/IBEB/SBTN : [email protected] Magali ANDRE - LFB BIOTECHNOLOGIES : [email protected] Patricia ANGLADE - MICALIS : [email protected] Karim ARAFAH - PLATEFORME BIOPARK D'ARCHAMPS : [email protected] Marie ARLOTTO - INSERM U1038 / EDYP : [email protected] Jean ARMENGAUD - DSV/IBEB/SBTN : [email protected] Carine ARNAUDGUILHEM - IPREM UMR 5254 : [email protected] Léo AUBERT - SERVICE FACTURIER : [email protected] Frédéric AUBRIET - LSMCL - UNIVERSITÉ PAUL VERLAINE : [email protected] Stephane AUDEBERT - CRCM : [email protected] Rémy AURAND - INRA PACA : [email protected] Aline AURIAS - SPECTRA ANALYSE - EDITIONS PCI : [email protected] Sophie AYCIRIEX - PLATEFORME FINANCIERE PHARMACIE : [email protected] Christine AYOUB - PROTEABIO EUROPE : [email protected]

-B-Mr Sacha BAGINSKY - MARTIN LUTHER UNIVERSITÄT HALLE WITTENBERG : [email protected] Catherine BALTHASAR - CLUZEAU INFO LABO : [email protected] Sylvie BALZANI - SANOFI-AVENTIS : [email protected] Perdita BARRAN - UNIVERSITY OF EDINBURGH : [email protected] Caroline BARRÈRE - INSA DE ROUEN : [email protected] Damien BARTHE - CEA/GRENOBLE : [email protected] Isabelle BATXELLI-MOLINA - CNRS : [email protected] Emilie BAUDELET - INSERM DRMRS : [email protected] Mathieu BAUDET - CEA GRENOBLE : [email protected] Bruno BAUDIN - UFR PHARMACIE : [email protected] Karima BAUDIN - PERKINELMER : [email protected] Mathilde BEAU - INGÉNIEUR D'ÉTUDE : [email protected] Martine BEAUFOUR - CNRS-CBM : [email protected] Chérine BECHARA - UPMC - LBM : [email protected] Francois BECHER - CEA SACLAY : [email protected] Maya BELGHAZI - CNRS : [email protected] Patrick BELLEMIN - BIO RAD : [email protected] Hélène BELVA-BESNET - SANOFI-AVENTIS : [email protected] Farid BENKACI-ALI - CHERCHEUR : [email protected] Yves BÉRARD - SANOFI PASTEUR : [email protected] Carole BERAUD - ETUDIANTE : [email protected] Pierre BERNARD SAVARY - CHROMACIM SAS : [email protected]


Dr Stéphane BERNILLON - UMR1332 BIOLOGIE DU FRUIT ET PATHOLOGIE : [email protected] Laurence BERTHON - CEA MARCOULE : [email protected] Fabrice BERTILE - CNRS IPHC DSA : [email protected] Gwladys BERTIN - IRD-UMR216 : [email protected] Sophie BERTIN - INSTITUT DE RECHERCHES SERVIER : [email protected] Michael BIACCHI - INSTITUT DE CHIMIE DE STRASBOURG : [email protected] Jordane BIARC - UCSF : [email protected] Claudia BICH - ICSN CNRS UPR 2301 : [email protected] Willy BIENVENUT - CHERCHEUR : [email protected] Céline BLAND - DSV/IBEB/SBTN : [email protected] Mélisande BLEIN-NICOLAS - INRA : [email protected] Joel BOCKAERT - CNRS IGF : [email protected] Audrey BODIN - DOCTORANTE : [email protected] Elisabetta BOERI ERBA - ETH : [email protected] Philippe BOGARD - SERVA ELECTROPHORESIS GMBH : [email protected] Wilfrid BOIREAU - INSTITUT FEMTO-ST : [email protected] Gérard BOLBACH - UMPC - LBM : [email protected] Marc BONNEU - UNIVERSITE BORDEAUX SEGALEN POLE PROTÉOMIQUE : [email protected] Andy BORTHWICK - NONLINEAR DYNAMICS : [email protected] Ali BOUAMRANI - INSERM U836-EQ7 : [email protected] Stéphane BOUCHONNET - ECOLE POLYTECHNIQUE : [email protected] Guy BOUCHOUX - ECOLE POLYTECHNIQUE DCMR : [email protected] Pierre Edouard BOUGIS - PIERRE EDOUARD BOUGIS : [email protected] Stéphanie BOULLANGER - CERMAV/CNRS : [email protected] Valentin BOUQUET - ASA - ADVANCED SOLUTIONS ACCELERATOR : [email protected] Valérie BOURDON - UNIV. PAUL SABATIER : [email protected] Emmanuel BOURGOGNE - UNIVERSITÉ PARIS DESCARTES : [email protected] Céline BOURSIER - UNIVERSITÉ PARIS SUD 11 : [email protected] Marie-pierre BOUSQUET-DUBOUCH - IPBS - CNRS : [email protected] David BOUYSSIÉ - IPBS/CNRS : [email protected] Brice BOUYSSIERE - IPREM UMR 5254 : [email protected] Bessem BRAHIM - IPMC/CSOB : [email protected] Catherine BRETHENOUX - SANOFI : [email protected] Jennifer BRODBELT - UNIVERSITY OF TEXAS : [email protected] Cedric BROUSSARD - INSERM : [email protected] Sabine BRUGIÈRE - INGÉNIEUR : [email protected] Christophe BRULEY - CEA GRENOBLE : [email protected] Virginie BRUN - UNITE DE BIOLOGIE A GRANDE ECHELLE : [email protected] Claire BRUNET - UNIVERSITÉ CLAUDE BERNARD LYON 1 : [email protected] William BUCHMANN - UNIVERSITÉ D'EVRY VAL D'ESSONNE : [email protected] Philippe BULET - LABORATOIRE AGIM : [email protected] Audrey BULETE - CNRS UMR 5280 : [email protected] Corinne BURÉ - CBMN UMR 5248 / CGF : [email protected] Alexandre BUREL - UNIVERSITE DE STRASBOURG : [email protected] Cécile BUSSET - AB SCIEX : [email protected]

-C-Dr Martine CADENE - CBM CNRS : [email protected] David CALLIGARIS - CRO2-PIT2 : [email protected] Luc CAMOIN - MARSEILLE PROTÉOMIQUE - CRCM : [email protected] Francis CANON - POST-DOCTORANT : [email protected] Sonia CANTEL - IBMM UMR 5247 UNIVERSITÉ MONTPELLIER 1 ET 2 : [email protected] Christine CARAPITO - CNRS IPHC DSA : [email protected] Vincent CARRÉ - LSMCL - UNIVERSITÉ PAUL VERLAINE : [email protected] Patricia CASTEL - INSTITUT DES SCIENCES MOLECULAIRES : [email protected] Guillaume CAZALS - UNIVERSITÉ DE MONTPELLIER 2 : [email protected]


Mrs Delphine CENTENO - CENTRE INRA CLERMONT-FD-THEIX : [email protected] Christopher CERRUTI - ICSN CNRS UPR 2301 : [email protected] Philippe CHAFEY - INSERM DRPA05 : [email protected] Ludovic CHAILLET - SAIC : [email protected] Patrick CHAIMBAULT - LSMCL - UNIVERSITÉ PAUL VERLAINE : [email protected] Christophe CHAMBON - ASSISTANT INGÉNIEUR : [email protected] Julia CHAMOT-ROOKE - LABORATOIRE DCMR : [email protected] Thibault CHAMPION - BIOMÉRIEUX : [email protected] Karima CHAOUI - IPBS/CNRS : [email protected] Solenne CHARDONNET - IBBMC, UNIVERSITÉ PARIS-SUD : [email protected] Laurence CHARLES - UNIVERSITÉ DE PROVENCE : [email protected] Marie-Hélène CHARLES - BIOMÉRIEUX : [email protected] Guillaume CHARLOT - LGS LAB GAZ SYSTEMS : [email protected] Yannick CHARRETIER - BIOMÉRIEUX : [email protected] Claude CHARVY - CNRS : [email protected] Pierre CHAURAND - : [email protected] Guylaine CHAUSSINAND - DSV/IBEB/SBTN : [email protected] Virginie CHAVANT - IGBMC : [email protected] Jérôme CHENAU - CEA DE SACLAY : [email protected] Christophe CHENDO - FÉDÉRATION DES SCIENCES CHIMIQUES DE MARSEILLE : [email protected] Sylvain CHÉREAU - ONIRIS - LABERCA : [email protected] Sylvie CHEVOLLEAU - AXIOM - INRA : [email protected] Cerina CHHUON - PLATEAU PROTÉOMES NECKER, PARIS : [email protected] Giovanni CHIAPPETTA - ESPCI PARISTECH : [email protected] Fabien CHIROT - EZUS/ UNIVERSITÉ CLAUDE BERNARD LYON 1 : [email protected] Joseph CHRISTIE - OLEZA - DSV/IBEB/SBTN : [email protected] Gérémy CLAIR - DSV/IBEB/SBTN : [email protected] Catherine CLAPAROLS - UNIV. PAUL SABATIER : [email protected] Christophe CLARYSSE - PERKINELMER : [email protected] Stéphane CLAVEROL - UNIVERSITE BORDEAUX SEGALEN POLE PROTÉOMIQUE : [email protected] Philippe CLEON - SANOFI AVENTIS : [email protected] Emmanuelle COM - SAIC : [email protected] Florence COMBES - CEA GRENOBLE : [email protected] Graham COOKS - PURDUE UNIVERSITY : [email protected] Laurent COQUET - CNRS UMR6270 : [email protected] Cyril CORBET - SERVICE FACTURIER : [email protected] Agnès CORBIN - NONLINEAR DYNAMICS : [email protected] David CORNU - CNRS : [email protected] Aurélie CORNUT-THIBAUT - INSERM DRLYS FACTURATION : [email protected] Pascal COSETTE - UNIVERSITE DE ROUEN : [email protected] Mélaine COURCOUL - INSERM DRPA05 : [email protected] Yohann COUTÉ - LABORATOIRE BIOLOGIE À GRANDE ECHELLE : [email protected] Morgane COUVET - INSTITUT ALBERT BONNIOT : [email protected] Cécile CREN - CNRS UMR 5280 : [email protected] Emmanuel CRENN - PROMEGA : [email protected] Myriam CUBIZOLLES - CEA : [email protected]

-D-Mr Christophe DABADIE - THERMO ELECTRON SAS : [email protected] Anne-sophie DABERT-GAY - IPMC - CNRS : [email protected] Saïda DANOUN - UMR 5546 UPS-CNRS : [email protected] Carine DAROLLES - DSV/IBEB/SBTN : [email protected] Claire DAULY - THERMO ELECTRON SASMrs Anne - Hélène DAVIN - DSV/IBEB/SBTN : [email protected] Christel DAYANG - STALLERGENES : [email protected]


Mr Laurent DEBRAUWER - AXIOM - INRA : [email protected] Yoann DECEUNINCK - ONIRIS - LABERCA : [email protected] Célia DECHAVANNE - IRD UMR 216 : [email protected] Paulette DECOTTIGNIES - CNRS/ UNIVERSITÉ PARIS SUD : [email protected] Mathilde DECOURCELLE - INRA : [email protected] Alain DEDIEU - DSV/IBEB/SBTN : [email protected] Pieter DEKOCKER - MS NOISE : [email protected] Julien DELOBEL - SERVICE RÉGIONAL VAUDOIS DE TRANSFUSION SANGUINE : [email protected] Frédéric DELOLME - INSERM DRLYS FACTURATION : [email protected] Edith DEMETTRE-VERCEIL - FUNCTIONAL PROTEOMICS PLATFORM - FPP : [email protected] Nicolas DESBENOIT - INSTITUT DE LA VISION, INSERM S968 : [email protected] Louis DESCHANEL - THERMO FISHER SCIENTIFIC : [email protected] Michel DESJARDINS - UNIVERSITE DE MONTREAL : [email protected] Cindy DIERYCKX - AI CNRS : [email protected] Laurent DIOLOGENT - UNIVERSITÉ DE LILLE 1 : [email protected] Bruno DOMON - LUXEMBOURG CLINICAL PROTEOMICS CENTER : [email protected] Christian DUCHAMP - UNIVERSITE CLAUDE BERNARD LYON 1 : [email protected] Magalie DUCHATEAU - PLATE-FORME DE PROTÉOMIQUE - INSTITUT PASTEUR : [email protected] Patrick DUCOROY - CLIPP (CLINICAL AND INNOVATION PROTEOMIC PLATFORM) : [email protected] Manuelle DUCOUX-PETIT - IPBS/CNRS/UPS : [email protected] Céline DUCRUIX - BIOMÉRIEUX : [email protected] Philippe DUGOURD - CNRS ET UNIVERSITÉ DE LYON : [email protected] Véronique DUPIERRIS - CEA - DSV -IRTSV- BGE -EDYP : [email protected] Mathieu DUPRÉ - UNIVERSITÉ MONTPELLIER 2 : [email protected] Jean- William DUPUY - UNIVERSITE BORDEAUX SEGALEN POLE PROTÉOMIQUE : [email protected] Jocelyn DUPUY - THERMO ELECTRON SAS : [email protected] Sylvère DURAND - INSTITUT CURIE - HÔPITAL RENÉ HUGUENIN : [email protected] Elodie DURIEZ - CRP-SANTÉ : [email protected] Emie DURIGHELLO - DSV/IBEB/SBTN : [email protected]

