1841 Nauvoo Hymnal

http://slidepdf.com/reader/full/1841-nauvoo-hymnal 1/351
aadand wiahwith the understanding itisit isig lyeyllll zi igiigl
f nspessarynS pessarycossaryt1hatislattslat the church of oficofjcJ 0411 I 1 1 iel iii
sus glaristgliristaristhrist 0of if lattatlattermatterter day salisamallsamtll i t
astawsta i
6
faaielliailliialiql andard belief in the gospel anandd
asfaracanasfarataganpranacanPcanran bebeholdingholding gorforfbrtnfcl i
i 1 t
anqn of manRntl inin his glorygloy riot- s
ljtfhndijisd tthea churchurchcli as it slitlft
rjlllf1nitss I1 in 4tsats iuinfancyfancyluhancyhancy yotyet
uritistl acikii fci st
orjiopji jk
iiipjyrqayay- anaanswerwer overyeveryoverroveryevery
itloisioii10II 10 tilotudtilgludluo songs509 of
5/26/2018 1841 Nauvoo Hymnal - slidepdf.com
atilivyl jtil it
heauellihes call penupersuadeade dirstdirptdiri4t moitwoitmrutgfi
umbBHBume himbim with swowwwlomwwow I1
lotifchtl ulgaj7nvlaaaitlcwyawliwl clevselevs whyobebegalabegasa944 wfolnlibanlcliBAnlCa f iwerer force the hhamanhumanUM imnindmind av4v
r ignianiqn WAandundudd reasonrebson makemaksmekemeks acaaanacn 1
iw amiamt what aw Wi nlinnle ujawlami ewtiwt asfs&eatny1fca4fl6iity t 6 tt&moro it&w&ta
aamatsirca
izmayslotIOTloy
ajl
i 1
1
lpessoaespss lattatl3t dtspiee grow harder still ib4 thauthatthlu adhereanere helietibtub turnstarns their will tliusalwolserasink isexosink to hell e troe anatinattt hearbearhaarbaar in glory dwell
itf iff i& ta6thetake the downward to- drodrosddrosd
liate 1411ellir liell ouonrconrr las abode jsffhft3 parr andant wawe shall know fityofityd pftjgedg e a duourselvesrs Aves in cedlesscndtercndless wo
ja j3 2 PMi- j altuqltu wiaswi4stbingsthings of oftfapcthee argarear spolen
ff god1
thou mamaystYtstist smilomilo oaonk onu aliallullnilnii thy fafosS
3 seesec the streamstreain of living waters r springing from camalctmalcoleitial loyelovetotetoyetokeroke
wewellsfringiag I1 susuppissupplyptirgbythy soniandbowsawbom and daughters
anandd ttitalttii mearrearar of dt6ullfremovotikrtith remoseremove H
4 who can faintfiatriatrintfeint ivbifiswbttfl guelistithguell a rivereyereterever flows their twrit vassuitgeliassotge I1
aloizfloizgrace whiewbicfiwhle like thaidthildth lord thwgiverthe ivr T never failsfailabaliabaltafalis I1 roarmoar aseage to0 aeqeaaelaslveiae
A
al 5 Vhound each hAithabitationadon lioilribho Tringvringzsee the cloud and firefir appear i
forir an glorygloryaOOTV andfindnindnd aPI qvrihf ff7riliweafrrihflr JwaklailI1 showingsho wing that th6thathdloriislowislowes neirnear ay4y
mi thus deriving from billeitilleitttreirbariiuuba kt
lilightghtaht bbytj nightzahidzghidwdbadtf by nay t
sweetly8wetlytheynjoytiibspmtt ey enjoyepjoy the apkht which he kivatkivvtlveive thornthointhomm whwhanin lhychy
pray t piffliiffl
ifctelte
F
B
& i
jai1lltr tahutjhu ovolemn praisespraipral sesacsaes
bpfjlattootfcriag1 b 0trering brings
lliiilljeramiaV I1 city&city
llesai4i 4
lljsll A
i T allarlait
nniltinfn I1 z antsntsuanu4n cutac4c loblomIOBomagrowsowsaws
4d in one sweet ssymphonyanznphenyph6ny of ofpraiaepraise
the jewsandlews jews and Gendlegendleswillgeoulesvviuswill unite J
and infidelity betconeovercomeoetcone ireturn again to endless mnightent
6 from east to westweat dromfroiafrom tortitorte towrcwiowiP
the laviorasaviorasaviorlpSaviorSavioralp kingdom
1 shalishail I cxtwtdettodethod
and evry man in evry pweeplacepigee AVshall meet a brother and 0n fljllttl
I1inrmninrunIYMlymN 44.4 sm
A totopraibethoierftaikisfliltpraise thlowmagod I1 1
the heavehenyeheavenly bounvihim
chestarthestarthe starry llgliatidtlrmnliaiifiatosiit fr
x
vw or alling lxalx at snow
414asie tfiauderaribth andersanderathundersunders truingtbuingaqtq mundmand the sk skicshic v
A hibhisnib powrandtleryahowvrndglotjhow
hm fire thattbtthag streaks the sky j rwe tle lordalord
anhffalbebnbovothat es abovoaboboparciyoIfolyoiforyietibtisryieyib fxprewdexplevald
shouldshoutdouldphvn hisbis praimpraisesprailprall best
oiioiloli p pap&Y
nok natnek hls8tsofvirfdgipirngip v
sbalitalso0 our health away if ifgodbewiibustbfitbtgodood be wjtll us there
heileils inu oarourgargur sunamiabnabu and he ourooroorthadeshadethade
A to oldevirdeoide the head
f by
3 god is ththetho0 only lonilawlom j ouroar shieldandshielshielddandand our deneahdefeat J
withwi th p ftsftaats hishiahlahib hand is storadstor4dslorstor ir we1
dtw atwtawraw our blemblewbiembiemnogssasbasses thencethencsthvnc r
r sewtewssw
r0onn jacob tedetaketaderekerebetsee peculiarpecullarpec&iiarfflricevacevfce S abdandatirigltooglgtj togtoa
HYMN 0 P M 1
i1 praiserrai8fltogodinimoitalyraifeto godimmaxtalpreqc for the lore tlttcroik thwerewa oagoaroug mysdays boubtlavenonntotbomceofirjtyoctveeoftvee o4vlly6 10t
let thytb 7 Ppraisemisewise our tthaestgaesppessmarpionrpioOZ
I1porperN r Aikes bllmiogsI1 asogsoofleteofllterh e rfiillfiiil yortliietar8lbbff4niarid1is storrs thio 1 old
foisflic niifshilo ezeexeezachattedcxattedEfodfedtodi acelce
of f dlediee girair
tx
ail tatimrimfrithwith boenbownbmatbowntooabmatloustoostooaloustousyoue aadtontl1ad kmen
I1 tatt6t leitrulitru 4tttfana Ppourapours0ursurh i wastwasi lmltobt raebrfeb overflowingoerflowingoerflowingwing stores
JH iteewgod we oweONVO
abauibau hakohakeshakeshako with awful
i feel his might
goditpoditpodildit tonghlltong hilhiihll annd
gt wcwmfwm reramoreft amo suisoiwouirvuiaiuyouirvuialuaiu t 4 77- 74swy3774bwyiwy i
3 lift up yourbeadsleyour headdye saints in peapeaco thea4viorthe sflior comes for0or your releaserelrei easeeaso
chaldy thaldy thao ay odtheoftheof thetha redecradhasrmeerrildffias commercornercomen
the saints shall all bobe e1comdtvefcomd homohomahome
4 Bbeholdbiholdholdhoid the cfiurchchurch it soars on high
tomeetdomeetto meet thesaintsthe saints amid the sky to hail thetho kingeingeinyelny in clouds ofaireoffirooffire and strike and tune thth1tha immortal lyre
56 hosannaII osanna now thothe trump shall soundbound proclaim the joys of ofheavnheavin aroundarounds
when all the saints
60 with enoch hereberebercherc wowe all shall meet
and worship at messiahs feet
unite ourOUT
the city that was seenpeen of olioltold i
i
tietaethe father and thothe sons delldeildelidelightklitglitkilt t S
A8
4an&loriand gloriesh great our god shallrhallshailghail give
tlora viora namenamaenamme
4A 144 boblb&adflttrantimantinanti tirwlamlt 1 bclaini AVvllitoamialftiielvn&6hallahoutcgal4
