Post on 01-Jan-2017
1
1
The formation of Streptococcus mutans persisters induced by the quorum-2
sensing peptide pheromone is affected by the LexA regulator 3
4
Vincent Leung,a Dragana Ajdic,
b Stephanie Koyanagi,
a Céline M. Lévesque
a* 5
6
Dental Research Institute, Faculty of Dentistry, University of Toronto, Toronto, Ontario, 7
Canadaa, Department of Dermatology and Cutaneous Surgery, University of Miami Miller 8
School of Medicine, Miami, Florida, USAb 9
10
*Corresponding author. Dental Research Institute, Faculty of Dentistry, University of Toronto, 11
124 Edward St., Room 454, Toronto, Ontario M5G 1G6, Canada. Phone: (416) 979-4917, ext. 12
4313. Fax: (416) 979-4936. 13
E-mail: celine.levesque@dentistry.utoronto.ca. 14
15
Running title: Contribution of LexA to CSP-induced persisters 16
17
JB Accepted Manuscript Posted Online 12 January 2015J. Bacteriol. doi:10.1128/JB.02496-14Copyright © 2015, American Society for Microbiology. All Rights Reserved.
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
2
ABSTRACT 18
The presence of multidrug tolerant persister cells within microbial populations has been 19
implicated with the resiliency of bacterial survival against antibiotic treatments, and is a major 20
contributing factor in chronic infections. The mechanisms by which these phenotypic variants 21
are formed have been linked to stress-response pathways in various bacterial species, but many 22
of these mechanisms remain unclear. We have previously shown that in the cariogenic organism 23
Streptococcus mutans, the quorum-sensing peptide CSP pheromone was a stress inducible 24
alarmone that triggered an increased formation of multidrug-tolerant persisters. In this study, we 25
characterized SMU.2027, a CSP-inducible gene encoding a LexA ortholog. We showed that in 26
addition to exogenous CSP exposure, stressors including heat shock, oxidative stress, and 27
ofloxacin antibiotic were capable of triggering expression of lexA in an auto-regulatory manner 28
akin to LexA-like transcriptional regulators. We demonstrated the role of LexA and its 29
importance in regulating tolerance towards DNA damage in a non-canonical SOS mechanism. 30
We showed its involvement and regulatory role in the formation of persisters induced by the 31
CSP-ComDE quorum-sensing regulatory system. We further identified key genes involved in 32
sugar and amino acid metabolism, CRISPR system, and autolysin from transcriptomic analyses 33
that contribute to the formation of quorum-sensing-induced persister cells. 34
35
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
3
INTRODUCTION 36
The classical view of bacterial survival against antibiotic killing has usually been seen as the 37
expression of genetic resistance mechanisms that arise from mutations or gained through 38
horizontal gene transfer. These resistance mechanisms include host target modification, 39
degradation or modification of the antibiotic itself, and reduction in the permeability or increase 40
in the efflux of the drug (1). A major survival mechanism of bacteria is antibiotic tolerance, 41
whereby bacterial cells that have a slower or reduced growth rate become more tolerant towards 42
antibiotic killing (2, 3). This reduction in bacterial growth is prominently perceived as one of the 43
main survival mechanisms elicited in bacterial biofilms, by which the slower growth of biofilm 44
cells contributes towards the highly recalcitrant nature of biofilm infections, even in biofilm 45
populations that lack genetically encoded antibiotic resistance markers (4, 5). 46
Formation of persister cells is the main factor responsible for the tolerance of pathogens to 47
antibiotics. Persisters are non-growing dormant cells that are produced in a clonal population of 48
genetically identical cells. They constitute a small fraction of the bacterial population. Persisters 49
are not mutants but phenotypic variants of the wild-type population (6). In contrast to 50
aforementioned drug resistance mechanisms which allow for bacterial cells to actively grow and 51
divide unimpeded in the presence of specific antimicrobials, persisters are capable of surviving 52
lethal doses of multiple classes of bactericidal antibiotics at the expense of cellular growth in 53
both planktonic and biofilm populations (7). 54
Persister formation is governed by both stochastic and deterministic mechanisms (8, 9). 55
Persister cells are formed through random intrinsic fluctuations of protein levels, such as the 56
well-studied stable toxins expressed by chromosomal toxin-antitoxin (TA) modules (10-13). 57
Spontaneous gene expression and noise during transcription and translation, amplified by 58