-E-Dr Aleksander EDELMAN - CENTRE DE RECHERCHE INSERM U845 : [email protected] Marven EL OSTA - CLIPP (CLINICAL AND INNOVATION PROTEOMIC PLATFORM) : [email protected] Nicolas ELIE - ICSN CNRS UPR2301 : [email protected] Christine ENJALBAL - UNIVERSITÉ DE MONTPELLIER 2 : [email protected] Quentin ENJALBERT - EZUS/ UNIVERSITÉ CLAUDE BERNARD LYON 1 : [email protected] Eric EZAN - DSV/IBEB/SBTN : [email protected]

-F-Mr Bertrand FABRE - DOCTORANT : [email protected] François FENAILLE - CEA SACLAY : [email protected] Bernard FERNANDEZ - DSV/IBEB/SBTN : [email protected] Myriam FERRO - CEA/GRENOBLE : [email protected] Stéphane FESSEMAZ - BIO RAD : [email protected] Christophe FLAHAUT - LABORATOIRE DE PHYSIOPATHOLOGIE DE LA BHE : [email protected] Céline FLEURY - CEA-GRENOBLE : [email protected] Catherine FONBONNE - EZUS/ UNIVERSITÉ CLAUDE BERNARD LYON 1 : [email protected] Eric FOREST - INSTITUT DE BIOLOGIE STRUCTURALE : [email protected] Laetitia FOUILLEN - CNRS LABORATOIRE DE BIOGENESE MEMBRANAIRE 0635 : [email protected]


Mr Thierry FOUQUET - CRP HENRI TUDOR : [email protected] Sylvie FOURNIER - UMR 5546 CNRS/UPS : [email protected] Isabelle FOURNIER - UNIVERSITÉ DE LILLE 1 : [email protected] Patrick FOURQUET - CNRS : [email protected] Xavier FRAMBOISIER - LRGP CNRS : [email protected] Julien FRANCK - UNIVERSITÉ DE LILLE 1 : [email protected] Yannis FRANCOIS - MAÎTRE DE CONFÉRENCES UDS : [email protected] Carine FROMENT - IPBS-CNRS : [email protected]

-G-Mr Guillaume GABANT - INGÉNIEUR D'ÉTUDES CNRS : [email protected] Fanny GAILLARD - STATION BIOLOGIQUE DE ROSCOFF : [email protected] Jean-Charles GAILLARD - DSV/IBEB/SBTN : [email protected] Patrice GARCIA - L.C.H. : [email protected] Jérôme Garin - LABORATOIRE BIOLOGIE À GRANDE ECHELLE (BGE) : [email protected] Jean Luc GATTI - CENTRE DE SOPHIA-ANTIPOLIS : [email protected] Mathieu GAUDIN - TECHNOLOGIE SERVIER : [email protected] Joseph GAULT - LABORATOIRE DCMR : [email protected] Violette GAUTIER - DOCTORANTE : [email protected] Anne-Claude GAVIN - EMBL HEIDELBERG : [email protected] Sylvain GHILINI - GALDERMA R&D : [email protected] Françoise GILARD - CNRS IBP : [email protected] Ludovic GILLET - INSTITUTE OF MOLECULAR SYSTEMS BIOLOGYMr Rémi GIORDANENGO - RHODIA OPÉRATION AUBERVILLIERS : [email protected] Vincent GIRARD - CR1 CNRS : [email protected] Marion GIROD - UNIVERSITÉ LYON 1 ET CNRS : [email protected] Alexandre GIULIANI - N.A. : [email protected] Florence GONNET - Prof : [email protected] Anne GONZALEZ DE PEREDO - CNRS : [email protected] Yann GOURIOU - CAPM : [email protected] Jérôme GOVIN - BIOLOGIE À GRANDE ECHELLE U1038 INSERM / CEA / UJF : [email protected] Samuel GRANJEAUD - INSERM U928 : [email protected] Seth GRANT - WELLCOME TRUST SANGER INSTITUTE : [email protected] Florence GUERARD - CNRS IBP : [email protected] Julien GUERIN - BIOSOLVE CHIMIE : [email protected] Philippe GUÉRIN - DSV/IBEB/SBTN : [email protected] Vincent GUÉRINEAU - ICSN-CNRS UPR2301 : [email protected] Céline GUIGUE - BERTIN PHARMA : [email protected] François GUILLONNEAU - PLATEFORME PROTÉOMIQUE UNIVERSITÉ PARIS DESCARTES : [email protected] Alain GUILLOT - INGENIEUR PROTÉOMIQUE : [email protected]

-H-Mrs Agnès HAGèGE - DSV/IBEB/SBTN : [email protected] Gregory HAMM - IMABIOTECH : [email protected] Philippe HAMMANN - PLATEFORME PROTÉOMIQUE STRASBOURG ESPLANADE : [email protected] Julie HARDOUIN - UNIVERSITÉ DE ROUEN : [email protected] Grégoire HARICHAUX - INRA : [email protected] Fabien HARTEL - STALLERGENES : [email protected] Pierre-yves HAUMONT - AB SCIEX : [email protected] Michel HÉBRAUD - DIRECTEUR DE RECHERCHE : [email protected] Sonia HEM - INRA : [email protected] Natali HENRIQUES - UNIVERSITE CLAUDE BERNARD LYON 1 : [email protected] Céline HENRY - MICALIS : [email protected] Chirstine HERR - BRUKER DALTONIQUE : [email protected] Anne-marie HESSE - CEA GRENOBLE : [email protected] Céline HEU - UNIVERSITÉ DE FRANCHE COMTÉ - UFR SMP : [email protected]


Miss Mélanie HILLION - LMDF-SME EA 4312 ; UNIVERSITÉ DE ROUEN : [email protected] Agnès HOVASSE - CNRS IPHC DSA : [email protected] Marie HUBERT-ROUX - CNRS UMR 6014, UNIVERSITÉ DE ROUEN : [email protected] Isabelle HUDE - INSTITUT DE RECHERCHE PIERRE FABRE : [email protected] Hans Caspar HÜRLIMANN - CNRS IBGC UMR 5095 CNRS *05.56* : [email protected] Olivier HUTINEL - AB SCIEX : [email protected]

-I-Mr Gilles IMBERT - CEA/DSV/IBEB/LDCAE : [email protected]

-J-Miss Aurore JAFFUEL - EZUS/ UNIVERSITÉ CLAUDE BERNARD LYON 1 : [email protected] Emilien JAMIN - INRA AXIOM : [email protected] Lucie JAQUILLARD - DOCTORANTE : [email protected] Michel JAQUINOD - CHERCHEUR : [email protected] Julien JARDIN - CENTRE DE RENNES : [email protected] Nolwenn JARNO - CEA GRENOBLE - BGE -EDYP : [email protected] Martin JARROLD - CHARGE DETECTION MASS SPECTROMETRY : [email protected] Mathilde JOINT - INRA : [email protected] Charlotte JOLY - CENTRE INRA CLERMONT-FD-THEIX : [email protected] Pierre JONLET - UNIVERSITÉ DE LIÈGE : [email protected]

-K-Mr Zied KAABIA - ONIRIS - LABERCA : [email protected] Said KINANI - EDF-RECHERCHE ET DEVELOPPEMENT : [email protected] Pascal KINTZ - X-PERTISE CONSULTING STRASBOURG : [email protected] Agneta KISS - CNRS-DÉPARTEMENT SERVICE CENTRAL D'ANALYSE : [email protected] Thomas KNIGGE - MAÎTRE DE CONFERENCES : [email protected] Oliver KOHLBACHER - TUEBINGEN UNIVERSITY : [email protected] Markus KOLBE - DECODON GMBH : [email protected] Alexandra KRAUT - CEA GRENOBLE : [email protected] Lauriane KUHN - PLATEFORME PROTÉOMIQUE STRASBOURG ESPLANADE : [email protected] Akihiko KUSAI - JEOL EUROPEDr Anthony KWASIBORSKI - PUBLIQUE : [email protected]

-L-Miss Valérie LABAS - INRA : [email protected] Jérôme LACOMBE - CRLC VAL D'AURELLE - IRCM : [email protected] Anne-sophie LACOSTE - USTL USR 3290 MSAP : [email protected] Chrystelle LACROIX - IPBS CNRS UMR 5089 UNIVERSITÉ DE TOULOUSE : [email protected] Daniel LAFITTE - UNIVERSITE DE LA MEDITERRANEE : [email protected] Philippe LAGARDE - SANOFI-AVENTIS CHIMIE : [email protected] Arnaud LAMARCA - PLATE-FORME BIOPARK D'ARCHAMPS : [email protected] Marine LAMBERT - INRA : [email protected] Pierre-hervé LAMBERT - INSTITUT DE RECHERCHES SERVIER : [email protected] Catherine LANGE - INSA DE ROUEN : [email protected] Olivier LAPRÉVOTE - PLATEFORME FINANCIERE PHARMACIE : [email protected] Colette LARRE - INRA : [email protected] Hélène LAVANANT - CNRS UMR 6014 COBRA, UNIVERSITÉ DE ROUEN : [email protected] Régis LAVIGNE - SAIC : [email protected] Adina LAZAR - CRICM UPMC : [email protected] Bruno LE BIZEC - LABERCA - ONIRIS : [email protected] Jean Pierre LE CAER - CNRS ICSN : [email protected] Pierre LE MARECHAL - UNIVERSITÉ PARIS-SUD : [email protected] Diane LEBEAU - CEA-SACLAY : [email protected] Melanie LEBRETON - CNRS : [email protected] Régine LEBRUN - CNRS : [email protected] Eric LECLERC - SANOFI-AVENTIS R & D : [email protected]; [email protected]


Mr Alban LECOLLEN - PROTEABIO EUROPE : [email protected] Marjorie LEDUC - INSERM U1016 : [email protected] Jana LEE - PROTEOME SOFTWARE : [email protected] Bertrand LEGERET - CNRS UMR 6504 : [email protected] Thierry LEGOUPIL - THERMO ELECTRON SAS : [email protected] Emmanuelle LEIZE - INSTITUT DE CHIMIE DE STRASBOURG : [email protected] Nadège LEMAHIEU - ANSES DPR UPCMAV : [email protected] Joel LEMAIRE - LCP : [email protected] Jérôme LEMOINE - EZUS/ UNIVERSITÉ CLAUDE BERNARD LYON 1 : [email protected] Sarah LENNON - CNRS IPHC DSA : [email protected] Eric LEPOUTRE - GENGAZ EURL : [email protected] Emma-dune LERICHE - CNRS UMR 6014, COBRA, UNIVERSITÉ DE ROUEN : [email protected] Eric LEROY - UNIV. PAUL SABATIER : [email protected] Denis LESAGE - UNIVERSITÉ PARIS VI : [email protected] Mikael LEVI - SHIMADZU : [email protected] Danielle LIBONG - GROUPE DE CHIMIE ANALYTIQUE EA 4041-UPS XI : [email protected] Sabrina LIGNON - CNRS : [email protected] Martin LINKE - NH DYEAGNOSTICS : [email protected] Laurence LINS - UNIVERSITE DE LIEGE : [email protected] Joanna LIPECKA - INSERM U894 : [email protected] Damarys LOEW - INSTITUT CURIE : [email protected] Rémi LONGUESPÉE - UNIVERSITÉ DE LILLE 1 : [email protected] Alain LORPHELIN - DSV/IBEB/SBTN : [email protected] Corinne LOUTELIER-BOURHIS - CNRS UMR 6014, COBRA, UNIVERSITÉ DE ROUEN : [email protected] Mathilde LOUWAGIE - CEA : [email protected] Bernard LYAN - CENTRE INRA CLERMONT-FD-THEIX : [email protected]