ir iiimvin& allshoutogair
HYMNnymn 8 P M 4
itoato1to utuulu tli&tbfilde ie wertawertj
iklbolttite noonboboonondBOonandnond bearrbtarr
f wilif wiltf ewttwtit died
tnttot ovaITOivaiteive laigfatI1 t lirelive
yh oiwibildliannsbongaomadoman ga
P aawofrerfygye R
r3ui3ndn aiqgtoto come
I tantslants above klukicliu
euth again igis
bleat bleats blestthen all thothe heirsof heirsOFof him
will find thetho promisdpromismbromismpromise rest with au the jtfst j cf3t
thethenn theyI1h ey may sinosingsincsing god is with us3
andA nd we with him
nymnHYMNnydin 9 PPMAL
K
andandceletrcelebratezatehlspralsehis praise
fl441ishis love
ia is great he died for usshall we z4ritifulanrattfal bielbe
j
i and said come folfoifollowingfollowinefollowlowanelowineiowanewe
3
the strait and narrow waywayvo wevevo va f goundfound0 und 13then let us travelt9ntravel on till we in the celestial worldwor id
9
I1
choir
bvm nvm
greatrentreat hotbolotbois thetho lord itistisitts ytis
good to prairieprai&cprairicliislilshlhg3eiand1110ia fid holyniciholy nimrieniirienaclnicinaul e
vett mayhemiyhemay lhajeaidt3abnisamnis in latter daydays
ills wonarpisrolAroi forcforeio TO proclaim
ttattq up loft ilslis
inifiipifi 0 hiblhinihibihinlhial
4xa eltditolt tflmnoe command
mckisckiscKi K S
Ipji11griairinmehin mggog905ospellaspellos pellpeil brings fahffh umttesodls to biowblowblew
931r e ent ngalnngalis31 w rpycliurchiurchitttndsattends
till jesus christ descends
owell0 wellweilweli praise him for a prophets voicevoicevolce
hisilialilalils peoplespoplos steps to guide in this we doanddo aniand will rejrejoiceoic9oice
thothe all the world deride
7 praise him the time thetho chosen time to favor zionszionts come
and all the saints from evryevry climeciftncilmociftana
will soon bobe gatgatheredherld home
2 the openingopnlngrop7ning seals announceanaouncoannouncaannoanao uncounca the day by prophets long decldecideclarlddeclarddeclarade clardarldarid
when all in oneorioonoorreorlo triumphant laywilljoinwill join to praise thethotholordlord
IIYMNIMILIN 11 C M 1 1 I
1 the glorious day lais rolling onon altallaitaltioryaltieryAltIgloryory to the lord y
when fair as at creations dawn h thothe ecccedth th will bobe restoedreslordrestoredres lordtord iiS 1 v
i
2 JA perfecterfe C t harvest then will clown t S
thof ho renovatrenovatorenovatede d soilgoil8011 ft K and rich nbundanconbqndancv dropdrob aroundd
drogiiroun I1 withwthoit ccarrodinecarrodinscargrrmnoonorodinsokoroding ttollyOR
rf j
wiltweltvilvii nature smile againagain Aandridiid blossoms streaminstrestreamingamin with perperfumefumefame
adoadormadornr a the verdant plain
4 tbthath9 saintlints willwll then with pure delight posse6ieaj the holy land
andalid vaik valk valkiilthwith jesus chrisichrist wantewaltein okitewkite ahaandabaand in tihighibs presence stand
r Vi
fi8iaii minwinmih
i
6
imkehnit0ifta despise thetherthet shame Aanountamountn jcofifit atiallatlntibtl earthly things but dross
11iorhlamostwinost holy name
powrspow7rspowars of darknessrage withit h glory in our view
injesincesin jesusu 9 strength let us engart to press to zion too jr
3 rorfor zion will ilkolikolikeilke eden bloom
and jem come t6r9irto reignq 4
ybci vomeVOMK
wilhmill angels meet again
HYMNhyun 12 C M
and chantclant the colerontoleronsolernn lay love jov joriov aandnd gratgratitudeitu de combinecoinpoinooin binebino
to hatlhailhatiafimfi th ansaianspianspicionsclocio as day
S
andiswcptand mcpt the bonhdtngioexiding tyralyreiyralyra
3 the themelthemes the songseng accloyafcloyhf JOY waswasjwasaTto eachaach ababgeheceficgefic tontanlantongaytoagay swiftS throughtthrouifi ohsttf ths retumfretumre
andaud loudladiadiud the iecc&i J 1
j 31
adangelayAdangelay 1lbfeiiatat& befarbedar thothe ritsaitaiita tffti8 5 rk I1 the cnerd6ic e f 1c atariesarlesardtsarits si&iit
tanilandtariid loryclory leadslems fheilia sonbonanaransr
peace and salvation swell thothe note of all the bevnlyhev7nlybevely throngthrone
6 with joy theth e chorus veliveilwellvellweilweli repeatrcp6at glory to god on high
good will and peacopeacepenco htwnowaffietffie now completocomnlag i jasus jesus jasas jes us wsbomwibomwas bom to dlodiedio
a7iiau111a vucepf prince yflftele foreverfbreyerhailthailhallhali cilentlftother frieodl
twr&ocglr laittalaitlaittb0tb and time and life W ety i A y
R eho4d fail
kiykly prprafe&hall
anitikatikasinitmilh0yeloryoas k4feafexaexkafe6 oui&dontgod todayto day I1
ifftasbtetfhlzaalpetfuloetful helhei iljetastftiozibirbbilloki zwippzwipi hill iabliblimijb ourtots jyttfows tikidad honors pay
1appypy elaceplacefcc0cc
fcwoo4nsmllsoilsmlis gracerace
gtbf T TW wgwsys 1 X 1 tosprayTospray and praise and hearrdljersctedactedsacred goidoi901goipellagopelsjotinlsonndpeilapellApeita jq a foundsound j
i
othero3thero3 therothere davids greater son ras filmfixmfix7d his royal arone
le zlisforellssilsellb borforror aragegracearago meoundjudgemcntandjadgecicnt thorothora
hato lads tth 0 mintwint be aglidgfidglid
he to
4 atyutylayxty peacepence attend thymatethygatethy gate i arajoy4b1 loy joylox within thee waitwalt
tobisstobiseto betsbttabebaatta the soul of evevry guestenestthe man that reekqtyseeksreeks ty peace
and vrishesibinewishes thine indreaincreaseincreaft A thousand blessingsblowings on him resresirest I1
5 mynil tonguorepeatstongue repeats herbetber vowsvowvoo beacebeocece tototbmcredhomthis sacred h 1
foihwee mytnyrny friendsfrienda andind jiiqred altsdlts amidaminandABdabdrincewincerinceuincei nce my glorioglorioifcgodgod JUAIS thee his w004biestblestbleet abode
myilyllyliy seuisoulseni shailshallbhail evereter lovolore thee weilwellwel 1
IYMNHYMNlymn 14 LI I1 V
itemyiteiy javery j4very one that thirsts ddrawraw mn A i
ixgoa9 god invites the fallerfailerfalier race
A
sAS
2 mnjfxgoniaafl tth&lhihgvatenIV terscometers camecome 1W01 9 ownirra 0olyply votyotxoe makersk erybFIBrys call
11irbutfiryjttrb e WOeesseroserasefss wantannerstanrersairersalrers home
0
3 zseosao f rfovih a fmntainfinuitainfontainfinui tain rise lflmi6ing kistreamstreamsroams it rolls
A ed nott bring nor priceag7gtaL rj i bqrdencliidenld dinsick oinaindinolneinehn sick ack mck bowssonisboms
iacc1bngctige bivallbiialleltall givp4riverincrivc whayhatbathav I1andondabdand are behbehindind
iutiudtbtUtft of adoodqd receive
alicilici ullmiiarr we reedfeeddeed