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
4
feedback regulatory processes, also give rise to fluctuating protein levels of persister genes that 59
result in a dormant multidrug-tolerant state (3, 14). Since the formation of persister cells is a 60
result of a variety of mechanisms, the subpopulation of persisters is heterogenous. The 61
redundancy in the formation of persisters hampers efforts in preventing tolerance towards 62
antimicrobial drugs through the targeting of a single mechanism (14). For example, it requires 63
genetic knockouts of at least ten TA modules to significantly reduce persister levels in 64
Escherichia coli (15). Recent studies have shown that the formation of dormant persister cells 65
can be induced by environmental and external stimuli (deterministic mechanisms), including 66
various stressors and signaling molecules. Studies done in E. coli have shown that DNA damage, 67
as a result of ciprofloxacin challenge, induced persisters through SOS-dependent expression of 68
the TisB toxin from the tisAB/istR TA locus (16). Another study showed that indole, an 69
intercellular signaling molecule expressed during stationary growth phase, was capable of 70
inducing the formation of persisters through the activation of stress response pathways (17). 71
While little work has been performed in streptococci, our lab showed – using 72
Streptococcus mutans as a model organism – that persisters were formed stochastically through 73
mild overexpression of chromosomal MazEF and RelBE TA modules (18). S. mutans is the main 74
causative agent of human dental caries (tooth decay) and a resident of the complex dental plaque 75
microflora (19, 20). As it inhabits and colonizes the dental biofilm, S. mutans is continuously 76
confronted to a variety of nutritional, chemical, and physical stresses (21, 22). We recently 77
demonstrated that challenge with an incoming stressor produced an increased numbers of 78
multidrug-tolerant persisters (18). More importantly, we discovered that S. mutans used its CSP-79
ComDE quorum-sensing system governing the development of genetic competence to produce 80
stress-inducible persisters (18). The CSP-ComDE system is composed of the CSP (competence 81
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
5
stimulating peptide) pheromone acting through a membrane-bound histidine kinase receptor 82
(ComD) and its cognate cytoplasmic response regulator (ComE) (23). When the extracellular 83
level of CSP reaches a critical threshold, CSP interacts with the ComD sensor, resulting in its 84
autophosphorylation. This event initiates a phosphorelay cascade that results in the activation of 85
ComE. The phosphorylated form of ComE regulates transcription of several genes (24, 25). 86
Among the early genes is cipB encoding a small antimicrobial peptide that also functions as a 87
peptide regulator for the transcriptional control of the competence regulon via the alternative 88
sigma factor SigX (26). Recently, it has been demonstrated that the ComR/ComS system is the 89
proximal regulator of SigX in S. mutans (27, 28). 90
Many environmental stresses are capable of causing damage towards the chromosomal DNA, 91
leading to potential mutations and even the formation of DNA strand breaks that are lethal 92
during transcription and DNA replication (29-31). Streptococci lack a canonical SOS response 93
pathway to repair DNA damage and the induction of the SigX regulon has been proposed to act 94
as a general stress response (32). In this study, we continued our investigation of the CSP-95
ComDE pathway in regulating bacterial persistence in S. mutans. In particular, we characterized 96
the CSP-inducible gene SMU.2027 encoding a LexA-like transcriptional regulator. We showed 97
that this regulator was involved in initiating tolerance towards DNA-damaging agents through a 98
non-classical SOS pathway. More importantly, we demonstrated that the LexA pathway affected 99
the formation of CSP-induced persisters. 100
101
MATERIAL AND METHODS 102
Bacterial strains, plasmids, and growth conditions. A summary of the bacterial strains and 103
plasmids is provided in Table 1. Nonpolar insertion-deletion mutants were constructed in 104
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
6
S. mutans UA159 wild-type (WT) strain by PCR ligation mutagenesis (33). Primers used for the 105
generation of PCR products are listed in Table S1. S. mutans strains were grown in Todd-Hewitt 106
medium supplemented with 0.3% yeast extract (THYE) and incubated statically at 37°C in air 107
with 5% CO2. E. coli strains were cultivated aerobically in Luria-Bertani (LB) medium at 37°C. 108