-M-Mr Florian MAIRE - CNRS UMR6014 COBRA, UNIVERSITÉ DE ROUEN : [email protected] Yannis MAJOR - UNIVERSITE DE PROVENCE : [email protected] Mohamed MAJOR - UNIVERSITE DE PROVENCE : [email protected] Véronique MALARD - DSV/IBEB/SBTN : [email protected] Christian MALOSSE - CNRS : [email protected] Alain MANGÉ - CRLC VAL D'AURELLE - IRCM : [email protected] Etienne MAOUT - THERMO ELECTRON SAS : [email protected] Marlène MARCELLIN - INGÉNIEUR D'ÉTUDES : [email protected] Didier MARCELLIN - DSV/IBEB/SBTN : [email protected] Christophe MARCHAND - CNRS : [email protected] Philippe MARIN - IGF : [email protected] Armelle MARTELET - BIOMÉRIEUX : [email protected] Marion MARTIGNAC - UNIV. PAUL SABATIER : [email protected] Patrice MARTIN - INRA - GÉNÉTIQUE ANIMALE ET BIOLOGIE INTÉGRATIVE : [email protected] Nathalie MARTY-GASSET - INRA / INP : [email protected] Laure MARVIN - NESTEC LTD. : [email protected] Jean MARY - MAÎTRE DE CONFÉRENCES : [email protected] Christophe MASSELON - CEA GRENOBLE : [email protected] Sabine MATALLANA SURGET - OBSERVATOIRE D'OCÉANOLOGIE DE BANYULS : [email protected] Lucrèce MATHERON - UPMC - LBM : [email protected] Mariette MATONDO - CONFERENCE : [email protected] Benoit MAUNIT - ENSEIGNANT CHERCHEUR : [email protected] Patrick MAYEUX - INSERM - DRPA05 : [email protected] Michael MAZARIN - CENTRE DE RECHERCHE DE SOLAIZE - TOTAL : [email protected] Dominique MAZZOCUT - INSERM DRLYS FACTURATION : [email protected] Thierry MEINNEL - CNRS, ISV-UPR2355 : [email protected] Noura MEKLAT - CENTRE INRA CLERMONT-FD-THEIX : [email protected]


Mr Sergio MELIS - LECO FRANCE : [email protected] Benoît MENAND - CNRS : [email protected] Franck MERLIER - UTC : [email protected] Nathalie MESPLET - SANOFI CHIMIE : [email protected] Frédéric METRAL - AGILENT TECHNOLOGIES SALES AND SERVICES GMBH AND CO KG : [email protected] Emmanuelle MEUDEC - INRA : [email protected] Carole MIGNÉ - CENTRE INRA CLERMONT-FD-THEIX : [email protected] Florence MIGOT-NABIAS - IRD UMR 216 : [email protected] Carole MINISINI - ABSCIEX : [email protected] Guy MIRANDA - INRA-CRJ UNITÉ GABI_LGS : [email protected] Michel- Yves MISTOU - MICALIS : [email protected] Catherine MOALI - INSTITUT DE BIOLOGIE ET CHIMIE DES PROTÉINES : [email protected] Laurence MOLINA - SYSDIAG UMR 3145 CNRS BIORAD : [email protected] Jean-marc MONNEUSE - PHYLOGENE : [email protected] Valérie MONNIER - FÉDÉRATION DES SCIENCES CHIMIQUES DE MARSEILLE : [email protected] Bernard MONSARRAT - CNRS : [email protected] Marie-hélène MONTANÉ - CNRS : [email protected] Stéphane MOREAU - SHIMADZU : [email protected] Paul MOREL - LABORATOIRE PBS UMR6270 : [email protected] Claire MOUCHE - INSTITUT DES SCIENCES MOLECULAIRES : [email protected] Laetitia MOULS - INRA : [email protected] Emmanuelle MOUTON BARBOSA - IPBS CNRS : [email protected] Markus MULLER - SWISS INSTITUTE OF BIOINFORMATICS : [email protected] Jean-françois MULLER - UNIVERSITÉ PAUL VERLAINE - METZ : [email protected] Jean- Pierre MUNIER - JEOL EUROPE SAS : [email protected]

-N-Dr Sophie NALLET - CRUCELL SWITZERLAND AG : [email protected] Edlira NANO - INRA : [email protected] Bertrand NAUDIN - UNIVERSITE DE ROUEN : [email protected] Alexis NAZABAL - COVALX : [email protected] Luc NEGRONI - CENTRE DE GENOMIQUE FONCTIONNELLE : [email protected] Claude NETTER - DIONEX : [email protected] Henri NICAR - ABSCIEX : [email protected] Edith NICOL - CNRS : [email protected]

-O-Mr Antoine OBRY - UMR 6270 : [email protected] Alexia ORTIZ - UNIVERSITÉ DE LILLE 1 - MSAP USR 3290 : [email protected] Laurent OUERDANE - IPREM UMR 5254 : [email protected] Sophiane OUGHLIS - UNIVERSITÉ PARIS 13 CSPBAT – LBPS : [email protected] Christopher OVERALL - UNIVERSITY BRISTISH COLUMBIA : [email protected]

-P-Mrs Adeline PAGE - IGBMC : [email protected] Fabienne PALGE - F-DBS : [email protected] Cedric PARIS - ENSAIA : [email protected] Xaviera PENNANEC - INRA UMR CSGA : [email protected] Marie PÉROT-TAILLANDIER - IPCM, UNIVERSITÉ PIERRE & MARIE CURIE PARIS 6 : [email protected] Michel PERROT - UNIVERSITE BORDEAUX SEGALEN POLE PROTÉOMIQUE : [email protected] Madeleine PEYTAVIN - THERMO ELECTRON SAS : [email protected] Delphine PFLIEGER - CHERCHEUSE : [email protected] Olivier PIBLE - DSV/IBEB/SBTN : [email protected] Carole PICHEREAUX - CNRS : [email protected] Paola PICOTTI - ETH ZURICH : [email protected] Charles PINEAU - PLATEFORME PROTÉOMIQUE BIOGENOUEST : [email protected]


Mr Jérémy PINGUET - CHU GABRIEL MONTPIED : [email protected] Benoît PINSON - CNRS IBGC UMR 5095 CNRS *05.56* : [email protected] Florence POIRIER - UNIVERSITÉ PARIS 13 : [email protected] Pascal PONCET - ESPCI, LSABM : [email protected] Frédéric PONT - INSERM DRTLS : [email protected] Matthieu POPHILLAT - CIML SERVICE DE PROTÉOMIQUE : [email protected] Noelle POTIER - CNRS : [email protected] Hugues PREUDHOMME - IPREM UMR 5254 : [email protected] Michel PRUDENT - SERVICE RÉGIONAL VAUDOIS DE TRANSFUSION SANGUINE : [email protected] Cédric PRZYBYLSKI - ETUDIANT : [email protected] Virginie PUECH PAGES - C.N.R.S : [email protected] Estelle PUJOS-GUILLOT - CENTRE INRA CLERMONT-FD-THEIX : [email protected]

-Q-Miss Lei QI - DSV/IBEB/SBTN : [email protected] Jusal QUANICO - MALDI IMAGING TEAM (FABMS) : [email protected] Florence QUÉLIN - UFR DES SCIENCES DE LA SANTÉ PIFO . UPRES EA 2493 : [email protected]

-R-Miss Amandine RACAUD - CENTRE DE RECHERCHE DE SOLAIZE - TOTAL : [email protected] Nicolas RAYNAL - CEM µ WAVES : [email protected] Virginie REDEKER - LEBS, CNRS : [email protected] Sandra RENIER - DOCTORAT : [email protected] Marie-france ROBBE - CEA : [email protected] Ophélie ROBINE - CNRS : [email protected] Gislain ROCHEBLOINE - SANOFI : [email protected] Beatrice ROCHER - LEMA EA32 22, UFR ST : [email protected] David RODARIE - TECAN FRANCE SAS : [email protected] Valérie ROFIDAL - INRA : [email protected] Hélène ROGNIAUX - INRA PLATE-FORME BIBS : [email protected] Christian ROLANDO - UNIVERSITE DE LILLE : [email protected] David ROPARTZ - INRA : [email protected] Florence ROUX-DALVAI - IPBS-CNRS : [email protected] Carolina RUBIANO - PONTIFICIA UNIVERSIDAD JAVERIANA : [email protected] Frank RUFFENACH - IGBMC : [email protected]

-S-Dr Emmanuelle SACHON - UPMC - LBM : [email protected] Sandrine SAGAN - UPMC - LBM : [email protected] Nicole SAGE - DSV/IBEB/SBTN : [email protected] Laila SAGO - INSERM - DRPA05 : [email protected] Virginie SALNOT - INSERM DRPA05 : [email protected] Thierry SALOMON - CELL BIOSCIENCES : [email protected] Jean- Yves SALPIN - UNIVERSITÉ D'EVRY VAL D'ESSONNE : [email protected] Arnaud SALVADOR - EZUS/ UNIVERSITÉ CLAUDE BERNARD LYON 1 : [email protected] Nicolas SALVETAT - SYSDIAG UMR3145 CNRS/BIO-RAD : [email protected] Michel SALZET - UNIVERSITÉ DE LILLE 1 : [email protected] Xavier SAUNIER - TECAN FRANCE SAS : [email protected] Marcelle SAUZON - BIOMÉRIEUX : [email protected] Thierry SAYD - INGENIEUR : [email protected] Christine SCHAEFFER-REISS - CNRS IPHC DSA : [email protected] Jean- Louis SCHAFFAR - EURISO-TOP : [email protected] Therese SCHEMBRI - UNIVERSITE DE LA MEDITERRANEE : [email protected] Odile SCHILTZ - IPBS, CNRS : [email protected] Jean- Marie SCHMITTER - UNIVERSITÉ DE BORDEAUX : [email protected] Sébastien SCHRAMM - LSMCL - UNIVERSITÉ PAUL VERLAINE : [email protected] Aurelie SEASSAU - CENTRE DE SOPHIA ANTIPOLIS INRA : [email protected]


Mr Gaétan SEEBURN - EURISO-TOP : [email protected] Lyna SELLAMI - PIT2/CRO2 : [email protected] Etienne SÉMON - INRA UMR CSGA : [email protected] Hélène SENECHAL - ESPCI, LSABM : [email protected] Michel SEVE - PLATEFORME PROTÉOMIQUE PROMÉTHÉE : [email protected] Martial SEVENO - IR CNRS PLATE-FORME DE PROTÉOMIQUE FONCTIONNELLE : [email protected] Pascal SEYER - CNRS : [email protected] Alexandre SEYER - CEA SACLAY : [email protected] Youcef SHAHALI - ESPCI, LSABM : [email protected] Estelle SIBILLE - LSMCL - UNIVERSITÉ PAUL VERLAINE : [email protected] Luca SIGNOR - INSTITUT DE BIOLOGIE STRUCTURALE : [email protected] Romain SIMON - EZUS/ UNIVERSITÉ CLAUDE BERNARD LYON 1 : [email protected] Gilbert SKORSKI - PHYLOGENE : [email protected] Audrey SOLGADI - SAMM - FACULTÉ DE PHARMACIE - UPS 11 : [email protected] Jean Marc SOUQUET - INRA : [email protected] Jonathan STAUBER - IMABIOTECH : [email protected] Alexandre STELLA - CNRS : [email protected]