ptliaotntde 0 alfinin valnvainwinvin
foecdlciife dlcedlcs
yl re
pibwibaww Mlpa tgw tpast toygwra raayyy77 rfaffsss ffoaxw 7 211 1 l i hearkenheatkenheathenHe arkenatken to me etithyithntith earnest earvieaifirearli
Agdatelamel frely eft eirtsabirtantialsabatantial fo6dfixidfoad
ttrtswoetneofinvsweetiewof my memymercymerey I1 hhirmhirehimmlielle and thothc jhc thplthal alonealonsalonoaiono 901 good
1
1
11
ll
iflfhhoullm e tasteustetasto the manna ofipyof my lovetoreioverove Y andAA letlotiet your soniasoulssonis delight in meM O
3 Yyourour wwwhltae oarcar and kuirtkdirtnrtfticlinelhclihe myaly wordsbefietinglyworbcorb befieiringly rmelreceivct
qaickendolxkkenld your souls by faith divineityinevinean everlasting life shall live 1
HYMN 15 trsiraipa83&6gys
I1 be it my only wisdoinvnadom herehede t6ta serve the londlord withmth nalfilialmalnai faifarfifar
with loving gratitudes Susuperiorperiorporiorperlor sense raaymaygI1 dttplgydtip111
byy banningaanning01111111 ediff eviff evry evil way
1 and walkingwaikingwaiting inin theth 0 goo900doogooddooda
2 0 fnayiy1ya still gromfromfroni sin aa4adepartparti avfeftJL 3vh- o and understandlnkheartunxlerstandlngheart
ato mo 0 given
A
pap3 npifrroywayY I1vayrayrny totu heaven te
hykin icIG gm
anjletyotvioya4 1I1 knownlolbfcagwth sweet accord
3vb2dycigbrrbnaddotdol iwibmd highisbig throne
S dofamanananawofa ifedyhedvjilv V
thitthat rulesrolesroias on highhiglhigea thpeorth suryevb
ft a stormy skyhiahie roaring soasseasgoas
lgodiaoorsgod 1 0 orsOTS ofielofitlqndonrjj00out loveiove
itcti lib heavrfly po warb
sovosovesote bicoic
iqpgm jpevcrn wrexwtexWteX 0qsjgrac0is racorace
ebiwtefri0 ril111 vav1 U
4 the inenmen ofgraceof amacegrace havohatoheto fbttffdfbitfd
glory begbegtrti bdourbdowr 1
then let olrodnow soniabotnat and evryetry y tear bw drygry
i
the blessingsicssingscfgodlaoofgodaitq40 thdmhd wisdom c4p41chmircomir iqssnfaj the faith that sawflyfwvtfyawfly
2 happy beyo4ddssdxbeyofld itsilsilssejselsej Aei
who kilowskilousknoftaiesaylelieylo E d
the gift unsunsplhkable Xc
3 wisdom divinoldhriflodivinyl aviiavil oteustheD nusUUSnas of wisdoinwisd04iWis doindole costlycostlyinqtqkjlinctrih4a1 wisdom tosilvorweprafirto silversliser weisfoweibfo and godrodbodgoldqod is drotsarots aebcaffijfttdcit d biociocfocf
SS fbs&ie
jpP dicercericerce arutandaruiahl immortal praise fdaystdays tiche6ofchriatr t on all besbwbegbestowdbwtowdbestowedtowd
rl 11bonpr bonarr t
tosjjslumeliaallmeil inviterintitw fciue itdlj gmritcalruairual deliatadelibta
HH whyttw&yttwayttwayte yawofpleaantnepbof asantnem
iwwph3 ai
sinftphtfstianqt n
alwrf4by chiehchwehoburchoberch belowffila1781118811 FWMP thine glynplynvn equestrqbtrubt
f
tle lord
4 J
in them let all mankind beholdhow christianschristiana livdelivd in days of old mighty their envious foes to movomoremovemoto A proverbpru verb of reproach aandbd ioverovetovelovelote
5 call them into thy woadroaswondir6aswoad roas lightworthy to walk nihnthwithnib thethee in111lriiri wfauoi
make ulptiprip thy j joiyeladowdsowds lord anandaud ebowe&ow
the gloriousglori ougoagous spotless churchurel beelowbfelow
fj6 from evryevry sinful wrinkle fracfrtcT 1
lredeemdredeemsRede emd from all iniqauyiniqatt f
thef he fellowship attaintsonmptsat saintstaints inaklngn A
aadandwadaadoniygodinigtib&oft0 my god miotmlot f r i
7 0 might my lot baU ccbesttestbastt with tasothe least of immiseemsimms nvititwtnftmoanr j 0 thatchat my lord woulaomouvwuldrcoaatciee 4meercc r to washwaahbiahis doardeardehrdebr difto1wd9cqaw1 feen I1
2 this only thinthiutiling dot401dp I1 Arqnirtuliewilowiio 1
thou kmilownsoormknewtknowt awuamuamrtwu uty boats desir freely what I1 rtctrect to gattgttt tao serralsarraiservalsarvant of efcytfcy onrchonichtirclitireli to 11liveV a
t
thetaea wjprta&dhattd4att pouy lipslip and 1I shailshallahall althvltht itipbopj Brblattidhresddbrattidatridattid die
iiysin10 4
name
hb iovelove 1iak lak to gaze
T s 4tu0qufi1 facoface
i stunstung Y by the scorpionscorp1bri sintinninnln
myillyinlyanly poor expiringexpizingoxpiiidg conlvdblonionl i
ilethebalfiiysonnddrifllindaimydaims sound fifflal and is dt onceoaceonco madovilboadoroado wliolowlizloiele10.10 r
seeseethetbmijordthere y ord upoxtuponatrei I1ihearittdiodforttohear e diet ortho
v
totobataftdtcnr&col9dii a f4it6zz rtco I1 1
what hallhalihail 140I1 do to mak intakentakeclaoltciait k knowndorpardow s what thonfotthonthoa aortalfortalal iflaatnd hnsfdorcll
a 1
on all the world to calucolucallcainealreasl x jto bid thattbrth0t tscailshcailsasfs rerejarej9 j 0
inln hlinhiiaweiolaliolvlio nimdimlieddiedrimliei forror altaitall c forallborallforror all I1laslayras lo10lorda as cruehfcdI1 i di for aelallaei
goigolfofcllnan1 raylay saviora 0 r diedI1 e g
IIYM 20 C M
i ies jes jtytfirp th edccrnnglord j thy hcbffnff w3fq7
ivsu9 wotthjlr
kjn1kini y
werliheisab and salsav t from sriiaiqi savansatandavangatanssatansopppowerpjwerwercyifeuitewceptancehatifa 64eplance hay
1
thetiietile sweetBWCCI intitationintitatiqnincitation we heard with surprise
and witnessedwitnessdwitn6sld salmCaInbalmsalealsaiclintionealtalioncaintionvallonTaliontion Sk
j 3 the wonderfulwonderjtulwondeiful
and publishanpn bilshblish ifiaranioin 1
0of f 0
with wimtlatitahisallisnisuis goodnfertiy a 7
llisIRSills namena ia js salvationn aisalvacs his miurnature is loreI1 V 1
4 we figovfiovnemnewnom aiawenlllstydilyellyellystosto ylt1 in jewslews bt6salllessdtais
divinely assistedassiitedsilied9s v i
to 2iofnzi 0 no a ltba t r ap4p
wedywadyy edyadyyit
H
4jaj az1zhmgsi 1 thathe nin1prnlnfflrtnketprmarm ng braak break e czek taxi69sl allwshllws ci 3
y le zioniczionix
v
thepherhe dawning otaof a brighter daymatmaima carecard rressoik soisso is antheonthe6 world i
tca douiledouilgoti 3 4ar0royorbyor ror ditbtoearmiso eargar
beorabfora139for6 ththithiflysilysflys &fittthbftftth ivine
1 I baahnaaha j
yi & i i
4 j3ijsyab jsjeft&s pt oflrlh give ear uaAu4 oftftiuioftstamandd livelieileilc
jisttlg&tarrqffinayngliielilil ma ng bare
ainsklvnaheoplft91 v pin to wree6ivetettttetettmtetTe tit
Y
1 jrygbryg ta lppoihvehoenoe record borne
tloniyskp wistinglisting forthfoith j&rasreircpa cslldr cn haduohduo
1
MLICrotlickotlic worswonsWORSHIPilipilir 33
foremost of the iansstmsitns of lightnearest the eternal throne these are they whoao bordboraborcbore ihoihwcrosscross