Plasmids were introduced into E. coli by transformation using electroporation or chemical 109
transformation. Plasmids were transferred to S. mutans by natural transformation as described 110
previously (26). When needed, antibiotics were added as follows: erythromycin (150 µg/ml), or 111
kanaymycin (50 µg/ml) for E. coli and kanaymycin (300 µg/ml), spectinomycin (1 mg/ml), or 112
erythromycin (10 µg/ml) for S. mutans. Cell growth was monitored by determining the optical 113
density at 600 nm (OD600). Cell viability was assessed by counting colony forming unit (CFU) 114
on replica agar plates. The minimum inhibitory concentration (MIC) test was performed 115
according to the broth microdilution method using THYE broth as described previously (34). 116
117
Construction of a non-cleavable LexA regulator. A non-cleavable LexA regulator was 118
generated by site-directed mutagenesis using the QuikChange II Site-Directed Mutagenesis Kit 119
(Agilent Technologies) following the manufacturer’s recommendations. Briefly, the full-length 120
coding region and promoter region of lexA gene (SMU.2027) was PCR amplified using UA159 121
genomic DNA as the template and the primer pair CMT-669/CMT-700. The PCR product was 122
purified, double digested with ApaI/BamHI, and then coned onto the shuttle vector pIB184 (35) 123
precut by the same enzymes. The recombinant plasmid pVL2 was confirmed by restriction 124
digestion and sequencing. Plasmid pVL2 was then used as the template for the replacement of 125
A115D using the two mutagenic PCR primers CMT-728 and CMT-729. The clone used to 126
produce LexA A115D mutant was designated pVL3 and confirmed by sequencing. The 127
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
7
recombinant plasmid pVL3 was next used as a template for cloning into plasmid pIB107 (35) for 128
integration into the chromosome of S. mutans UA159, and the resulting plasmid was designated 129
pVL6. 130
131
Construction of expression vectors for induction in E. coli. To generate inducible 132
expression constructs for induction of LexA and LexA A115D mutation, fragment containing the 133
open reading frame for the lexA gene was PCR amplified using UA159 genomic DNA as the 134
template and the primer pair CMT-718/CMT-719. The PCR product was purified, cloned in-135
frame upstream from the His6 sequence under the control of araBAD promoter into pBAD202/D-136
TOPO vector (Invitrogen). The recombinant plasmid pVL4 was transferred into E. coli DH10B 137
and sequenced on both strands for confirmation. The LexA A115D mutation was achieved via 138
site-directed mutagenesis as described above using the primer pair CMT-728/CMT-729 and 139
pVL4 as the template. The mutation was confirmed by sequencing. The plasmids designated 140
pVL4 (lexA in pBAD) and pVL5 (lexA A115D in pBAD) were then transferred into 141
electrocompetent E. coli LMG194 cells for induction by arabinose. 142
143
Production and purification of recombinant fusion proteins. Overnight E. coli 144
LMG194(pVL4) and E. coli LMG194(pVL5) cultures were diluted (1:100) into fresh LB 145
medium supplemented with kanamycin and grown aerobically at 37°C until and OD600 of 0.5 146
was reached. Arabinose was then added at a final concentration of 0.2% (wt/vol) to induce the 147
expression of recombinant fusion proteins and the incubation was continued for another 3 h at 148
37°C with agitation. Protein expression was verified by SDS-PAGE using the Laemmli buffer 149
system and the protein bands were visualized by staining with Coomassie brilliant blue. In 150
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
8
addition, the expression of recombinant proteins was confirmed with anti-His antibodies 151
(Sigma). The cells were collected by centrifugation, resuspended in 1 binding buffer 152
(Novagen), and disrupted on ice by sonication. The LexA-His6 and LexA A115D-His6 153
recombinant proteins were then purified by affinity chromatography on Ni2+
-nitrilotriacetic acid 154
(Ni-NTA) resin (Novagen) as described by the manufacturer. The Bradford protein assay was 155
used to determine the protein concentration of the purified samples. 156
157
Self-cleavage assay. Aliquots of purified recombinant LexA proteins (1 µg) were incubated 158
in 50 mM Tris-HCl buffer adjusted to pH values ranging from 6.0 to 10.0. LexA autodigestion 159
was performed at 37ºC for 16 h, and aliquots were stopped by adding SDS-PAGE loading buffer. 160
Samples were analyzed by SDS-PAGE using the buffer system of Laemmli at a constant voltage 161
(200 V) with gels containing 12% polyacrylamide in the separating gel and 4.5% polyacrylamide 162