-T-Prof Jean- Claude TABET - IPMC-UMR 7201-UFR726-LCSOB-CASE 45 : [email protected] Méhdi TAIYA - UBO-UNIVERSITÉ DE BRETAGNE OCCIDENTALE : [email protected] Marianne TARDIF - CEA : [email protected] Ana Paula TEIXEIRA-GOMES - INRA : [email protected] Nathan TENE - CENTRE UNIVERSITAIRE DE FORMATION ET DE RECHERCHE : [email protected] Laetitia THERON - INRA - ENSAT : [email protected] Danièle THIERSE - CNRS IPHC DSA : [email protected] Robert Alain TOILLON - SERVICE FACTURIER : [email protected] David TOUBOUL - ICSN CNRS UPR2301 : [email protected] Mathieu TRAUCHESSEC - CEA / METABOLIC EXPLORER : [email protected] Sarah TRIBOULET - ETUDIANTE EN THÈSE : [email protected] Yury TSYBIN - EPFL LAUSANNE : [email protected]

-U-Dr Svetlana UZBEKOVA - INRA : [email protected]

-V-Dr Gilles VALETTE - UNIVERSITÉ DE MONTPELLIER 2 : [email protected] Cyrille VALLÉE - ONIRIS - LABERCA : [email protected] Benoit VALOT - PAPPSO, UMR DE GÉNÉTIQUE VÉGÉTALE : [email protected] Gerard VAN DER LAAN - MS VISION BV : [email protected] Guillaume VAN DER REST - CNRS : [email protected] Alain VAN DORSSELAER - CNRS IPHC DSA : [email protected] Franck VANDERMOERE - INSTITUT DE GÉNOMIQUE FONCTIONNELLE : [email protected] Anne-sophie VERCOUTTER-EDOUART - UNITÉ GLYCOBIOLOGIE STRUCTURALE ET FONCTIONNELLE : [email protected] Yann VERDIER - ESPCI PARISTECH : [email protected] Patrick VESCOVI - LGS LAB GAZ SYSTEMS : [email protected] Didier VIALA - ASSISTANT INGÉNIEUR : [email protected] Frédéric VIART - ASA - ADVANCED SOLUTIONS ACCELERATOR : [email protected] Claude VIDAUD - DSV/IBEB/SBTN : [email protected] Sébastien VILAIN - UNIVERSITE BORDEAUX SEGALEN POLE PROTÉOMIQUE : [email protected] Claude VILLARD - UNIVERSITE DE LA MEDITERRANEE : [email protected] Jean- Baptiste VINCENDET - AB SCIEX : [email protected] Joëlle VINH - ESPCI PARISTECH : [email protected] Olga VITEK - PURDUE UNIVERSITY : [email protected] Christiane VITRY - INSTITUT DES SCIENCES MOLECULAIRES : [email protected] Kees VLAK - HARLOW ENTERPRISE HUB : [email protected]


-W-Dr Reiner WESTERMEIER - SERVA ELECTROPHORESIS GMBH : [email protected] Philippe WOLFF - PLATEFORME PROTÉOMIQUE STRASBOURG ESPLANADE : [email protected] Nico WORTEL - MS VISION BV : [email protected] Jianqing WU - CNRS : [email protected]

-Z-Mr Affif ZACCARIA - INSERM U836-EQ7 : [email protected] Isabelle ZANELLA-CLEON - INSERM DRLYS FACTURATION : [email protected] Zita ZENDONG - ONIRIS - LABERCA : [email protected] Anna ZIEMIANIN - CNRS UMR 6014, COBRA, UNIVERSITÉ DE ROUEN : [email protected]


Author Index


-A-ABDEL-WAHAB, Yasser H.A....................................222ABEILHOU, Pierre...................................................169ABID, Salwa.............................................................93ABSALON, Christelle...............................268, 269, 358ADAM, Claire.................................................305, 358ADRIANO, Jean-Marc.............................................101AEBERSOLD, Ruedi.................................................277AFONSO, Carlos...24, 80, 190, 225, 280, 303, 320, 358AHRNE, Erik.............................................................71AKÉ, Francine.........................................................129AKLOUL, Rym.........................................................219AL ALI, Ahmad................................................131, 358ALAYI, Tchilabalo...................................................248ALBERTIN, Warren.................................................261ALBIGOT, Renaud...........................................252, 358ALBRIEUX, Florian..................................176, 192, 358ALEXANDER CHRISTIE-OLEZA, Joseph....................306ALEXANDROV, Theodore.......................................232ALKHALFIOUI, Fatima...............................................91ALLAIN, François............................................315, 358ALLEGRAND, Julie....................................................53ALLORY, Yves...........................................................85ALMEIDA, Reinaldo.........................281, 299, 318, 322ALMERAS, Lionel............................................227, 358ALVES, Sandra................................144, 205, 225, 320AMOUYEL, Philippe................................................138ANDRÉ, Patrice......................................................142ANNE CREMER , Gaëlle..........................................153ANNE LORIOT, Marie.............................................245ANSELME, Michel...........................................345, 346ANTIGNAC, Jean-Philippe.................57, 137, 221, 247ANTOINE, Rodolphe....54, 61, 133, 154, 184, 210, 280ARAFAH, K.............................................................302ARC, Erwann..........................................................278ARGENTINI, Manuela.............................................158ARMENGAUD, Jean 8, 14, 79, 283, 291, 306, 314, 315, 316, 358ARMENTROUT, Peter B..........................................303ARNAUDGUILHEM, Carine.............................194, 358ARVERS, P..............................................................302ASTRUC, Thierry.....................................................170ATMANENE, Cedric................................................292ATTEIA, Ariane.......................................................224AUBERT, Léo..................................................150, 358AUBOURG, Patrick.................................................193AUBRIET, Frédéric............................................62, 358AUBRY, Laurence...................................................304AUDE-GARCIA, Catherine.........................................88AUDEBERT, Stéphane.............................227, 229, 266AUDOUARD-COMBE, Fabien..................................214AUDRAN, Emilie.....................................................312AURAND, Rémy..............................................278, 358AUVYNET, Constance.......................................68, 187AUZEIL, Nicolas..............................................185, 193AVERSENG, Olivier.................................................211

AYCIRIEX, Sophie............................185, 193, 245, 358AYMONIER, Cyril....................................................269AZANDO, E. V. B.....................................................235AZOULAY, Michel...................................................182AZRIA, David............................................................96

-B-BACHA, Hassen........................................................93BAENA, Sandra......................................................291BAGREL, Denyse....................................................180BAILLET, Arlette.....................................................320BAILLY-CHOURIBERRY, Ludovic................................81BAKKALI, Nawal.....................................................227BALAKRISHNAN, Indran.........................................126BALLIAS, Patricia....................................................253BALLOT, Eric..........................................................284BANA, Emilie..........................................................180BAPTISTE FOURNIER, Jean.....................................124BARBIER, Pascale...................................................309BARNES, Alan.................................................196, 197BARRÈRE, Caroline.................................141, 200, 358BARSAN, Cristina...................................................336BARTHE, Christophe..............................................127BARTHE, Damien................................8, 101, 186, 358BARYLYUK, Konstantin.............................................50BASCANDS, Jean-Loup...........................................260BAUDELET, Emilie...................................227, 266, 358BAUDET, Mathieu...............................8, 101, 267, 358BAUDIN, Bruno..............................................117, 358BAUDIN, Karima.......................................19, 275, 358BAUDOT, Robert............................................326, 333BAUDOUIN, Christophe..........................140, 159, 340BAUMGART, Jan....................................................281BAUTISTA-ORTÍN, Ana-Belén.................................112BAUVAIS, Cléa........................................................339BEAU, Mathilde................................65, 172, 182, 358BEAUFOUR, Martine......................................335, 358BEAUNE, Philippe...........................................131, 245BECAMEL, Carine.....................................................48BÉCARD, Guillaume.................................................90BECCHI, Michel........................................................69BECHARA, Chérine.........................................206, 358BECHER, François......75, 118, 144, 164, 181, 301, 358BECKER , Emmanuelle......................................72, 230BECUE, Thierry.........................................................67BEISSON, Fred........................................................101BELEOKEN, Elvire...................................................284BELGACEM, Omar...........................126, 128, 264, 309BELGHAZI, Maya............................................204, 358BELGHIT, Hanane.....................................................80BELLE, Valérie........................................................350BELLINA, Bruno......................................................184BELOTTI, Edwige....................................................266BEN AMEUR, Randa...............................................311BÉNARD, Camille...................................................253BÉNO, Noëlle.........................................................175BENOIT-MARQUIÉ, Florence..................................147


BENSAID, Fethi......................................................265BENSLIMANE-AHMIM, Zahia..................................228BENZ, Nathalie.......................................................338BERGER, François...........................................302, 313BERNARD-SAVARY, Pierre..............................354, 355BERNILLON, Stéphane....................................253, 359BERQUAND, Alexandre..........................................325BERTHON, Laurence.......................................349, 359BERTILE, Fabrice.......................................77, 294, 359BERTIN, Denis................................................200, 201BERTIN, Gwladys............................................160, 359BETTAIEB, Ali.........................................................254BIACCHI, Michael...................................273, 347, 359BIAIS, Benoit..........................................................253BIAN, Wanping......................................................336BIANCHI, Leonardo................................................352BIARC, Jordane...........................................25, 49, 359BICH, Claudia........................22, 52, 94, 240, 324, 359BICHON, Emmanuelle............................................247BIENVENUT, Willy V....................24, 63, 162, 163, 359BIERLA, Katarzyna..................................................194BIGEARD, Jean.......................................................157BILLON, Emmanuelle.............................................101BLANCHET, Sandra.................................................158BLAND, Céline............................................8, 316, 359BLEIN-NICOLAS, Mélisande....................261, 263, 359BLESBOIS, Elisabeth...............................................114BLINET, Sylvie........................................................323BOCKAERT, Joël....................................48, 76, 97, 359BODGE, Annegret..................................................337BODIN, Audrey...............................................169, 359BOERI ERBA, Elisabetta..............................24, 50, 359BOIREAU, Wilfrid....................................255, 307, 359BOISSEL, Pierre......................................................330BOISSON-VIDAL, Catherine....................................228BOLBACH, Gérard.....................68, 187, 217, 231, 359BOLLOTTE, F..........................................................134BOLOT, Stéphanie..................................................109BOLVIN, Capucine..................................................311BONHOMME, Ludovic......................................83, 263BONNAFFÉ, David..................................................105BONNAIRE, Yves.......................................81, 122, 328BONNEL, David........................................................73BONNEU, Marc.............9, 74, 127, 188, 226, 243, 359BORG, Jean-Paul....................................................266BORNARD, Isabelle................................................207BORNERT, Olivier.....................................................91BOSSELUT, Nelly....................................................117BOTH, Jean-Pierre..................................................130BOUAMRANI, Ali............................................313, 359BOUCHONNET, Stéphane...........................25, 59, 359BOUKENOUCHE, Asma...........................................219BOUKHERROUB, Rabah............................................64BOULAY, Mylène....................................................151BOUQUET, Valentin..................................19, 209, 359BOUR, Jérôme.........................................................70

BOURCIER, Sophie...................................................59BOURDERIOUX, Matthieu......................................342BOURDON, Valérie.........................................265, 359BOURGOGNE, Emmanuel...............................108, 359BOURGOIN-VOILLARD, Sandrine............................303BOURGUIGNON, Jacques.......................................331BOURHIS, Jean-Henry............................................284BOURMAUD, Adèle................................................212BOURSIER, Céline...................................174, 278, 359BOUSQUET-DUBOUCH, Marie-Pierre.......60, 277, 359BOUTET, Isabelle...................................................339BOUYSSIÉ, David...............65, 109, 260, 289, 336, 359BOUZAIDI CHEIKHI, Imad.........................................74BOUZOM, François..................................................73BOYON, Charlotte..................................................276BRADSHAW, Ralph...................................................49BRAGUER , Diane...................................................282BRAHIM, Bessem....................................205, 225, 359BRASME, Bernard..................................................107BRAY, Fabrice........................................................233BRETONNIERE, Yann................................................54BREUIL, Benjamin..................................................260BRIGNOLE-BAUDOUIN, Françoise..........140, 159, 340BRIZARD, Jean-Paul................................................195BROUSSARD, Cédric.................................95, 146, 244BROUSSOLLE, Véronique.......................................207BROYER, Michel.....................................................184BRUGIÈRE, Sabine.......................8, 224, 236, 304, 359BRULEY, Christophe. 8, 85, 98, 99, 102, 186, 224, 236, 242, 267, 304, 305, 331, 332, 359BRUN, Virginie........................26, 32, 98, 99, 102, 359BRUNEAUX, Matthieux..........................................198BRUNEEL, Arnaud..................................................117BRUNEL, Luc............................................................55BRUNELLE, Alain...52, 53, 94, 131, 139, 140, 159, 170, 185, 240, 340BRUNET, Claire.......................................133, 210, 359BUCHMANN, William.............................115, 300, 359BUCHRIESER, Carmen............................................145BUÉE, Luc...............................................................327BUISSON, Corine......................................................82BULET, Philippe..............................................295, 359BULETÉ , Audrey....................................................326BULINGAME, Al........................................................49BULLET, P...............................................................302BULTELLE, Florence................................................274BUNEL, C................................................................353BURÉ, Corinne............................................25, 51, 359BUREL, Alexandre............................................77, 359BURLET-SCHILTZ, Odile......60, 65, 109, 143, 172, 182, 183, 246, 250, 259, 260, 277, 289, 319BURNOUF, Dominique Y........................................171BUSNEL, Jean-Marc...............................................273