nobly for chesirthesirthak chak mastormastereaster stoodst66d i sufprerssafprerg in his rightcoascushightrightrighteousrighteoaseoas cause
followersFollo wirs of the dying god
2 out of great distress they cacamel washdwashldwashid their robes I1by faithfalth below
in the blood of yonder lamb
blood that washes wristewriitenthite aaisjf stlawrstfawrtherefore are therntheytheynthexthorn nextnett61c jfioiho fhiihifhtihroheihioheihoheroHerobe
servo their marermaner satydaty aad rstigif i
god resides amongamonsatnang tfe& I1 i
god doth inin his I1wtftfs sgh1t s piffliiffl i
i3 moretharrcootnkiiowaeiiisltmore tharrthary coneon dotihn6t here theythayjinldindfind OW tritt orr
they have all heletheirheieheirt soffriniuvndgi pas 1
hunger now aadahd thiftt CO ttioret no excessive heat theyt6tlthoythey feielfesel 1 41
from the sunfssuns directdirectorrayorrayerray wr in a milder climeclimocilmocilma theythe dwlf dalf j
region of cesCEOeternalI1 day 5 1
ta j 4 ilellelieiiewhooifthothronodothfristgrrwho otratr the throne af 1f oth t0tat it
A
8 to thelivingtrelivingthe living fountainsfounta leade
ii c
1
r wanwantst batsatat oncoonce reareiremovenover wipe theh iai3 teatstears 66from every facetaceoace
fillI1 illlillii uupp cv7rysoulcvryavry soulsoui with love
i
J1 when israel out of egyptwyit oswecajtebcolwe i
and left the proud oppoaorlteoppicoraoppi ooracora land supported by the great I1
aai ABI
2 the sea beheld hisbis power and flednned
dispartedDis parted by the wondrouss rod jordan ran backward to its leadlodlendL od
and sinai felt the incumbent god the mountains skippdskippidskippe like figfilfrightedightedfrightlighteded rams the hills leapdicap1dleand after thethemmasas lambs
1
and why should hillbills ar9ror stainsnopnowptainsouptains
shakeye niountalnshugemountains iugouge that &lippd like rainsrams r
yenlllebancowas arikriflightedfrightedfrightgh fcedd I1lambslambba in b s
f w
rtbuc woiasmy 8
whose powr inverted 4006wnatuk natu8 ownsownans inisiriairis only law 114hah5 avteignvareignvreign word
lie shakes the centrocentre i
e with hisbis rod
6 creation varied by hiihacndhlahia hand the omnipotent jehovah knows
thefhelle sea is turndturn1dtotuond to olidsolid land
the rock into a fbnntain6fintain flijmrsfloviraflo990 vieaviravles ind all thingthings
overnallyri18 as ttmey changechangohb 0 o proclaim
rhefheohe lord eternally thtfsaine
HYMNRYMN 25 6 8a81saa
onn israelsIsraelssellseiss god herhehei madamade thethathoftiekrekybyr
and eartheurth and seas witltzllwith altaitall ththeirI 1
i train
lieilelle savessa vesthathatho opprestoppressopprest1op prest h heefetbetfetmathefe6&rmathoMathe jhbthb codrpohfohodre
and none shall find huihuthiphiahla prcetdinpionlisviiin
and none shall find huihutphiahla prcetdinpionlisviiin S t t vwwt
roemoroemc WOSSPIP
3 thetho lord appppourspsursu rs eycefcht jait prion ththetho blind
theth larl6rlorlsuppqrlspo jhoaho1hohe fainting mindif azgzHhee fenjhdlnqrifte ad conscience peace he lijbqsw diacrediatredi streatre the widvwid8wwidd aand 9 jtathtriew
and grdntstpjbbbn sweettweet release
and when my yrfipiijlot in desofidesdfi
fralfiejiairayra 51aoler51 jhywblerocrsnobler persparspcrs amy
5my daj3jfpii4oeaita0er jayor jarer
t0rjifllportalfy endures
tanalujepdpap4 wkwosks hu bohawoha
6 fa ohpthp taistarstaig trofiothofio heavnlyheavinlyheahesheavilyvInly elanflaneeanflanacsiesacsles frnameniamesnameslames
diio jiio cflynts
dj 8ivn
mrmmim WOKSHIP 3731 1
hlll adornand clothes the smiling fieldsfieldswfthnathnqth corn the beasts with food his hands supplystipply and the young ravravens whenV heriseriherl they cry
h
5
n hithil sightahtohto
lietieifelleile views his children with delrgttdelight heife sees their hope 4 ho knows their fear i
and looks and loves hisliudgehis image tbiwk therethero J
HYMN 27
how hihiffahiffhh ththy nvonderitkiiwonderatteawonderattea gag1its Kknownnown throng
K h tiretirb cdttheditnedttn by AthossahuthoS sakusAhund
by thousands
through thothetao
2 thosomightyorbsproceuintnypthosomiglily66 rocialerocialm P awrybwryW r jf
their motions speltspeatspeak speal thy skill and on thetho wings 0of oryeryorr hourthoar rwe read thy
patienc patienca patient pati ercaenca still
3 partof martof part of thy name alv1j361ys4hddivinely standst v
on all thycreattifestny creatures wret
on0rniprjaoftbyflt0 AO
twkf6xto savosafaeava rdliobrdlioB10 Nvwornieornasorrasorros
toittojiboii tjiejpsticej3r
placosplaiosptains
a fatrtflptol ontantsong6ntlong
tIIYMNS CCMm kexekk k
1 ibl
raeneranne wonworworsuyworskysumsuy
2 loglong asat ouiour our fiery rialetrialsrialp lastlong as the erootweero8sw& bear
0 letlotiet our souls on theothee be cast in never ceasing prayerprayorprayor
3 the spirit of inercecdingintercedinginter ceding gracegive us in falthfaith to glaimcaimcalm
to wrestle tiutintitolotito0owo 9 thyth faceface
and know tbyhiqea1x1mcthy hiddenvn namoname
4 till thou thy peperfectrfectrefect loaimvatlovmflspatt
till thou thyself bestow dobe this the cry of evry heart
1 I willnotwillcotwill not let thee go j n
s 1 I will not let thee go unless
thou tell thy namonamaname to rmsmts6 1
with all thy great baimsaltbalmsalvationwoassalvationt16aioiw1mobsmebswoas
and make me all ilk lik ekis tta thitt1
1
i
thath6th&pqwcrg ofliesurro&n3ii who bowiobojjobodjo clirlsvschnstcfimtnanuriqianoiqian
40 rroiicrvzlic wousuirwokiairwonswoKi alpairnip
go larthforth to glotirusivb&glorious wanwar
a5 opioplonly jpewe faith in god lprt
raatra4tfaith soujlioftsoesbes assailassaiassal ott wrtehlhggainstb magalbst cleohflchfleoh and blobiobiocpd
ut ay the powers of hailhellbellhali g frdinhroriea 0dfloiyS irivendriven
g by elahiflahiflamingV tgqspgeancyiftngeotcfe6 euridhuridhumidhurita 6r
gurheygjrheyshey ownthiong thothet e niraleair aniand darken healhearnheavnin vh andn 4alctheruierule the lower niorldoridorld
1
1
xieXICliiiliillISVPIDsining to thothaabotbohe joyful joyfdl joyfia roundgound
lostapdhplcssos appp f p esaiasessiasas ye are
ansof onsof sorrowborrowow sin and care gonfybonfyr thee king of kingskingeingseing takerak the peace the gospel brings
djesus2jesus2 jesus for the sinner dies
view the wondrous sacrifice
pardon holiness and heavnliciondicion glorify the king af pf othanothlneingskings tae tthepeaccbaceeace thewe gggppcltecltpcl
bringsbrings k
search prove my heheajjjlp jjlbrtheeartheerthee 010 burst these bonds anifljkhj aberbe