in the stacking gel. The protein bands were visualized by staining with Coomassie brilliant blue. 163
164
Gene expression analysis following heat and DNA damage induction. Overnight cultures 165
of S. mutans strains were diluted (1:100) into fresh THYE broth and incubated at 37°C until an 166
OD600 of ~0.4 – 0.5 was reached. Cells were then exposed for 2 h at 37°C (except for heat shock) 167
to the following stresses: antibiotic stress (20 µg/ml of ofloxacin), DNA crosslinker (0.5 µg/ml 168
of mitomycin C), oxidative stress (0.5 mM of hydrogen peroxide), and heat shock (30 min at 169
50°C). Cells were processed with the Bio101 FastPrep System (Qbiogene) and total RNA was 170
extracted using TRIzol reagent (Invitrogen). Samples were DNase-treated with RQ1 DNAse 171
(Promega), and converted to cDNA using a RevertAid H Minus First-Strand cDNA Synthesis 172
Kit (Fermentas). Negative controls without reverse transcriptase were included in all 173
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
9
experiments. Real-time quantitative PCR (QPCR) analysis was performed using the SsoFast 174
EvaGreen Supermix (Bio-Rad) and the CFX96 real-time PCR detection system (Bio-Rad). 175
QPCR assays were performed in triplicate with RNA isolated from three independent 176
experiments. Statistical significance was determined by using a Student’s t-test with the 177
parametric P value cutoff set at < 0.01. 178
179
Persistence assays. Overnight cultures of S. mutans strains were diluted (1:20) into fresh 180
THYE broth containing 20 µg/ml of ofloxacin (DNA damage), 15 µg/ml of oxacillin (inhibition 181
of cell wall synthesis), 50 µg/ml of rifampicin (inhibition of transcription) or 20 µg/ml of 182
vancomycin (inhibition of cell wall synthesis), followed by incubation for 24 h at 37°C. For the 183
quorum-sensing peptide pheromone assays, diluted S. mutans cells were incubated with 2 µM 184
synthetic competence stimulating peptide (CSP; Advanced Protein Technology Centre, Hospital 185
for Sick Children, Toronto, Ontario, Canada) pheromone for 2 h at 37°C before exposed to the 186
stresses (18). Samples were withdrawn at the indicated times, serially diluted, and plated on 187
THYE agar plates. The colonies were counted after 48 h of incubation. All assays were 188
performed in triplicate from three independent cultures. The statistical significance was 189
determined by using a Student’s t-test and a P value of <0.01. 190
191
DNA microarrays. DNA microarrays were performed as previously described (25). Briefly, 192
S. mutans WT strain and ∆lexA mutant cells were grown with 2 µM CSP (CSP-induced) or 193
without (uninduced) to mid-log phase. Cells were then collected by centrifugation, resuspended 194
in ice-cold RNAwiz (Ambion), and disrupted using 0.1-mm zirconia beads. Total RNA was 195
extracted using the Ambion RiboPure-Bacteria kit according to the provided protocol. Isolated 196
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
10
RNA was treated twice with DNase I (Ambion) to remove traces of genomic DNA. After the 197
treatment, RNA samples were cleaned with the QIAGEN RNeasy MinElute cleanup kit. Aliquots 198
of the extracted total RNA were tested for quantity and quality. RNA concentration was 199
determined spectrophotometrically using the NaNodrop spectrophotometer and RNA integrity 200
was assessed by Agilent BioAnalyzer 6000 (ProkaryoteTotal RNA Nano assay). Inclusion 201
criteria considered total RNA with a ratio (A260/A280) ideally > 1.8 and absence of signs of RNA 202
degradation on the Agilent BioAnalyzer. 203
For cDNA synthesis, 15 µg of RNA was mixed with 1.25 µg of random primers and 204
incubated at 70°C for 10 min and then at 25°C for 10 min. The reverse transcription was 205
performed in 1 First Strand buffer supplemented with 10 mM dithiothreitol, 0.5 mM 206
deoxynucleoside triphosphate mix, 60 U of RNAseOut (Invitrogen), and 1,500 U of SuperScript 207
II reverse transcriptase (Invitrogen). The reaction mixture was incubated at 25°C for 10 min, 208
37°C for 1 h, 42°C for 1 h, and 70°C for 10 min. To remove residual RNA, the cDNA samples 209
were treated with 0.2 N NaOH at 65°C for 30 min and then neutralized with 0.2 N HCl before 210
being purified with the QIAGEN MinElute PCR purification kit. The cDNA was fragmented 211
using Roche DNase I (0.06 U per µg of cDNA) at 37°C for 10 min. Inactivation of the enzyme 212
was performed at 98°C for 10 min. Synthesized cDNA was quantified spectrophotometrically 213
and the integrity assessed by Agilent Bioanalyzer 6000. These processes were performed before 214
and after fragmentation. Fragmented samples represented by a smear of products falling between 215