-C-CABASSON, Cécile..................................................253CABATON, Nicolas...................................................56


CACAS, Jean-Luc......................................................51CADENE, Martine...................................271, 335, 359CALLIGARIS, David....................................78, 282, 359CALVO, Florent......................................................192CAMADRO, Jean-Michel..........................................84CAMOIN, Luc............................93, 227, 229, 266, 359CANLET, Cécile.........................................................56CANON, Francis..............................133, 293, 317, 359CANTEL, Sonia.......................25, 55, 64, 136, 173, 359CAPOMACCIO, Robin...............................................69CARAPITO, Christine...........................26, 77, 312, 359CARRÉ, Vincent................................................62, 359CARRIER, Marion...................................................269CARRILLO , Stéphanie............................................112CARTIER, Nathalie..................................................193CASSIER-CHAUVAT, Corinne..................................166CAST, Delphine......................................................104CASTAING , Bertrand.............................................271CASTEL, Patricia.............................................268, 359CATHERINE FONBONNE, ...............................138, 361CAUBET, Cécile......................................................260CAZALS, Guillaume.........................................241, 359CECCHELLI, Roméo................................................203CENTENO, Delphine.......................................324, 360CERRUTI, Christopher....................................170, 360CHAFEY, Philippe........................89, 95, 146, 161, 360CHAFSEY, Ingrid.....................................................178CHAIMBAULT, Patrick.............................142, 180, 360CHALKLEY, Robert....................................................49CHALMEL, Frédéric................................................239CHAMBERS, Matthew............................................289CHAMBERT, Stephane.............................................54CHAMBON, Christophe...178, 218, 262, 323, 324, 360CHAMINADE, Pierre...............................................320CHAMOT-ROOKE, Julia............9, 58, 84, 120, 148, 360CHAN TCHI SONG , Philippe...................................177CHAN, Philippe...............................................177, 212CHANGOTADE, S....................................................134CHAOUI, Karima.....................................250, 277, 360CHAPEL, Agnès.......................................................304CHARDAN, Laetitia.................................................283CHARDONNET, Solenne.................................166, 360CHARLES, Laurence.. .70, 141, 200, 201, 202, 210, 360CHARLEUX, Bernadette..........................................154CHARPIN, Denis.....................................................161CHARRETIER, Yannick.................................24, 66, 360CHARRIER, Jean-Philippe..................................66, 138CHASTANT-MAILLARD, Sylvie.................................156CHATELLIER, Sonia...................................................66CHATTI GAZZAH, Amel.............................................93CHAUMONT-DUBEL, Séverine.................................97CHAUMOT, Arnaud................................................214CHAUSSINAND, Guylaine...............................306, 360CHENAU, Jérôme........................................24, 75, 360CHENDO, Christophe..............................141, 200, 360CHÉREAU, Sylvain.......................................26, 57, 360

CHERRAD, Semcheddine........................................251CHEVET, Eric..........................................................243CHEVOLLEAU, Sylvie......................................137, 360CHEYNIER, Véronique....................................119, 317CHHUON, Cerina............................................342, 360CHIAPPETTA, Giovanni...........................296, 310, 360CHIARA GUERRERA, Ida.........................................342CHIROT, Fabien..............................190, 191, 192, 360CHNEIWEISS, Hervé...............................................312CHOLLET-MARTIN, Sylvie.......................................161CHORT, Alice..........................................................245CHRISTIE-OLEZA, Joseph A.....................................316CLAIR, Gérémy...........................................22, 79, 360CLAPAROLS, Catherine...........................147, 265, 360CLARY, Guilhem...............................................95, 146CLAUDE TABET, Jean..............................................320CLAUDE, Emmanuelle............................................348CLAVEROL, Stéphane........74, 127, 188, 226, 243, 360CLAVERYS, Jean-Pierre...........................................259CLAVREUL, Anne....................................................238CLÉMENÇON, Benjamin.........................................135CLOTTES, Eric.........................................................319COADOU, Gael.......................................................152COCQUEREZ, Théophile.........................................155COFFINIER, Yannick..................................................64COLIN, Florent.........................................................92COLINET, Dominique.............................................204COLLARD, Alfred....................................................216COLLIGNON, Anne.................................................174COLLIN-FAURE, Véronique.......................................88COM, Emmanuelle.................................238, 239, 360COMPAGNON, Isabelle..........................................184CONREUX, Alexandra.............................................248CONTREPOIS, Kévin...............................................167COQUET, Laurent...................................212, 222, 360CORBET, Cyril.................................................150, 360CORMANT, Florence................................................81CORNU, David................................................158, 360COSETTE, Pascal.....................................177, 212, 360COSTAGLIOLI , Patricia...........................................127COTTON, Anthony.................................................226COUDERC, Rachel..................................................295COUILLAULT, Carole...............................................100COULON, Maxime..................................................110COURANT, Frédérique.............................................57COURCOUL, Mélaine......................185, 193, 245, 360COUREUX, Pierre-Damien......................................297COURNAC, Laurent................................................224COURT, Magali.................................................85, 305COUTÉ, Yohann......................102, 186, 267, 332, 360COUTOULY, Marie-Aude........................................215COUVET, Morgane.................................220, 278, 360CRAVELLO, Laetitia................................................118CREN-OLIVÉ, Cécile...........................82, 326, 333, 334CRONE, Catharina..................................................116CROUZET, Marc.....................................................127


CUINÉ, Stéphan.....................................................101CULARD, Françoise................................................271CUNY, Celine............................................................91CUNY, Gérard........................................................195

-D-D’AGOSTO, Franck.................................................154DACHEUX , Jean-Louis............................................239DAGANY, Xavier.......................................................61DAGHER, Zeina......................................................199DAHMANI, Abdelkader..........................................241DAIGNAN-FORNIER, Bertrand..................................74DALLONGEVILLE, Sophie........................................258DAMOC, Eugen......................................................116DANIEL, Régis.................................................105, 115DARBOUR, Florence.................................................54DAROLLES, Carine..........................................283, 360DARROUZET, Elisabeth..........................................314DAUGHERTY , Sean................................................275DAULY, Claire.................................................116, 360DAUTREY, Sébastien..............................................120DAY, Robert...........................................................276DE HAAN, Bjorn.....................................................286DE LA PORTE, Sabine..........................................52, 94DE PAU, Edwin...............................................216, 219DE PAUW, Edwin...................................................216DE VIENNE, Dominique..........................................261DE WAZIERS, Isabelle.............................................245DEBORDE, Catherine.............................................253DEBRAUWER, Laurent......................56, 123, 137, 361DEBUIRE, Jacques..................................................147DECEUNINCK, Yoann......................................247, 361DECHAVANNE, Célia.................................89, 321, 361DECOTTIGNIES, Paulette................................166, 361DECOURCELLE, Mathilde................................308, 361DECROP, Wim........................................................285DEFER, Christine............................................233, 234DEFFIEUX, Alain.....................................................268DEKKER, Karsten....................................................286DELANGHE, Bernard..............................................116DELAUNOIS, Bertrand............................................278DELBOS, Jean-Marie................................................73DELCOURT, Nicolas..................................65, 172, 182DELMAS, Agnès......................................................153DELOLME, Frédéric..........................................69, 361DELORON, Philippe................................................160DELSUC, Marc-André.......................................44, 215DELVOLVÉ, Alice....................................................225DEMETTRE, Edith...........................................195, 361DEMEY-THOMAS, Emmanuelle..............310, 327, 339DENARIÉ, Jean.........................................................90DENERY-PAPINI, Sandra.........................................103DENIER, Xavier.......................................................274DENISOV, Eduard...................................................116DÉPREZ, Benoit........................................................73DERACHE, Chrystelle..............................................110DERACINOIS, Barbara.....................................203, 278

DERNIS, Dominique........................................233, 234DERVILLY-PINEL, Gaud.....................................57, 122DESBENOIT, Nicolas................140, 159, 240, 340, 361DESMAZIÈRES, Bernard..........................................300DESMONS, Annie...................................................276DESTANDAU, Emilie...............................................125DESVAUX, Mickaël.........................................178, 262DEUTSCHER, Josef.................................................129DEWAELE, Laure....................................................189DIALLO, Dévy...........................................................88DIAS ABELAIRAS, Helia...........................................256DIEBATE, Oumar....................................................217DIEMER, Hélène.......................................................88DIERYCKX, Cindy............................................251, 361DIEUSET, Gabriel....................................................232DIOLOGENT, Laurent......................................231, 361DIOUF, Ibrahima....................................................227DIRAT, Béatrice......................................................250DITTRICH-DOMERGUE, Franziska...........................106DJELTI, Fathia.........................................................193DJIDJA, Marie-Claude............................................348DOIZI, Denis...........................................................124DOMERGUE, Frédéric......................................51, 106DOMINICI, Christian...............................................202DOMON, Bruno............................24, 36, 85, 288, 361DONFACK, Béryl.......................................................94DOUSSINEAU, Tristan............................................154DRIDI, Imene...........................................................63DRUART, Xavier..............................................114, 189DUBAN-DEWEER, Sophie.......................................203DUBOIS, Marc..........................................................56DUBRULLE, Marie-Pierre........................................252DUCHAMP, Christian......................................176, 361DUCHATEAU, Magalie....................................145, 361DUCLOS-VALLÉE, Jean-Charles...............................284DUCOROY, Patrick..................254, 255, 307, 325, 361DUCOUX-PETIT, Manuelle..............................319, 361DUGOUJON, Jean-Michel.........................................89DUGOURD, Philippe.......9, 54, 61, 133, 154, 184, 190, 191, 192, 210, 213, 280, 361DUMAS, Philippe...................................................171DUMÉNIL, Guillaume...............................................84DUPIERRIS, Véronique................................8, 305, 361DUPORT, Catherine.................................................79DUPRÉ, Mathieu.........................23, 64, 136, 173, 361DUPUIS, Alain........................................................102DURAND, Fabrice...................................................274DURAND, Sophie...................................................221DURAND, Sylvere...................................................118DURIEZ, Elodie.........................................85, 288, 361DURIGHELLO, Emie........................................316, 361DUYCKAERTS, Charles....................................185, 240

-E-EDDARKAOUI, Sabiha.............................................327EDELMAN, Aleksander...................................342, 361EDWARDS-JONES, Valery.......................................126


EGEA, Isabel...........................................................336EIKEL, Daniel..................................................318, 322EJSING, Christer......................................281, 318, 322EL OSTA, Marven...........................................307, 361ELFAKIR, Claire.......................................................125ELIE-CAILLE, Céline.................................................325EMADALI, Anouk...................................................305ENJALBAL, Christine............55, 64, 136, 173, 241, 361ENJALBERT, Quentin...................23, 54, 213, 280, 361ERARD, Monique...................................................319ESCUDIER, Bernard................................................342ESPAGNE, Christelle.........................................63, 163ESPAGNON, Isabelle..............................................130ESTOUR, François..................................................257EVRARD , Bertrand...........................................72, 230EWBANK, Jonathan................................................100EZAN, Eric.................................75, 164, 167, 301, 361