2 wash out its stains refine its dross
nail my affections to the cross
hallowHillohailohilloweachweacheach thothoughtuht let all within babo clean as thou my lorlordd artileanartpleanart gleancleanplean
3 if in this darksome wild I1 stray be thou myraymay lightnight be thou my way
no foes no violence I1 fear N 3 fraud while thou my god art near
4 when risincrisingrising floods mymysouloerflowsoulolerflow
when sinks
in waves of woe
jesus thy timely aid impart and raise my head and cheer my heart
5 savior whereer thy steps I1 see
dauntless untired I 1 follow
thee0 let thy hand support me still and lead me tothyto thy holy hill
6 if rough and thorny be the rayjwayjway
poblicroblic ctrhnip
till toll ftadriiif trief trilf and pain shallbhailshailshali ceasecense nabnvb Usfscilnf caw and joy and peace
A
AT
I1 TO II11 lelowjuebelowlelow tie jUexuexuatletia skies tb 0 Vs rajseraaseearisearisearisoadiseriso
ejupsejnps name bsbe sung t3irongh everyevorylr6r land byoveryby everyovery tonguetongue
ynrnalapbraja jraja jo thytb ymercijnietcipspslotdlordloyd toaitoalmoalalbruallrutruth attends thy word
1
I1hym33ilsild 33.33 S M
esing ofhilylnelove fwsflllfngpqvijllngpowcrgppwcr
PQPUC woiaarp 43
0 ransomd ransom7d ransomsransomd
incinoin christh ist 1 tho eternal mp king
iiy3wHY 34 L M
I11 before jehovahJehovahl abfalawfalawful throne yo nation4bonationnations 3 10 vithnothvoth sacred joy know that tho lordlad is god aloneatone ilehellelie can create and ho destidestiodestroyo
2 his sovmgiljpwerpqw6r wlthtuvour4withttufourafd lladmadousmaay
hovagsovag Us ay and fbrnildusformdusntenen
and ivher111wherfhltee Nanariewandrinanarirwan drinatrlirliyitr holpholbhaiphoip we strayed
ilehellolio brought ustousloasto his fold
againA
1
and earth lithkith herieherleher tenn
thousatt thou thousaponguessaitsattdollndtlln
4 widawidaaswiddasas thoavorldthe world is tbthy cocorflmananiffidimi 1
vast as eternity tthh ylona X
44 krcelicrcelic WORSHIP
firm as a rock thy truth shallatank shallshallAshalishaila tank stand when rolfingyearsshallrolling jearsyears shall cease to move
HYMNIIYDINnymn 35 S M
j je jehovah Is ththee sovEovboveovreignreirelreignan Ggod0 v
the universal mamMGMkamhingking
1l dileille2 he formdfbnndfored the deeps unknown g ifqogavehe gave the seasbeas their1oundtheir bound fg i thetho Wwaterya tery worlds are all his ownowa H and all the solid ground
iconic3conic3 come worship at his thronecac6comeinelne bow before the lord wearetiisbrebra his work and not our 0ownv n
heilellelie formdfored us by his word
4 todayodaytoo dayaay attendhisvoiceattend his voicevolce t noror dare provoke his rod i
domecomeme like the people of mischoicehischoicehis choice A
andnd own your gracious god if
1
5bkkyour5 ibutabut if jouryour earscars refusetb e language of hisbis grace andhdh6ftshearts grow hard like stubborn jew jewslews B
s
4you who despis6datpisgidespise inmy promprohiisrestisa rest shallshail have nohohoportionportion thretuie 5
M
it i j &fb
0 do notnotoiirshitdisdalnrodrmiit disdaldindal avitvitV i shall we seek seck theeletheel&thelteilgyain valnvainkt
P
2 in thine own appoilitcappoiptcdwpjwnow we seek thee heire0 re wasswgsswats lord frofromm hence we wowouidtnofrgd0 till a blessing thou bebeste sf
3 send some message firofromjhywordMthat mamayy joy0y and ppeacepenceeacdeach dnaimdlna 4comfort thosetos whoweepwho veep anyjmioilmypn h dm 0 it rzi 11
II let hethe time of love reretftrntuin
i w ff y
thee 6urgraciousour gracious gadgpdgpdanirklndhaklhtkln d t
heal lhesck lh6mck the captirreefjtrottao ro
re
let us all rejoice viilffj in tthee iff iwf j
ti
prwwwyryyv vf i
45 TVSW woeanir
his honors shallshail enrich your verse
2 heilellelie shadesrsha4s tholiethoheatholieavnsavnsvins withwxthlondind elarms how terrible iia god in arms in israel are hiwncrpios jpprfickshi known
tisrel iihiekllft4bronetehiptfcul&lr throne
restpst whenmbenaben terrors rhebrge and notionsn&tionsridtions ishi
1 god is hethetho strength oferycoferyedrysCOTYSsaltsnitsaitdr 1
HYMN 38 L M
2 ihlihiM flfleshf4wouldfotwould rotnbotn 1 thineolneoinegine abode imyidy panting bril crijaegut fprgod mygoaniyktng6y6hopidibolild I1 bp
lafarfrdinairiyjondeer 4
farfrdinairiyjondee 4
thy brightegglerinsbrighter 9lriw ghineshine above and all theltthelethatthab bokis0okisoyfeisoy keisfeisekis praiseretsebetse and love
4 blest arearc
wthiiitlietmatewrithenwrithin thothe toy101 N I1a orthyof thy gracgrace there ttheythayheyher bloidbiondbiotdI1 U thy gentler rays and seseek tjaytj6yTMbradtiradt and learn thy praiseplaise
tblestaroilf6zen julest jblest aro mts ddnrdn whcieheartswhose hearts areseearesetare set
to find ththethoa way to ziondzion3zion7s gate god 13is their strength and through the
roadr ad
till all shallahaltshaitshalishail meet iniftint headonheavuheaon avlefigthat length 4 till all before thy fabeface aappearopeargopear and join inlillii nobler worship there I1
IIYSIN at3t3 Gc M I1
cw4
bindlekifldlsxindle a flae of offeacretlmcrbcr edibvdlovo intheseooldin th eseesa doldcold h6artsofadrihkart9 of onrgf t
2 look how wo grovel here below fond of theesthesethosetheoe earthly toyatoys s
ourourgiilshojyqqjshbrhcaheavilyrily they gogo yi
haoarhaohr opolionowolion diesdlee
& ialinihaipttaipttai pT dyingdyingratelratelrate
cirilojioifaint6 aint so cold to thee ajlijl andffnetone to us
ussogrcat so great
Aandlhatisliallkipdieourgn
y IIYliyllyhyloayiohyioaaa0 c M y i p
1 kijnrf sing t6tbetbfthc great jeJehovaboehsbonhshs praise Nictsan4 vl praise to him belongs
1 whqkindly lengthensen thensoutthen soutout ourourdaysdadaysP jiifii
i D ernanddidwidhid our cchoicestoicestnicest songs 7
jsillis jhs prprftyflencqhathvj46qqhath brouchtbrouc4tbrougtuaus through
apojhcrer yariousjvearariouseariousyvoaltwihW ith yciwayd wo and anthems newnev msbeforeoiir0 godappcarurgodappear
B sct&iif V i
TV
thy still continued chrscaracarscarbcarg to thee presenting through thy on
Whawhateverteler we have or are our lips and lives shall gladly show
the wonders of thy love
whileV nile on in jesus steps wo go to seek thy face above
3 our residue of days or hours thine wholly thine shall be
and all our consecrated powrspoiorapoerspoitra A sacribacrisacrificefloe to thee
till jesus in the clouds upappear i
to saints on earth forgvenforglvefi4forgivenforg ven and bring the grand sabbattqyearsabbatic year