50 and 200 bases were included and labelled with biotin-ddUTP using the BioArray terminal 216
labeling kit (Enzo). Microarrays were run using whole-genome custom GeneChips antisense 217
expression microarray previously designed in collaboration with Affymetrix (Santa Clara, CA) 218
(36). Hybridization, washing, and scanning of the microarray chips were performed at the 219
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
11
Princess Margaret Genomics Centre (Toronto, Ontario, Canada) using Affymetrix protocol. 220
Results were validated by QPCR. 221
222
DNA transformation assays. Overnight cultures of S. mutans WT strain and its deletion 223
mutants were diluted (1:20) with fresh THYE broth and incubated at 37°C until an OD600 of 0.1 224
was reached. To test the effect of CSP on genetic transformation (CSP-induced conditions), 225
synthetic CSP was added at a final concentration of 0.2 µM (26). Ten micrograms of UA159 226
genomic DNA containing the spectinomycin resistance marker inserted into the rgp locus of the 227
UA159 strain, as inactivation of this locus has no effect on cell viability and transformation 228
efficiency (25), was added to the cultures (0.5 ml aliquots), which were grown for a further 2.5 h 229
at 37°C before differential plating. The transformation efficiency was calculated as the 230
percentage of spectinomycin resistant transformants divided by the total number of recipient 231
cells, which was determined by the number of CFU on antibiotic-free THYE agar plates. All 232
assays were performed in triplicate from three independent experiments. 233
234
RESULTS 235
An Intact CSP-Dependent Competence Pathway is Necessary for CSP-Inducible Formation 236
of Persisters. In the oral cavity, bacteria are constantly challenged by a wide variety of stressful 237
environmental conditions. We previously demonstrated that particular stresses activated CSP 238
production (25) and cells responded to high levels of CSP by inducing the formation of multi-239
drug tolerant persisters (18). In pursuit of determining the mechanism by which the CSP-ComDE 240
pathway regulates the inducible formation of persisters, several components of the competence 241
regulon necessary for the development of genetic competence in S. mutans were investigated. 242
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
12
Individual knockout mutants in comE, cipB, comR, comS, and sigX genes were constructed and 243
tested for the CSP-inducible formation of persisters tolerant to ofloxacin. We used exogenously 244
added synthetic CSP to artificially mimic the high CSP concentrations induced by stress. Our 245
results showed that whereas the WT strain produced an increased number of persisters tolerant to 246
ofloxacin (~4-fold) in the presence of the CSP pheromone, the CSP-inducible persistence 247
phenotype was abolished for all mutants tested (Fig. 1). These results signified the importance of 248
an intact competence pathway initiating from CSP binding to the ComD membrane sensor to the 249
eventual activation of SigX, and suggests that putative persister genes are regulated by this 250
alternative sigma factor. 251
252
SMU.2027 gene induced by the quorum-sensing CSP pheromone possesses 253
characteristics of LexA-like transcriptional regulators. Work performed by some members of 254
our group showed that S. mutans employs its quorum-sensing CSP pheromone as a stress-255
inducible ‘alarmone’ to give an early warning signal of hostile conditions, and mount a specific 256
response to adapt and survive environmental assaults (reviewed in 37). SMU.2027 encoding a 257
putative LexA-like (or HdiR-like) regulator was found up-regulated ( 5-fold) under CSP 258
conditions used to mimic the high concentrations of CSP induced by stress (25). Although 259
SMU.2027 gene is induced by the CSP pheromone, it is unlikely that SigX directly regulates 260
SMU.2027 gene since no conserved CIN (competence-induced) box consensus sequence (23, 38) 261
has been found in its promoter region. A perfect inverted repeat (15 bp) was found in the 262
promoter region of SMU.2027 (Fig. S2) suggesting a putative binding site for autoregulatory 263
activity as observed in other LexA-like regulators (39). Bioinformatic analysis of S. mutans 264
SMU.2027 showed that it possesses the two conserved domains found in LexA-like regulators: i) 265
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
13
a helix-turn-helix motif involved in sequence-specific DNA binding; ii) a signal peptidase-like 266
serine peptidase domain. A multiple sequence alignment of S. mutans SMU.2027 with the amino 267
