THE SHREWD MANAGER Luke 16:1-13 Penge Baptist Church 14 th August 2011.
16 th August 2013
description
Transcript of 16 th August 2013
![Page 1: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/1.jpg)
16th August 2013
![Page 2: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/2.jpg)
carbohydrates, lipids, proteins and nucleic acids
“Molecules of life”
Packets of instantly available energy
Energy storesStructural materialMetabolic workersLibraries of hereditary information
Cell to cell signals
Slides by : J Sen
![Page 3: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/3.jpg)
Proteins are communication devices to conduct biological processes
![Page 4: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/4.jpg)
How are Proteins made?
DNA
RNA
Protein
Cellular processes
Transcription
Translation
Proteins
Enzymes – that carry out chemical
reactions are largely proteins.
Most drugs bind to proteins to
repair a ‘faulty bio-machine’ to restore order in
the system (organism).
![Page 5: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/5.jpg)
Most drugs bind to proteins to repair a ‘faulty bio-machine’ to restore order
in the system (organism).
HIV drugs that bind to a target protein exploits shape
complementarity
![Page 6: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/6.jpg)
Viruses infect by manipulating their proteins
Isolated Viral Capsid protein
Fully formed stable virus particle
![Page 7: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/7.jpg)
![Page 8: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/8.jpg)
Proteins play crucial roles in all biological processesTrypsin, Chmytrypsin – enzymes
Hemoglobin, Myoglobin – transports oxygenTransferrin – transports ironFerritin – stores iron
Myosin, Actin – muscle contraction
Collagen – strength of skin and bone
Rhodopsin – light-sensitive proteinAcetylcholine receptor – responsible for transmitting nerve impluses
Antibodies – recognize foreign substancesRepressor and growth factor proetins
Slides by : Sankar
![Page 9: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/9.jpg)
Biopolymers Building Blocks
Proteins Amino acidsNucleic acids NucleotidesCarbohydrates SugarsLipids Fatty acids
Proteins
Enzymes carry out these reactions.
![Page 10: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/10.jpg)
Proteins are polymers of amino acids
Proteins talk to each other due to shape-complementarity.
The shape is important for its function.
![Page 11: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/11.jpg)
Proteins are made up of 20 amino acids
NH2
H C COOHR
R varies in size, shape, charge, hydrogen-bonding capacity and chemical reactivity.
Slides by : Sankar
– a very small tool kit!!
![Page 12: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/12.jpg)
Only L-amino acids are constituents of proteins
Slides by : Sankar
![Page 13: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/13.jpg)
Nonpolar and hydrophobic
AcidicBasic
Slides by : Sankar
![Page 14: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/14.jpg)
20 amino acids are linked into proteins by peptide bond
Slides by : Sankar
![Page 15: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/15.jpg)
Peptide bond has partial double-bonded character and its rotation is restricted.
Slides by : Sankar
![Page 16: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/16.jpg)
Polypeptide backbone is a repetition of basic unit common to all amino acids
Slides by : Sankar
![Page 17: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/17.jpg)
YGGFL is a different polypeptide than LFGGY
Slide by : J. Sen
![Page 18: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/18.jpg)
A Ala alanineC Cys cysteineD Asp aspartic acidE Glu glutamic acidF Phe phenylalanineG Gly glycineH His histidineI Ile isoleucineK Lys lysineL Leu leucineM Met methionineN Asn asparagineP Pro prolineQ Gln glutamineR Arg arginineS Ser serineT Thr threonineV Val valineW Trp tryptophanY Tyr tyrosine
Large proteins - sequence lengths are long.
One letter code is easier to work with than the three-letter codes for amino acids.
Slide by : Sankar
![Page 19: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/19.jpg)
Long polymers : from 20 amino acids
Fold into compact structures
Primary structure ADDFGFIPRELALKRMKGSTPNY
Proteins
![Page 20: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/20.jpg)
Protein Structure: Four Basic Levels
Primary Structure
Secondary Structure
Tertiary Structure
Quaternary Structure
Slides by : Sankar
![Page 21: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/21.jpg)
Slides by : Sankar
![Page 22: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/22.jpg)
SETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
Histone (human)
MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA
Rhodopsin (human)
An educated guess of the proteins function from the primary sequence
![Page 23: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/23.jpg)
How does a protein’s three dimensional structure emerge?