the jubilee of heavnheav7nheaven
HYMNIMILIN 41 C MX
I11 ononjordan7ost6rmybariltststand jordans stormy banks I1 stand and cast a wishful eye
to canaanscanaanjCanaans fair and happyhapIPyjandland where my possessions lie
2 0 the transfortinctransporting baptiraptiraplrousrous scene that rises to0 my sluilusightflit
sweet fields arraarraydarrandid inn living grgreenn anaannanarandranaxiversAnaxiversriversnivers of belightyelightYe
delightlight
K 3 tbthftreawtfros94a aqrq As f fruitsruito thatat ndelndeinever fafailfallif 0ontunprtlgrqva jl j p r I1 g
herpesthherp6serp6x l annanaa dnnANNhips vild brooks and
W wiloitoilband
dpnkpn honeybyflowflow
& i u taaif ailairall oargar31 g tliogevddeos i aeoxtendodextended plains 1 sflintiqoaalf aalt
iid116lid herhal day erieiiejiertjier co4ftwp011iajf6u forr eveverovererrreignselgaselghs
jauasehftersand spatapatspattersscattersters night away t xiivilxhi
T
ogtep5lhjit147bolthfalshorebealthfal shorebhore
M0ewt lwt6 wjbanhall I1frftaathatthat happyplcehappy place w andbreyirjtb abtawt i vvheniiaujlvheashjallliikiixll 41biocfioc mniy fathers fideface
ahdlfg&m&tde
1 4u tm
t J V
nbnih jrflanlfl wayQB arounda U d mam6mqx0rollii
V xearlsy1aayfthL uvaava
butinperpattialjovfnltlrainsbut in perpjanaljoyfialstmins 7 redeemingredeeminglovoidwirslovoiove admiraamir
HYMN 42 C M
1 let evry mortal earcar attend and evry heart rejoice J
the trumpet of thggosptlth&gosptf boundssounds with an inviting voice i
2 110holioiio all you huncyhungryhun&y starvingstirvitrig souls who feed ubonuponupon tho wind
aadandA ad vainly strive with efcirthlyddrtfily toystoyat
to fill an empty 4j3dttltbdi 1
t J
and bidsbldg yourI1ur ionlon gingappelltb&hitik litik vilt9ithe richrickoprovisionP rovisilh fasticfastfc
isdbsd
II11littrereyonit may quencfuencc r&nrrteamst withwit springssp thannefanntfannt t at
rivers of love androyjhirgan ljjlg in a hiahrichniah ocean boitt joitt
salvationIR mahunda&flaws likeliko hopagapa afinnfc affdyini J
vywppwyyv w
6 greatvodgreat solrolgodsodVod the treasures of thy loveare qeverlastingrlastidgnilnesniinesnaines
deepbeep as our helpless mis1riesmisriesmiseriesmismls niesries arearc andana boundless as our sinssins
7 tiietjiethigile happy gates of gospel grace 4tilandinlandtand open night and daydyaay
lord weve are come to seek susuppliesppliespiles
and drive our wants away
r HYMN 43 L M
1 jehovahreigns jehovah reigns your tribute bring Procproclaimlelih the lord theternalthleternalththl eternal king grown him ye sbaitsbaltssaitsA withholyjoywith holy joy
ilililhiss arm shallshailshalishaltshallshait allaliailallyourI1ilyourbu r foes destroy
2 thou0 lordord ere yet the humble mindtildfild olhad formedf 01 d to prayer the wish designed hastheardhastHas theardheardtheara the secret sigh arise
while swift to aid thy mercies flies
3thyathy3 thy spirit shall our heart prepare thine ear shall listen to our prayer thou righteous judge thou power
divinedilon irethei&ethethee the fatherless recline
C4 the lord ilizilli6veshallrhall saveththath7 afflicted breast his aarmrm shallaillahilahli vindicate ihthy oppressed
austrorcblrorustro noe&nip 63 f
earths mlmightiestight iestlest tyrant fidlfedfealfenfidi hishi s powernor sin noinornor satargrievcsatan grievo them more
HYMNIIYAIN 44 L HI
I11 the spacspacious firmament on high with all the blue ethereal skysrybry and spangled heavens a shinshiningirig framefromframe
their greatoriginalgreat original proclaim
2 ththlthy unwearied sun from dydaydas to day does his creators power disdisplayappp a
and publishes to every land thetheworkofanalmigwork of an almightyeverieverk yhafidhand
r 3 soon as the evening shades prevailpr6vh the moon takes up the wondrawondrouswondr5ug tale and nightly to the lisils ningtIningtyning iarthearthbarth repeats the story of otherher birth
i4 while all the stars that round herber buiriiburn and allaltailali the planetspanets inin their torrijturrijturn confirm the tidings aaof they roll I1
1 Jf
and spread the truth from pole to pole
5 what though in solemn selencesjlencesjlerme all move round this dark terrestrialballterrestrial ball
what though nor real voivolvoitvoltvolgvoitnotiHnortnoTinoni0 es 1
sound66 d amid their radiant orbsarbs beroun5iind0 4ll11 J
6 the nandand that made usas isis ditinoditincdiflne 11
t t mrm 445 L ATM
i i 1
to introdiicesiahs6r iossi jessilossi jessialsmisAlsmie reign
tiruuptrnoapajeainisnialnis heardtlnryrf T TQM daaneeshgpruiarui vppeorldaEpeard th ancgtomhh lgang6ng inntlkpemlayparknen laytaytax
av1v iiavdnqylhiyd
X ic
i
thdlyhftnijofllw ruk rutruthouldhould hear NP 405905axkx ewulWWwwulUlear
v nwftdp imanimgnap9p ovaov9 traira lihithroenith moenroen
I1 ohohl for a shout ofs6wdjofsacrcdjoyav0v
to god thothesovdroiknthesovewgn klugklut 1
liltdiltui eeverylaneeverylandeveveryrytandrylandtandland thairton9dthir tongues6 employempio I1
lendlend aljyhimnsinghimnsinff e ng dir24f tiiroxetttlirotettif tbhethea akyiskyakssk
with trumpets jtfu joyfulsoiincl joy ouldou4d
Wwhileh he angels shoatiandpshottshoft and praisspratss theirv r 1 1
Ikiuhinkinklug r f let mortaulearjvjlfelfvmortals learn tifeiistrainp61
dotlotletdet all the earth biahonorsblabisbiahiahla honors ef3f 61eft v oer all thothe earth fitrjgnbgrogne
tete
4t speak of hispranhigpranpraNhishigbispralsatytthaprofotindprahdran wfcrf
4 d let knowlinknowlidknowledge ffpidh0igogid 06vt or momock A hiehithim gd PMagoleanagoldanS bindsindn
I1uponpon a lhovgjsthongntitestppgut PP guecuecud j
a loud bothbo thffajasaibrxacjiyflieflik 4 to itolITOIdao i
t
56 MLIC IVORVIPWORWIP s
HYalnain 47 L al
f
2 0 thou whose mercy bendsbejidp the skiessidesbides
to gavcave vavbavevavewheneWhenwhen humblesinnershumble sinners prayaftiandsallail land to thee shall lift their eyes
and eeveryty yiyieldingeldina heart obey
fr boon3oon3 soon shall the flocking nations run
to zionsmowkowkom hill and own their lordfe tc rusingrisingresingk I1 heidgaidkeidand tothe setting sun thalihalthaishallshailshali oebikeoebiheseesse ac saviors nam&adored
Y IIYMNHYMN 48 L M
1 godingodgoa in his earthly temple laylaj foundationyoundatioa for his heavnlybeavinlyheabeaheavilyvinly praiseiais6 he likes the tents of jacob well but still in zion loves to dwell
alisdils2jls jlis mercy visits every house ithatpiftheirthatghat pay their night and morninmorninga vows