-F-FABRE, Bertrand.........................................22, 60, 361FABRE, N................................................................235FANTON, Laure......................................................142FEDERICI, Christian........................................146, 244FENAILLE, François....................75, 144, 167, 301, 361FEREC, Claude........................................................338FERNANDEZ, Bernard.....................................316, 361FERNANDEZ, Xavier...............................................218FERNIE Alisdair......................................................253FERRO, Myriam.. .8, 101, 224, 236, 242, 305, 332, 361FERRU, Geoffroy....................................................349FIEVET, Nadine......................................................160FILDIER, Aurélie.......................................................82FLAHAUT, Christophe.....................................203, 361FLAMENT-WATON, Marie-Magdeleine....................82FLATT, Peter R.......................................................222FLEURY, Céline...........................................8, 332, 361FLIS, Paulina...........................................................329FLORENT, Jean-Claude...........................................182FOCSA, Cristian......................................................231FONTAINE, Albin....................................................227FOREST, Eric...................................................135, 361FOUILLEN, Laetitia.........................................106, 361FOUQUET, Thierry......................................25, 70, 362FOURNIER, Françoise.............................................303FOURNIER, Isabelle.........140, 231, 276, 340, 351, 362FOURQUET, Patrick........................................100, 362FRAMBOISIER, Xavier.....................................343, 362FRANCESCHI, Christine............................................66FRANCK, Julien...............................................351, 362FRANÇOIS, Yannis...........................272, 273, 347, 362FRÉDÉRIC CARLIN, .................................................207FROMENT, Carine..........................................246, 362FROMENTY, Gaëlle................................................173FROTTIN, Frédéric....................................................63FULCRAND, Hélène................................................112

-G-

GABANT, Guillaume.......................................271, 362GABELLE, Audrey...................................................181GAIGEOT, Marie-Pierre..........................................208GAILLARD, Jean Charles.........................................283GAILLARD, Jean-Charles.....................8, 314, 316, 362GAL, Olivier............................................................223GALLAGHER-GAMBARELLI, Maighread..................267GALLIEN, Sébastien................................................288GARBAY, Bertrand..........................................127, 226GARCIA, Patrice..................................22, 81, 328, 362GARIN, Jérôme 8, 9, 14, 85, 98, 99, 102, 242, 331, 362GARNIER, Nicolas...................................................258GARRIC, Jeanne..............................................214, 326GATELLIER, Philippe...............................................323GATTI, Jean-Luc.....................................................204GAUDIN, Karen........................................................51GAUDIN, Mathieu..................................185, 193, 362GAULT, Joseph...........................................23, 84, 362GAUTHIER, Sébastien.............................................169GAUTIER, Hélène...................................................253GAUTIER, Violette.............65, 143, 172, 182, 183, 362GAVALDA, Sabine..................................................344GAVOILLE, Joseph..................................................255GEAIRON, Audrey..................................................103GEFFARD, Olivier...................................................214GEIGER, Sophie......................................................243GÉNARD, Michel....................................................253GENIN, Eric............................................................344GENTY, Christophe..................................................59GÉRARD, Nadine............................................114, 189GERVASI, Gaspard............................................66, 164GIBON, Yves...........................................................253GIGLIONE, Carmela..................................63, 162, 163GIGMES, Didier......................................141, 200, 201GILBERT, Helene....................................................323GIMBERT, Yves......................................................107GIRARD, Jean-Philippe.....................................65, 172GIRARD, Victoria......................................................66GIRARD, Vincent............................................251, 362GIRAUD, Christophe..............................................261GIROD, Marion...................................23, 61, 210, 362GIULIANI, Alexandre.................53, 133, 293, 317, 362GOFFINONT, Stéphane..........................................271GOGUET-SURMENIAN, Emilie................................204GOLINELLI, Béatrice...............................................139GONDELLE, Hélène................................................245GONNET, Florence.................................105, 115, 362GONZALEZ-DE-PEREDO, Anne. . .23, 65, 109, 143, 172, 182, 183, 260, 319, 362GOOSSENS, Pierre...................................................75GOUHIER, Géraldine..............................................257GOULDEN, Pierre-Henry..........................................59GRANIER, Claude...................................................311GRASSEAU, Isabelle...............................................114GRÉBAUT, Pascal...................................................195GROSSEL, Martin...................................................152


GUDZINSKI, Ashley C..............................................120GUELORGET, Amandine.........................................139GUÉNIN, Erwann....................................................149GUENNEAU-PUVIJESINGHE, Tania.........................266GUÉRINEAU, Vincent................................52, 139, 362GUETTIER, Catherine.............................................284GUIANVARC'H, Dominique....................................217GUICHARD, Gilles...................................................171GUIGLIARELLI, Bruno.............................................350GUILHAUDIS, Laure................................................344GUILIANI, Alexandre..............................................300GUILLEN, Franck....................................................241GUILLONNEAU, François....89, 95, 146, 160, 244, 287, 321, 362GUILLOT, Alain.......................................151, 352, 362GUILLOT, Laetitia...................................................239GUITARD, Evelyne....................................................89GUST, Marion........................................................326GUTERL, Patrick.......................................................77

-H-HAAN, Serge..........................................................223HACHANI, Johan....................................................203HADDAD, Iman...............................................161, 310HAFNAOUI , Norredine..........................................324HAGÈGE, Agnès..............................................211, 362HAIECH, Jacques....................................................312HAÏSSAM JIJAKLI, M...............................................341HAMDANE, Djemel................................................139HAMM, Grégory.................................22, 73, 140, 340HAMMANN, Philippe..............155, 171, 199, 272, 362HAMON, Marion....................................................103HAO, Zhiqi.............................................................288HARDOUIN, Julie............................149, 153, 212, 362HARICHAUX, Grégoire....................110, 114, 156, 362HARSCOAT-SCHIAVO, Christelle.............................343HARVENGHT, Luc...................................................335HASHIMOTO, Masahiro.................................179, 298HÉBERT, Yann........................................................111HEBRAUD, Michel..........................................178, 262HEEMSKERK, A. A...................................................273HELARY, G..............................................................134HÉLYE, Reynald......................................................198HEM, Sonia.........................................25, 67, 308, 362HÉNINGER, Michel.................................................330HENION, Jack.................................................318, 322HENRIQUES, Natali.........................................176, 362HENRY, Céline................................129, 207, 352, 362HERNIO, Nolwen....................................................239HERSANT, Yael.......................................................105HESSE, Anne-Marie........................................186, 362HESTER, Alfons......................................................223HEU, Céline....................................................325, 362HEYMAN, Dominique.............................................228HIRT, Heribert........................................................157HIRTZ, Christophe..................................................181HOLZMULLER, Philippe..........................................195

HOMER-VANNIASINKAM, Shervanthi....................126HONDERMARCK, Hubert........................................150HOPFGARTNER, Gérard..................................108, 197HOSTE, H...............................................................235HOUNZANGBE-ADOTÉ, M. S..................................235HOURDEL, Véronique............................................157HOVASSE, Agnès............................................248, 363HUART, Jean-Jacques.....................................233, 234HUBERT-ROUX, Marie....................................257, 363HUDSON, John.......................................................345HUET, Sylvie...........................................................261HUGHES, Chris.......................................................249HUHMER, Andreas.................................................288HUILLET, Céline........................................................99HULMES, David........................................................69HUMBEL, Stéphane........................................141, 200HÜRLIMANN, Hans C..........................................22, 74

-I-IBRAHIM, Marianne...............................................199IDRISS, Hussein......................................................257ITO, Yoshiyuki................................................179, 298

-J-JACQUES FOURNIE, Jean........................................121JAMIN, Emilien...................................26, 56, 123, 363JAQUINOD, Michel............98, 102, 242, 267, 331, 363JARDIN-MATHÉ, Olivia...........................................157JARNO, Nolwenn............................................331, 363JARRAYA, Fayçal....................................................311JAULT, Jean-Michel................................................135JEANNIN, Jean-François.........................................254JEANVOINE, Yannick..............................................208JÉGOU, Sandrine....................................................248JOB, Claudette.......................................................251JOB, Dominique.....................................................251JOHANET, Catherine..............................................284JOO CHUNG, Young...............................................256JOUANIN , Isabelle.................................................123JOUENNE, Thierry...........................149, 177, 212, 222JOUMIER, Jean-Marc.............................................290JOURDAN, Fabien....................................................56JOURNET, Agnès....................................................304JOUVIN-MARCHE, E...............................................302JOUX, Fabien.........................................................237JUBEAUX, Guillaume..............................................214JUILLARD, Vincent..................................................151JULLIEN, Laure.......................................................107JUNOT, Christophe.................................164, 181, 328

-K-KAABIA , Zied.................................................122, 363KARAKI, Samah........................................................48KARAMANOS, Yannis.............................................203KAROYAN, Philippe................................................217KARSTEN, Marco....................................................285KELLMANN, Markus...............................................288KERBIRIOU, Mathieu..............................................338


KERDRAON, Olivier................................................276KHARCHENKO, Andriy............................................223KHRISTENKO, Nina.................................................288KIEFFER-JAQUINOD, Sylvie.............102, 267, 304, 331KIEHNE, Andrea.....................................................111KIFAGI, Chamseddine............................................311KING, Jay D............................................................222KIRSCH, Gilbert......................................................180KISS, Agnéta.......................................................26, 82KLEIN, Gérard........................................................304KLEIN, Tania...........................................................352KRAUT, Alexandra..............................8, 186, 267, 363KRISTIAN HANNIBAL-BACH, Hans..........................281KUBO, Ayumi.................................................179, 298KUHN, Lauriane........................91, 155, 199, 272, 363KULESZA, Alexander..............................................184KULYK, Hanna........................................................123KUSAI, Akihiko..................................19, 179, 298, 363KUZMINSKA, Maryna.............................................351KWASIBORSKI, Anthony.................................341, 363

-L-L'HOSTIS, Guillaume..............................................164LABADIE-LEMIÈRE, Emilie......................................253LABAS, Valérie................110, 113, 114, 156, 189, 363LABEL, Philippe......................................................335LACOMBE, Claire..............................................68, 187LACOMBE, Jérôme...........................................96, 363LACOUX, Xavier.......................................................66LACROIX, Chrystelle.......................................260, 363LADJIMI, Moncef.....................................................93LAFAY, Florent.......................................................334LAFITTE, Daniel...........................22, 78, 282, 309, 363LAFOSSE, Michel....................................................142LAGARRIGUE, Mélanie...................................232, 238LALMANACH, Anne-Christine.................................110LAMARCA, Arnaud.........................................295, 363LAMBERT, Jean Charles..........................................138LAMBERT, Marine..........................................119, 363LAMOURETTE, Patricia.............................................75LAMRANI, Myriam.................................................254LANE, Cathy...........................................................234LANGE, Catherine...........................152, 257, 353, 363LANGELLA, Olivier............................................83, 263LANGRIDGE, James................................................348LANOË, Laura.........................................................182LAPAILLERIE, Delphine...........................................188LAPRÉVOTE, Olivier. .53, 108, 131, 140, 159, 185, 193, 240, 245, 340, 363LARDENOIS , Aurélie................................................72LARRÉ, Colette.......................................................103LARTIA, Remi.........................................................107LARVOR, Frederic...................................................221LATAILLADE, J.J......................................................134LATCHE, Alain........................................................336LAUMAIN, Bastien...................................................95LAUNAY, Jean-Claude............................................186