The primary structure of the protein gives rise to the protein’s shape in the following ways:
1) It allows hydrogen bonds to form between the C=O and N-H groups of different amino acids along the length of the polypeptide chain.
2) It puts “R” groups into positions that allow them to interact. Through their interactions the chain is forced to bend and twist.
Slide by : J. Sen
![Page 24: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/24.jpg)
The anatomy of the peptide backbone
These atoms are on the same plane.
The peptide bond is essentially plannar
Slide by : J. Sen
![Page 25: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/25.jpg)
Second level of protein structureHydrogen bonds form at short intervals along the new polypeptide chain and they give rise to a coiled or extended pattern known as the secondary structure of the protein.
Think of the polypeptide chain as a set of rigid playing cards joined by links that can swivel a bit. Each card is a peptide group. Atoms on either side of it can rotate slightly around their covalent bonds and form bonds with neighboring atoms.
Slide by : J. Sen
![Page 26: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/26.jpg)
Alpha helix (α helix)Features:1. It is a rod like structure.
2. Backbone is inside while side chains are on the outside.
3. Hydrogen bonding between CO and NH groups of the main chain stabilizes the structure.
4. CO group of residue R hydrogen bonds with the NH group of residue R+4.
5. Rise per residue is 1.5Å and rotation per residue is 100 degrees, therefore, residues per turn is 3.6.
6. Most α-helices observed naturally are right-handed helices.
Slide by : J. Sen
![Page 27: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/27.jpg)
Pauling and Corey predicted the structure of α-helix 6 years before it was actually experimentally observed for the structure of Myoglobin.
The elucidation of the structure of α-helix is a landmark in Biochemistry because it was demonstrated that the conformation of a polypeptide chain can be predicted if the properties of its constituents are rigorously and precisely known.
For this work Pauling got the Nobel prize in Chemistry in 1954.The helical content of a protein may vary anywhere between 0% to 100%. 75% of AAs in Ferritin, an iron storage protein is in alpha-helices.α-helices are usually less than 45Å long. However, two or more α-helices can entwine to form a very stable structure, which can have a length of 1000Å or more. Such α-helical coiled coils are found in many structural proteins e.g. myosin, tropomyosin in muscle, Fibrin in blood, Keratin in hair etc.
α-helical coiled coil
Slide by : J. Sen
![Page 28: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/28.jpg)
Beta sheet (β sheet)Where residues per turn is 2 (n=2) it is a β-pleated sheet structure. There are two kinds of β-pleated sheet structures either the chains (strands) are such that in two successive chains they have same directionality for N>C or they are parallel chains (parallel β-sheet) or they are in opposite/ anti-parallel orientation (anti-parallel β-sheet).
Features:1. Distance between two successive amino acids is
3.5Å.
2. The side chains are at 180° to each other.
3. Adjacent β-strands are linked by hydrogen bonds.
4. In antiparallel β-sheets the hydrogen bonds between the CO and NH of adjacent strands form between groups that are diametrically opposite to each other.
5. In parallel β-sheets hydrogen bonds between CO group of one amino acids forms with the NH group of two amino acids downstream in the other strand.
6. β-strands are depicted by arrows schematically.Slide by : J. Sen
![Page 29: 16 th August 2013](https://reader036.fdocuments.net/reader036/viewer/2022081507/56816726550346895ddbbaee/html5/thumbnails/29.jpg)
β-sheet is an important structural element in many proteins e.g. fatty-acid binding proteins, important for lipid metabolism, are almost exclusively built of β-sheets.
Many β-strands (4-10 or more) may come together in a protein. These β-strands may be all parallel to each other or anti-parallel or mixed.
A and B are ball and stick and ribbon model of the same polypeptide, respectively. β-strands may have twists. Side view of the schematic in B demonstrates the twists.
A protein rich in β-sheets, This is a fatty acid binding protein – but not necessary that all fatty acid binding proteins are like this.
Slide by : J. Sen