abutirbut13dtimakbsmakes anorearnore delightful stay where Achurchesurc h e 9 meet to praisepra i so and pray
where Achurchesurc h e 9 meet to praisepra i so and pray
jbf wg f
rundioPUBLIC ffoenie 57
thou city ofourolourofonrgobtgllitgo 0 i
ththyy farnefamedamefanne shall all tlhyatn8ffijnovat
IIYMNHYMN 4940 C V
atr rtr1 return 0 god ofloveoglove harmhirm4666rifajnf earth is a tiresome ppalacolplacolI1 acal r
how long shallveshailshallshali we thy chichiiffrisn inoilrrr6drnI1
our absence fronifromerom thy aicoracoalcoletcolstco s
2 let heaven succe6dsucceedsucceeaiwitltalnflayea let sinilin and soirowskirowsorowborow c6scsceasa&icsi61
and in proportion to our tart&r 2 A so makemako our joys fit&66irl Ssig
irlsig 34
3 thy wonders to thy
thynstilthyna Stilmake thine own votkccijptc9vor d N then shall our souls thgforytbyltlof bikhirh6ikh
and own thy love wapwaswasgreatsterf IA
alliffaiffh eshashtsh w 1
illyanillymnihymnsd 31
r 1 ai I11 sweghesweghsswe is the wortwork niymy dgodmyjkingJ to prpraispratsa 0 thy nnameamei givagiv&givchank lllakila ii 4 atlarlatiatrati
airtoshowthTosto showhowth sing thy love bbjmorningrgfitbornimorni in41 fghtfeht
and talk 0of allail thytriththy truth atiii blk elgnignigatnigktt ft
wwwvvvvfi w
2 swootsweet is the dakof dayof day of sacred resttestreslrebiresu
Nno mortalmbjfal caiaiallcarcjshau seize my breast 0 mayinaynyhetttihinen inneinno bobe found
likalike iayfaiarplc6olcmn61cmn sound
AMandardarl biblessblissbiesseescesbes hisworkihis works aand11 bledableeaabloes his wordtnytoytox nvworksriksbiks of grace how bright they
shinesh- ine 110lloliohowwadeiwdeidepdapdcpVP thy counselsbowcounselshowhowbow divine
4 sureur c I 1
shall share a glorious part
4ohepahcp ja j6 gracerace hathbath well refined any jnyy heart
andn trashtrpshpihpahp6h supplies of joy are shodshedahods d
likolikeak 1k holyblybir oil to cheer my headbondboadhoad
i 6
s A I1 djireddjfpredorired or wishedwisbedbel9wbelewbelpw jj andardari civery06ry power find sweet employ
inntthatatetrnalworldofjoyeternal world of joy
eternalterier a iadomssdomom isi their guide 1
fjrhiirheip dmnipotencfc
vtis 4 afttftifeive2 inn foreignor rrealmske and lanik lanm remote aponyPpponyb
N tltvii
J foteforerote
fiul
3 when by ttedrethe dreabfnlSfajfhj tontttnltt bornelornebornohorne high on tubthetuetho broachbtokaibrokch varavw&vcviravc I1
they know thou art notsloinnotslowtodoleartolearhear nor impotent to save ili 0 J
4 the stormslormisshormisi laidliiidtthotha waw1wingswindsnan6 r6tr i
0obedientbedient to thy willevilly
the sea that roarsroart at thyay commanda at&tt thy commandminandco isstflilis suilsull t ny
5 in midst of dadangardanglrdang lr fear anand dltttfr
thy goodnewgoodncbaweleadortiilivuft
and humbly hopfdfliiahfofttanh I1 j
I1iiyainI1 I1I1N 1 t 1
d t1ta
i 1
couldC ouldouid givegiva thogaldioulodid gttiltyity cocon&tre apiipii or wash away thothe stainstair
T 1
I 2
limnim namT
AB earsallears allailali our bi-sangmng away i if A sacrifice ofnpblofnpblitrr naffinnaffipnamp r S
andandriehjryo6uahha gri4 ri A
3 1301iylngvwabelieving we rojoico k
Ttooseobeeltho6jjii aursexemovaoursecursecurbe remove we blijthoilliariibilliAlambriib with chcheerfulcerfulcarful voice
liong ai6 alveilveI1 live when troubles rise
ajlpliniipjl basteabastep toatos throne
i 2l46ijfiaotdY hehearclnylieliliii earhny cries tt andritndritnd dit rit my gritf away
IK r ssiysf r 1 a
ayiy qjriyselrtbmoredesjiblrkp moromore deides
xr&to P tt
L 1 ilo rd thonthou9 zastreahastreahast searcbdainlrchadh1d naanadnna seenbeenen me issISB tmotamot
tenjegpsspmmaniiismthoinffiariostylth ppiercing view ibayibiy rianbjnyjpshnlioure14 an4n diouttdiourt my6aranasvltnall1114 dil their polverspoiverspolderspolpo iversvers
HM
tieTIMyFRF
PUBLIC WORSHIP 61
2 31yihoughtsmy thoughts befarobeforo they are myroymoy own A ie sy god distinctly known he14 k knfiys thoho words I1 mean tospeak to speak Eeree rfwjaii m openinopeningolenin lips they brcak break hrcak
3 Nethl
yintin fthl
thy circling power
I 1 stand
1111 affyneeykffyy side I1 find thy handband q flaisfl&isv asleep at home alyniyabroadroad
cisirroundcdim39trounded still with god
MWtitttiet largelaraelarce extent what toftyloftylorty height liyIlylirilysoul jlysoalsoalsoulsoai with all thetha powers I1 boast winuin ab&b boundless prospectprope ct lost
5 0
HYMINHYMN 55 GC P ai
begfifmybegifmyeoulsouisoulboul ththl exalted lay jay urtunt elceleeaejirapturedbra pt uredared thought oboyobeyohey
antandancttsba ihth almightysalmighty7it nametoi101koioiheaaiidhea an carthearthcarthandearthandcartearthandhanland seas and skitsskimskeasskemskew itbanetoneianeonoone odsausousUs concert riserise
to evbffnfi inspiringintpiringthspidrigingintpiringeiring theme
ittiyijth vrikst0 ternalternai king tiittlittiltalit iimelsibrlas64640flas adore A
jmjrmjroaring billows triistm joffee jofftewe skies fdiros6 as viaubu rolitolt
oatmotgotanteimotdeclareaptei declare iiilil himbim ofvieldingairf idoidi agairngair ttostbtlboul
1
amaiflfflpiojp ayqy
ivstw woftsfin 6303
HYMNIIYAIN 50 C al I11 whenwhell all thy merclmercimerciemercle eq ornoinomy gogodgoadi
my rising soul surveyssurveys transported withthewith thetho viewiview pinviapraII11 M lost
in wonder love and praise
22 unnumberednnumberedcomfortatocomforts to my soul thy tender care bestowed
lforeaforeE lureluroiuro my infant heart conceived
fromlromwhomwhamwhtm thosochoso comforticpmibrtcpmforti flowed
iai1
and led me up to Mmanmau
4 ten thousand thousand piedpiedtisprcciottgtis gifts my daily thanks emptemplemptoremptof of i
nornot is the least a clicarthlchcflifnl hcajt4heart
that tastes those gifts with toy
b through every perioderibdi of myliamylif rnliftimy lif tllytsygooanossinjpursmegoodnogbodno 54iiii patotaputota qui ja j18 t
anduftcrdeathinandaftcr death in distant worlierorlteworlteotjkuotoku
thoglorioustho glorious thomothemethome renewr
1
praiseFWSO
A
lla115llyklyll51
1 plunfied inin naulagulnguiaculcof 0 f ddark alI1 c despair wlretciod6innerar6tqji4tinndrs lay
4 ivriijwi&uiapnen cheerfuledhoerful bebeamam of hopehoped
E otispaifoofuintncring 14
iglimnicrinm day S
S vahvhht pithingpitjingitnian g Wwyss64hek thothe prince of grace BH gurpur aelpltp3 grief &
myliTaIImylltaiiawaaw arluaridarldanilannl oh amazingainarnnin oling love f j asfsf
he 6cambAR 160 o our yclf cljtr t i