LAURENT, Victor....................................................250LAURIER, Marie......................................................262LAVANANT, Hélène........................................165, 363LAVIGNE, Régis...................22, 72, 230, 232, 239, 363LAZAR, Adina N,.....................................................240LE BIZEC, Bruno.............9, 57, 122, 137, 221, 247, 363LE BOURHIS, Xuefen..............................................150LE CAER, Jean-Pierre..............................................284LE GALL, Caroline...................................................260LE GALL, Morgane............................................95, 146LE GORREC, Madalen...............................................85LE MARECHAL, Pierre.....................................166, 363LE QUÉRÉ, Jean-Luc........................................168, 175LE VOT, Clotilde.....................................................330LEBARON, Philippe.................................................237LEBEAU, Diane...............................................124, 363LEBERT, Dorothée....................................................99LEBLANC, Catherine...............................................124LEBLOIS, Thérèse...................................................307LEBOULENGER, François........................................274LEBRET, Bénédicte.................................................323LEBRETON, Mélanie.........................................91, 198LEBRUN, Régine.............................................350, 363LECAMP, L..............................................................353LEDUC, Marjorie...............................95, 244, 321, 364LEFAY, Catherine...................................................201LEFRANC, Marie-Paule.............................................89LEGOUFFE, Raphael..................................73, 140, 340LEGROS, Véronique...............................................300LEHMANN, Sylvain.................................................181LEIZE-WAGNER, Emmanuelle.................272, 273, 347LEIZE, Emmanuelle....91, 198, 199, 272, 273, 347, 364LELU-WALTER, Marie-Anne...................................335LEMAIRE, Joël........................................................330LEMOINE, Jérôme......54, 66, 138, 143, 183, 191, 192, 210, 214, 280, 364LENNON, Sarah......................................278, 312, 364LÉONARD, Didier...................................................333LEPOIVRE, Philippe................................................341LEPRINCE, Jérôme..................................................344LERICHE, Emma-Dune....................................152, 364LEROY, Eric.............................................235, 265, 364LEROY, V................................................................302LESAGE, Denis........................................303, 320, 364LESCURE, Marie-Hélène.........................................269LESSIM, S...............................................................134LESSIRE, René........................................................106LETENDRE, Julie.....................................................274LI-BEISSON, Yonghua.............................................101LIBAT, Stéphane.....................................................252LIBONG, Danielle...........................................320, 364LIGNON, Sabrina............................................350, 364LILLA, Sergio..........................................................163LISACEK, Frederique................................................71LIU , Yuchen.....................................................72, 230LOBINSKI, Ryszard..................................194, 290, 329


LOFTUS, Neil..................................................196, 197LOISEAU , Florence..................................................97LOKIEC, Francois....................................................118LONGUESPÉE, Rémi.......................................276, 364LÖNNBERG, Maria...................................................81LOPPINET-SERANI, Anne........................................269LORENZI, Magali....................................................350LOUIS BEAUDEUX, Jean.........................................108LOUTELIER-BOURHIS, Corinne........152, 165, 353, 364LOUWAGIE, Mathilde.....................................102, 364LUCCHI, Géraldine..........................254, 255, 307, 325LUCIO, Marianna.....................................................82LUTOMSKI, Didier..........................................134, 228LYAN, Bernard................................................270, 364

-M-MACALEESE, Luke..................................................191MAGALLON, Thierry...............................................110MAINGONNAT, Jean-François................................207MAJERAN, Wojciech......................................162, 163MAJOR, Mohamed.........................................201, 364MAJOR, Yannis...............................................202, 364MAKAROV, Alexander............................................116MALARD, Véronique..................................8, 283, 364MALATS, Núria.........................................................85MALOSSE, Christian..........................84, 120, 132, 364MAN, Petr..............................................................135MANACH, Claudine................................................270MANGÉ, Alain..................................................96, 364MANN, Carl............................................................167MANNOURY LA COUR, Clotilde..........................48, 97MARC, Ivan............................................................343MARCELLIN, Didier.........................................314, 364MARCELLIN, Marlène.............................277, 282, 364MARCHAND, Philippe............................................221MARCHE, Patrice N. ......................................295, 302MARCHETTI, Catherine..........................................245MARI, Adriano.......................................................161MARIE LOMENECH, Anne......................................188MARIE, Cecile........................................................349MARIN, Philippe...............................9, 48, 76, 97, 364MARQUE, Sylvain...................................................350MARTEAU, Charlotte.............................................137MARTELET, Armelle.......................................164, 364MARTELLI, Alain.......................................................92MARTIGNAC, Marion.....................................147, 364MARTIN, Benoît.....................................................232MARTIN, Nicolas....................................................255MARTIN, Patrice.............................................352, 364MARTINEZ, Aude...................................................163MARTINEZ, Jean.................................55, 64, 136, 173MARTINHO, Marlène.............................................350MARTROU, David...................................................169MARTY-GASSET, Nathalie...............................218, 364MARULLO, Philippe................................................261MARVIN-GUY, Laure F...........................................256MARY, Jean....................................................339, 364

MASSELON, Christophe D...........24, 85, 236, 304, 364MASSON, Gilles......................................................119MATALLANA-SURGET, Sabine................................237MATHERON, Lucrèce.....................................217, 364MATONDO, Mariette.....................................277, 364MAUCLAIRE, Gérard..............................................330MAUCOURT, Mickaël.............................................253MAURETTE, Maïté.................................................147MAYBORODA, O.A.................................................273MAYEUX, Patrick.................89, 95, 244, 287, 321, 364MAZA, Elie.............................................................336MAZEROLLES, Gérard............................................119MECHKARSKA, Milena...........................................222MÉCHULAM, Yves..........................................132, 297MEETANI, Mohammed A.......................................222MEFFRE, Julie...........................................................97MEHMOOD, Shahid...............................................135MEINNEL, Thierry.............................63, 162, 163, 364MEIRELES, Maria-Héléna.........................................56MEJEAN, Arnaud....................................................342MEKLAT, Noura..............................................270, 364MELKI, Ronald........................................................249MELLAL, Mourad..............................................85, 236MEMBOEUF, Antony..............................................107MENAND, Benoît...........................................104, 365MENCH, Michel.....................................................269MENEI, Philippe.....................................................238MERCADIER, Jean-Jacques.....................................146MESMIN, Cédric.....................................................301MESTDAGH, Hélène...............................................330MEUDEC, Emmanuelle...................................119, 365MEUNIER-GONTERO, Brigitte................................350MICHAEL CONLON, J..............................................222MICHALAK, Sophie.................................................238MICHEL, Thomas....................................................125MICHELLAND, Sylvie..............................................220MICHOPOULOS, Filippos........................................196MIGNEN, Olivier....................................................338MIGONNEY, V........................................................134MIGOT-NABIAS, Florence.........................89, 321, 365MIGUIRDITCHIAN, Manuel....................................349MIJAKOVIC, Ivan....................................................129MILEO, Elisa...........................................................350MILLAN, Mark J..................................................48, 97MILOHANIC, Eliane................................................129MILOSAVLJEVIC, Aleksandar..................................317MINSINI, Carole.....................................................234MIRANDA, Guy...............................................352, 365MISRA, Sandeep....................................................129MITRIC, Roland......................................................184MOALI, Catherine.......................................23, 69, 365MOEHRING, Thomas......................................116, 288MOING, Annick......................................................253MOLETTE, Caroline................................................218MOLINA, Franck.....................................................311MOLINA, Laurence.........................................311, 365


MONGRAND, Sébastien...........................................51MONNET, Véronique.....................................129, 151MONNEUSE, Jean-Marc...................................67, 365MONNIER, Valérie..................................141, 200, 365MONSARRAT, Bernard.......60, 65, 109, 143, 172, 182, 183, 246, 250, 252, 259, 260, 277, 282, 289, 319, 365MONTANÉ, Marie-Hélène..............................104, 365MONTAVON, Philippe............................................256MONTEAU, Fabrice..................................................57MOREAU, Stéphane.........................19, 196, 197, 365MOREIRA, Guillaume.............................................201MOREL, Alexandre.................................................335MOREL, Natalie........................................................75MOREL, Paul..................................................278, 365MORIKAWA, Yoshio...............................................196MORLET, Lise.........................................................191MORLOCK, Gerda..................................................354MOUCHE, Claire.............................................268, 365MOULIN, Morgane................................................245MOULS, Laetitia.............................................112, 365MOUTON-BARBOSA, Emmanuelle...........65, 109, 172MOUZ, Nicolas.........................................................99MOYET, Lucas........................................................236MOZZO, Milena.....................................................104MUELLER, Mathias.................................................116MULLER, Bruno......................................................164MULLER, Catherine................................................250MULLER, Julie........................................................349MULLER, Ludovic...................................................225MULLER, Markus........................................26, 71, 365

-N-NAHON, Laurent....................................133, 293, 317NAMANE, Abdelkader............................................145NAMY, Olivier........................................................158NANO, Edlira..................................................263, 365NASSO, Sara...........................................................289NAUBOURG, Pierre................................................209NAUDIN, Bertrand.........................................177, 365NDIAYE, Sega.................................................296, 310NEGRONI, Luc................................................243, 365NESPOULOUS, Claude............................................308NETTER, Claude................................19, 285, 286, 365NGUYEN-KHOA, Thao............................................342NGUYEN, Mai.........................................................101NGUYEN, Uyen...............................................279, 337NGUYEN, Viet........................................................225NICOD, Laurence...................................................325NICOL, Edith...............................24, 58, 148, 297, 365NICOLI, Raul...........................................................220NIETO, Laurence....................................................319NIKITIN, Frederic......................................................71NITSCH, Robert......................................................281

-O-OHARA, Keiichiro.....................................................55OJO, Opeolu O.......................................................222

OLIVEROS, Esther...................................................147OLIVIER, Audrey.....................................................259OLOUNLADÉ, P. A..................................................235ONODERA, Jyun.....................................................298OPENSHAW, Matthew E................................128, 309ORIVEL, Jérôme.....................................................344ORTIZ, Alexia..........................................233, 234, 365ORTIZ, Daniel.........................................................213OSORIO-ALGAR, Sonia...........................................253OUARDAD, Samira.................................................268OUERDANE, Laurent...............................194, 329, 365OUGHLIS , S...........................................................134OUIDIR, Tassadit....................................................212OVERALL, Christopher..........................23, 42, 69, 365

-P-PAGE, Adeline..................................................92, 365PAGÈS, Fréderic.....................................................227PAIN-DEVIN , Sandrine...........................................177PAMELARD, Fabien..................................................73PANCHAL, Maï...............................................185, 240PANCHOUT, François.............................................274PANSANEL, Jérôme..................................................77PANVERT, Michel...................................................132PARANT , Marc......................................................177PARIS, Alain...........................................................328PARIS, Cédric.........................................................343PARRA GIMENEZ, Nereida.....................................195PASCHKE, Carmen..................................................116PASCUAL, Aurélie...................................................227PECH, Jean-Claude.................................................336PÉCHINÉ, Séverine.................................................174PÉLEGRIN, André.....................................................96PELOSI, Ludovic.....................................................135PELTIER, Gilles.......................................................224PELTIER, Julien.......................................................229PEPE, Claude..........................................................303PÉROT-TAILLANDIER, Marie.....................80, 280, 365PERROT, Michel......................................127, 188, 365PERUCH, Frédéric..................................................268PETER SCHANSTRA, Joost......................................260PETIOT, Stéphanie..........................................278, 292PETIT, Vanessa.......................................................240PFLIEGER, Delphine........................................157, 365PHAN, Trang N.T....................................141, 200, 202PIBLE, Olivier..............................................8, 315, 365PICARD, Guillaume.............................................98, 99PICAUD, Vincent....................................................130PICHEREAUX, Carole.......................218, 252, 336, 365PIERRE, Jonlet........................................................216PIGUET, Dominique...............................................256PINARD, Amélie.....................................................352PINEAU, Charles............9, 72, 230, 232, 238, 239, 365PINGUET, Jérémy...........................................324, 366PINSON, Benoît................................................74, 366PIVETEAU, Catherine...............................................73PIZZALA, Hélène....................................................202


PLANCHON, Stella..................................................207PLANELLES, Gabrielle.............................................342PLECHAKOVA, Olga................................................258PLOU , Philippe......................................................122POCK, Katharina....................................................128POINOT, Pauline....................................................181POINSOT, Véréna.....................................................90POIRIÉ, Marylène...................................................204POIRIER, Florence...................................134, 228, 366POLARD, Patrice....................................................259POLLET, Samuel.....................................................147PONCET, Pascal..............................................161, 366PONT, Frédéric...............................................121, 366POPHILLAT, Matthieu....................................100, 366POPOT, Marie-Agnès.......................................81, 328PORBECK, Frank.....................................................299PORTAIS, Jean Charles.............................................90POTIER, Noelle.........................................91, 198, 366POUECH, Charlène.........................................333, 334POURCHER, Thierry........................................124, 314POURHASSAN, Nina.......................................273, 347POUSSEREAU , Nathalie.........................................251PREUD'HOMME, Hugues................................194, 290PREVILON, Miresta................................................146PRIMIG , Michael.............................................72, 230PROSSER, Simon............................................318, 322PRULL-JANSSEN, Mehdi.........................................105PRZYBYLSKI, Cédric.................................105, 115, 366PUCCIO, Hélène.......................................................92PUECH PAGÈS, Virginie............................................90PUJOS-GUILLOT, Estelle..........................270, 324, 366PUPPO, Carine.......................................................350

-Q-QUANICO, Jusal..............................................351, 366QUÉAU, Hervé.......................................................214QUINTANA, Mercedes...........................................270

-R-RABILLOUD, Thierry.................................................88RAMPAL, Sushma..................................................346RAMZAN, M...........................................................302RASCLE , Christine..................................................251RAVALLEC, Marc....................................................204RAYNAL, Patrick.....................................................246REBUF, Christian....................................................204REBUFFAT, Sylvie...........................................190, 280REDEKER, Virginie..........................................249, 366REDON, Sebastien....................................................54REFREGIERS, Matthieu...........................................293RÉGAZETTI, Anne...................................................193REILLE-TAILLEFERT, Geneviève..............................258REILLER, Pascal......................................................124REMOUE, Franck....................................................227REMY-MARTIN, Fabien..........................................307RENARD, Pierre-Yves.............................................120RENAUD, Jean-Paul................................................292

RENAUT, Jenny......................................................341RENIER, Sandra..............................................178, 366REUTENAUER, Laurence..........................................92REY, Martial...........................................................135REYNAUD, Karine...................................................156REZAI, Keyvan........................................................118RHOURRI-FRIH, Boutayna......................................142RICHA, Latifa..........................................................234RIFFLET, Aline........................................................344ROBAGLIA, Christophe...........................................104ROBBE, Marie-France.............................130, 223, 366ROBINE, Ophélie............................................148, 366ROCHE, Serge........................................................246ROCHER, Béatrice..................................................274ROEMPP, Andreas.................................................223ROFIDAL, Valérie............................................308, 366ROGNIAUX, Hélène........................................103, 366ROLANDO, Christian....24, 44, 215, 233, 234, 258, 366ROLANDO, Monica.................................................145ROLIN, Dominique.................................................253ROLLAND, Norbert.................................224, 236, 305ROMIEU, Anthony..................................................120RONAT-HEIT, Evelyne............................................343ROPARTZ, David.............................................103, 366ROPERCH, Jean-Pierre...........................................229ROSENBAUM, Jean................................................243ROSSIGNOL, Michel..........................67, 218, 308, 336ROUET-BENZINEB, Patricia.....................................146ROULEAU, Alain.....................................................307ROUSSET, Jean-Pierre............................................158ROUSSI, Stamatiki..................................................283ROUX-DALVAI, Florence.................109, 143, 183, 366ROYLE, Louise........................................................128ROZAND, Christine.................................................164RUBIANO-LABRADOR, Carolina..............................291RUCH, David............................................................70RUDAZ, Serge........................................................220

-S-SABLIER, Michel.......................................................59SACHON, Emmanuelle................25, 68, 187, 217, 366SAGAN, Sandrine...........................................206, 366SAGE, Nicole..............................................8, 283, 366SAGO, Laïla.......................................89, 287, 321, 366SAINT-DIZIER, Marie..............................................156SAKR, Samer..........................................................166SALIOU, Jean-Michel..............................................312SALNOT, Virginie.........89, 95, 160, 244, 287, 321, 366SALPIN, Jean-Yves..........................................208, 213SALVADOR, Arnaud....................54, 66, 138, 214, 366SALVETAT, Nicolas.........................................311, 366SALVI, Daniel..................................................236, 305SALZET, Michel...................................9, 276, 351, 366SAMUEL, Didier.....................................................284SANGLIER-CIANFÉRANI, Sarah........................292, 312SANTONI, Véronique...............................................67SANTORO, Massimo..............................................275


SARNI-MANCHADO, Pascale..................................317SATO, Takafumi.....................................................179SATOH, Takaya......................................................179SAVISTCHENKO, Jimmy..........................................249SAVOUREY, Gustave..............................................186SAYD, Thierry.........................................323, 324, 366SCHAEFFER-REISS, Christine...........................248, 366SCHEFFLER, Jean-Luc...............................................62SCHEMBRI, Therese.................................78, 309, 366SCHILTZ, Odile................................................252, 366SCHMIT, Pierre-Olivier...................................111, 272SCHMITT-KOPPLIN , Philippe...................................82SCHMITT, Emmanuelle...................................132, 297SCHMITTER, Jean-Marie...................................51, 243SCHMUCKER, Stéphane...........................................92SCHOENMAKER, B.................................................273SCHRAMM, Sébastien................................24, 62, 366SCHULZ-UTERMOEHL, Timothy..............................196SCHWIKOWSKI, Benno...........................................157SEBAGH, Mylène....................................................284SEIGNEURIN-BERNY, Daphné.................................236SEIMANDI, Mathieu.................................................76SELLAMI, Lyna................................................309, 367SÉMON, Etienne.....................................168, 175, 367SENECHAL, Hélène.........................................161, 367SERGEANT, Nicolas................................................327SEVE, Michel............................................71, 220, 367SÉVENO, Martial..............................................97, 195SEYER, Alexandre...........................................144, 367SEYER, Pascal.............................................23, 76, 367SHAHALI, Youcef............................................161, 367SHEN, Shida...........................................................275SIBILLE, Estelle...............................................180, 367SICARD, Delphine...................................................261SILVA ZOLLEZZI, Irma.............................................256SIMON, Romain................................54, 138, 214, 367SMARGIASSO, Nicolas............................................216SMIETANA, Michael.................................................55SNEEKES, Evert-Jan........................................285, 286SOBESKY, Rodolphe...............................................284SOBHANI, Iradj.......................................................229SOLASSOL, Jérôme...................................................96SOMAIYA, Pranav..................................................126SOMMERER, Nicolas..............................................119SPECHT, Michael....................................................224SPENCER, Daniel....................................................128SPEZIA, Riccardo....................................................208SPINA, Lucie...........................................................113STAUBER, Jonathan..........................73, 140, 340, 367STEINMETZ, Michel O............................................282STELLA, Alexandre..........................143, 183, 259, 367STEUNOU, Anne-Lise.............................................319STOECKLI, Markus..................................................223STOJILJKOVIC, Natali..............................................328STÜBIGER, Gerald..................................................264STURM, N..............................................................302

SUGANO, Madeleine...............................................67SUMPTON, David...................................................163SUTRA, Jean-Pierre................................................161SWART, Remco..............................................285, 286

-T-TABET, Jean-Claude..80, 144, 164, 190, 205, 225, 280, 303, 328TAIYA, Mehdi.........................................................338TAJAN, Mylène......................................................246TAM HA, T. B..........................................................235TAMURA, Jun.................................................179, 298TANGUY, Arnaud...................................................339TARDIF, Marianne..........................................224, 367TEIXEIRA-GOMES, Ana-Paula. .110, 113, 114, 189, 239TENE, Nathan.................................................344, 367TENG, Ling.............................................................338TERLOT, Jean-Didier...............................................114TERRAS , Lionel......................................................282TEYSSIER, Caroline.................................................335THERETZ, Alain.......................................................164THÉRON, Laetitia............................................170, 218THÉVENOT, Etienne...............................................223THILLAYE DU BOULLAY, Olivier..............................265TIERS, Laurent........................................................181TITMAN Chris.................................................196, 197TITMAN, Chris................................................196, 197TOILLON, Robert-Alain...........................................150TOKARSKI, Caroline................................233, 234, 258TOLEDANO, Michel................................................296TONG, Germain...............................................68, 187TORIBIO, Alix.........................................................125TOUBOUL, David....23, 52, 53, 94, 131, 139, 170, 185, 240, 367TOURNIER, Mikaël.................................................334TOWERS, Mark......................................................348TRAUCHESSEC, Mathieu.........................242, 278, 367TRÉGUER, Karine...................................................246TREILHOU, Michel..................................................344TREMBLAY-FRANCO, Marie.....................................56TRIBOULET, Sarah............................................88, 367TRIMAILLE, Thomas.......................................141, 200TRONTIN, Jean-François........................................335TROUVE, Pascal.....................................................338TRUNTZER, Caroline...............................................209TSA, Chia-feng.......................................................111TSIBYN, Yury..........................................................192TSIKIS, Guillaume...................................................189TUTUNDJIAN, Renaud............................................214

-U-UBUKATA, Masaaki........................................179, 298UTTENWEILER-JOSEPH, Sandrine...........................277UZBEKOVA, Svetlana......................................113, 367

-V-VALENTIN, A..........................................................235VALET, Philippe......................................................250


VALLÉE, Cyrille...............................................221, 367VALLON, Olivier.....................................................224VALOT, Benoît.....................26, 83, 207, 261, 263, 367VAN AGTHOVEN, Maria A......................................215VAN DER REST, Guillaume58, 120, 132, 148, 297, 317, 367VAN DORSSELAER, Alain....77, 88, 248, 292, 294, 312, 367VAN LING, Robert..........................................285, 286VANDENBOGAERT, Mathias...................................157VANDENBROUCK, Yves......................................8, 304VANDERMOERE, Franck.......................25, 48, 76, 367VARESIO, Emmanuel......................................108, 197VASSEUR, Jean-Jacques...........................................55VERBAERE, Arnaud................................................119VERDIER-PINARD, Pascal........................................282VERDIER, Yann.......................................310, 327, 367VERGELY, Isabelle..................................................209VETILLARD, Angélique............................................344VEUTHEY, Jean-Luc................................................220VIALA, Céline.........................................................174VIALA, Didier..................................218, 262, 324, 367VIANELLO, Sara..................................................52, 94VIDAUD, Claude.............................................211, 367VIEL, Stéphane...............................................141, 200VIEU, Diane-Lore....................................................342VILAIN, Sébastien...........................127, 188, 226, 367VILLARD, Claude...............................78, 282, 309, 367VILLAUME, Sandra.................................................248VILLIERS, Christian L...............................................295VILLIERS, Florent....................................................331VINATIER, Denis.....................................................276VINH, Joëlle.............117, 161, 296, 310, 327, 339, 367VISSERS, Johannes P.C...........................................249VITRY, Christiane............................................268, 367VIVAT HANNAH, Valérie.........................................292VLAK, Kees...............................................19, 281, 367VOGT, Johannes.....................................................281

-W-WAGNER, Michel...................................................197WAGNER, Renaud....................................................91WANG, Fen..............................................................51WASSELIN, Thierry.................................................294WATTENHOFER-DONZÉ, Marie................................92WATTIEZ, Ruddy....................................................237WAXWEILER, Sophie..............................................216WEILL, Sophie........................................................118

WERNER, Erwan....................................................185WERTHER, Wolfgang.............................................264WEST, Caroline......................................................142WEY, Emmanuel....................................................126WIEST, Laure..........................................326, 333, 334WILLAND, Nicolas....................................................73WILLIAM DUPUY, Jean...........................................188WILSON, Ian D.......................................................196WIRTH, Jérémie.....................................................119WISZTORSKI, Maxence...................140, 231, 340, 351WOLFF, Philippe.............................................171, 368WU, Jianqing..................................................297, 368

-X-XU, Hao..................................................................261XU, Ying.................................................................225XUE, Baiyie.............................................................225

-Y-YANG, Yang..............................................................50YART, Armelle........................................................246YERLY, Justine........................................................256YSABEL GONZATTI, Mary.......................................195YU BAO, Cong........................................................154

-Z-ZACCARIA, Affif..............................................313, 368ZAL, Franck............................................................198ZALKO, Daniel..................................................56, 137ZALTSMAN, Yefim..................................................206ZAMBARDI, Gilles.....................................................66ZANELLA-CLÉON, Isabelle........................................69ZARSKI, J-P.............................................................302ZEGGARI, Rabah....................................................307ZELLER, Martin.......................................................116ZENDONG, Zita.......................................221, 247, 368ZENOBI, Renato.......................................................50ZEYER, Denis..........................................................292ZGANI, Ibrahim......................................................257ZHANG, Wenjing....................................................154ZHAO, Jingjing........................................................120ZIARELLI, Fabio......................................................202ZINS, Emilie-Laure..................................................303ZIRAH, Séverine.............................................190, 280ZISKIND, Michael...................................................231ZIVY, Michel.............................................83, 261, 263ZORZ, Nicole..........................................................349ZOUINE, Mohamed................................................336ZOVI, O..................................................................353


Congrès géré conjointement par :la SFEAP & la SFSM

Laboratoires organisateurs :CEA/iBEB/SBTN/LBSPCEA/iRTSV/BGE/EDyP

Abstract Book All

Documents

Transcript of Abstract Book All