efromnfrom0 he sshiningininginipg seats above jlpythashejied0 I1rqjh4se aqvq i enteredn ferter 1 hegravebegravehee graverayeinmoralVtn mortal flesh
1 andahl weltdweltweit among the dead
1 l A
4jdhfor ph toor
ioor this love let rocks and hills
4 Their lasting silence break fj amr jw all harmonious hupan tongues 617he jhthc saviors praises speak t
hsuASU5 AngelsngeI1 s I1 assist our mighty joysJUN joyt jon Pviiivfiii1111
I1 16e al lyou0111 harppfgoldpap8 ad6d Bbut whenypup ou rairalserourseyour highcsthighesti aoteanotea
A A hisl6vercani awmelcrneer beve t 61oldr
r x
sinaicrinaic VOMBIP
sceneacenelizlithast totto thehe saintasaints a refogarif6j en 1I throughnroughbrough eveevey age eroterotfiilydilXfiP their pleasipleasapleaainghomengh omelOMML deir&fe Aabode0
2 in theeortheovttheror
behold their sonslihSonoq3ofewbixagilaslih filed t wenyevye come tolltolitotito fillll11 murfitourfitourthwsp
k 1
oral orny mitspitslq wee treatrealtreadtresl
grooroure we aareara num4110vithnanilqid nh thedeailzbo41the dearvdeaildealv A aj&jmenwhen friendadesdicfnrtldil depdec toivdtoiwd lee thou our 01123an011sllsii 23aqffiicimadi 1 y
4 anawandwandvhp4dagtoijpy
totothegodwywoflf the 10 j andkudludaudlud fifinavffslnsfwae
1 S A lyk III111
5 Tto thee qgunfautn wyfiiatga ai1i jthem may tjsragtdrx00. fhatvaahatihat voejlavoella Hi glIDa
enucccediucceedinshylriniofhiimbloprigin 3
1 hark hark a thetho notes of joy ronrou110110oererthelieaylnlthe heavnlyheavily y plains
atandjseraphszerapbi find employ
v 1 LOUlopijqudringT nuoathe jthe harps around the throne
haW h& 2 hark eark arqr hark ork thethothetouadstowndrtoundr draw nionigbybigby
thjofth hostsosts descend
iloilsiio guliyajiyajispSp afo jfob bl4blcsabla our fallen race hcbnowithC with messages ofgtaceof grace sr
kiyarar earthecarthelicarthe tidings round pelipELtmelipeltevryevryv r mortal know
vfiati lo10loveiovee in god is found
t whatat pityit he can show Q yawindsy1 s tthati t blow ye waves that roll
lag116bearr the gag1gladgiad news from pole to polepeledlevledieale
istrikctike strike the harps again oi greatreatrent Im manuels name
ansense ye sons ofmanofmcnof men
an d loud hishie grace proclaim C tangeiangekangeanggl8andimenwakes i7ndpien 4akeevryevry string
1 tislboaftaviorsi praise we sing N 1
4jsst
p 1 r JWWJ WW y HI lt gA j tobtrc WORSHIP 67
HYMNJIVINnymn 6 C M
I11 with joy wowe meditate thothathagracot4ezrgraco of ourourhighourflighsurhighfligh priestabovbpriestabovo
his heartisheart is made of tendernessen darness hisIDSins bowels meltmeit with loveIPVC
IZ touchedtouch7dtonchdwithsnijathjvilhlnlitvawitva sytn0t hpwrhin A3 lieheife knowsknoourfeebloour feoblo oramfram
veife knows what soro tetemptations mea n
for he has felt the same s
3 liehelleile in thodaysthodayatho daysdaya of feebiefeeble flefleshai pourldpourdfourd out his crisscries and tears
and in hisbisbighig measure feels afresh what evry membermombermemder beaislbeairlbearaj
j 1l
we shashaIRshaibshairobtainilpalpobtain0 i cstivilng EW J
incachincachdistresmrtgboarfctr ol01 flig h 0 1 11
1 v
v a
iloileiioiicuvoII suvocUvo iv
at 0
lielleilefeliniliapilivpi to ivliviwijiway
hether fivesilveshives their tmitmtqnsmiehsmiqhs to prepare hgiq 11y61hvf3 to tf tritftfemVadzzf safely there
3 yo igouiridsoalemou riantdsriAntriandrland ds dry npap your tetertea Ts
dmissMMISamiss14 s ysfflftywhsnyaforeyfore ydemwsdoubtsdoobts and ftfearsnarsmars
withivithicliepcliefbuiopft jaqwdaqw1 your heartsbaarts TCrevivei c foreor ghatghardhar lsar3tharf Vp lot ahveaeve
i
tiurhianfjiaccalltalitailt oceocowco viuwillyiu be afford 11ll au arptoctisrtmoeftmoiftneift vahriihvhhviih thetie gad
IIYINMnyaindyain 02 L M
iilhwsflrveytftrhfaeatpraymiff 4 hoda atgmnl
pareftjyptir voieefl hhighh gamgaacre iw wlrantaxrqn a to oieole0 e
gfihljtlff hiathp allaliailloaillvaillV sool
and calls the sicredvsicresacreddVplace dge ifniqwnhysrysbys
NVII
y
keepsback keeps back her b6nsecrafuc6nsecraf2 storestorotoT a
from east to wrestvrest thamoftptheraffstgo IOJRSrin I1
and either india
grent san 0of f RRightObiebithie 1 i1100
and fill
comecomo tthe savior promispromisetot144yok letlotlct evry heargiheart pmpaxetj 6
and evry vnfravninfracoyeedmedcoa01coAfra 6qog01
his holy vreevreqbrebroactinbroaCTin
the ironwbronw
kilpkalpktlplecloclocpaespaesCPSOBSones from thickest shades of nihtnight
to dearliedearlhecicarclear teetheteo inwaidsighiawatd sighttanaanu anpnon thothsypbauseyipbaus of the blind to pourour celestial light
5 he comascomes tfatbrolson apartbpartapart jpart to bind
tlletiie breedingbteeding faoulfcoul to cutecurecutaaaaronaafronainaain4 JTOW thotheteo trpassottauoalvtee of his grace i T enriienrib tho humble poor
grgladhosaohas otinceptince of peacopeacecaco
hymsHYMN &1
C M
IR lerrtsgbf cr
4 while fromfroni thetho thesonsvorinenansonsofmenoa eurih ilehellolio suflerdsuffierldsuflesuffierldrd rude disdain
iwthey threwtheirthrewutirthrew their hfortorahortoraoiiort ors anitisatitisnttslietit A and waited in hitrainvitrainhi vlravirawiratraintrdin 1 wf A &
5 throughthroumh through
they didid his steps attend oa02o2oft gadg0deazdeadd and wondbrhher&athjwondir7&wfidr&q Tthisis scene of loeenloeeilorutd efra la
i pylep yfeyle 6 thythey heard him in thathothoardiardyardi aanand saw hishiahla sweat 6of bod6od they saw his pierced hadhanhab1gdndatand
naildnailldnaald tto the cufsedoova00 aliiaisidliiI1
7 thetheathejy sawbawaw Mhim break breakahklh i dc a which none oereereleroleroyer brbrok 0
and rftqinrjiaq in conqu7rinrconquringlnaaa
totostopkostopsto op to death nno0 nilo
8 thethey bbroughtrouwroug t hischehischj 0 0 vek veito boarr hhim to hjtj lff iff 6 and with a shodtshout6 out Q
yytuw vrwssuf
LM L 11
sabb ir hpdstuwdshads thetiie spirit camecamb
ign ifapitoflghb8flficiotenwopgk ovlayea flamoflame 1
12 liyftsorisofisofir whatwhatmairacksaiiiaolai helitlis gave 1
varvrrvfrp r to 4luilul41 andpovorandadd pwrowr to baveeaveEAVO
miniifni aklehaolehU iieirmieir dpntpntpngn940 viiviviiiith wonditoulwondt&ua
a ralr2l anlsparsnd pea rs andandsyordsandswordssWords
aoiintthehe sarit the champichamplchampia&s
Ffrostfrosafrosf Fro Sf J rom gouthouith to norihggilbtiursviotabovierbovior r Is causecauso
gopujlp0 mysviyayiy srtxbrinsis erbse 17
4
5 T
ar&rrjppshajl1yarlsp mmsams subdudsubduldsubduesubdudduld
1 to him ihaftvdihattgvd the eorabosaoos Otiftecneni i

1841 Nauvoo Hymnal

Documents

Transcript of 1841 Nauvoo Hymnal