acid sequences of various LexA and HdiR regulators revealed that the Ala-Gly bond, which is 268
involved in RecA-dependent autocleavage, was conserved in all sequences aligned (Fig. 2). 269
Under heat and DNA damage conditions, LexA regulators are cleaved and derepress 270
expression of genes involved in DNA damage tolerance and repair, and lexA gene itself (i.e., it is 271
autoregulatory) (39). The expression of S. mutans SMU.2027 gene in response to heat and DNA 272
damage conditions was then investigated. Our results showed that treatment with ofloxacin 273
antibiotic and heat shock, two stresses known to initiate self-cleavage of LexA repressors (39, 274
40), led to activation of S. mutans SMU.2027 gene (Table 2). Oxidative stress was also 275
investigated since reactive oxygen species (ROS) are known to cause DNA damage via oxidation 276
of nucleotide bases. Our results showed that hydrogen peroxide stress resulted in an increase in 277
SMU.2027 gene expression (Table 2). Consequently, we can hypothesize that SMU.2027 278
(denoted as LexA hereafter) belongs to the LexA-like (or HdiR-like) family based on domain 279
organization, sequence similarity, and induction in response to heat and DNA damage 280
conditions. 281
282
LexA undergoes self-cleavage and requires the ClpP proteolytic subunit for its 283
autoregulation. To further characterize the S. mutans LexA regulator, we produced a 284
recombinant LexA protein by cloning the full-length coding region of SMU.2027 into the pBAD 285
expression system for induction of gene expression using araBAD promoter dose-dependent 286
regulation. Purified recombinant protein was then utilized for determining if LexA undergoes 287
self-cleavage in vitro at alkaline pH, a characteristic feature of LexA-like repressors (41). In vitro 288
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
14
cleavage requires RecA at neutral pH, but at alkaline pH, a spontaneous cleavage takes place. 289
This RecA-independent reaction is called autodigestion. As the purified recombinant LexA 290
protein was incubated in increasing pH, spontaneous self-cleavage occurred which resulted in 291
two cleavage products at pH ≥ 8.0 (Fig. 3A). A recombinant LexA regulator with a point 292
mutation at the conserved alanine residue at position 115 of the Ala-Gly bond to an asparatic 293
acid abolished the alkaline-induced self-cleavage (Fig. 3B). These results confirm that LexA is 294
capable of self-cleavage, specifically at the conserved A115 cleavage site. 295
After cleavage, the N-terminal domain of LexA-like repressors can remain bound to the DNA, 296
which can still repress gene expression (42). For this reason, the N-terminal cleavage products 297
are usually removed by Clp proteolytic complexes prior to derepression of target gene 298
expression. QPCR analysis of lexA gene was performed using WT strain and a mutant deficient 299
in the ClpP protease catalytic domain (ΔclpP). Results showed that derepression of lexA did not 300
occur in the ΔclpP mutant upon heat and DNA damage (Table 2). Together, these results suggest 301
that in S. mutans, Clp protease is required to degrade the N-terminal helix-turn-helix motif of 302
LexA that is predicted to remain bound to the DNA upon heat and DNA damage, similar to other 303
LexA-like repressors. 304
To confirm the role of S. mutans LexA in its autoregulation, we constructed a strain 305
expressing a mutated LexA protein unable to undergo autocleavage. A single-site mutation of 306
amino acid residue was introduced by PCR in the Ala-Gly bond of S. mutans LexA regulator. 307
The conserved alanine at position 115 was changed by aspartic acid (Fig. 2). The uncleavable 308
form of S. mutans lexA was then cloned under its own promoter into pIB107 vector (pVL6), and 309
integrated into the chromosome of an S. mutans ∆lexA mutant. The new mutant was designated 310
∆lexA::lexA A115D and was confirmed by PCR. The disruption of lexA gene had no effect upon 311
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
15
S. mutans cell growth under normal growth conditions (data not shown). Moreover, no 312
discernable growth difference was observed between WT strain, ∆lexA mutant, and ∆lexA::lexA 313
A115D mutant under unstressed conditions (data not shown). As expected, no up-regulation of 314
lexA gene was observed in the S. mutans ∆lexA::lexA A115D uncleavable strain tested under the 315
same stress conditions (Table 2). Our results indicate that induction of lexA gene expression by 316
heat and DNA-damage is controlled by LexA-cleavable-mediated derepression of lexA gene. 317
Altogether, these results confirm that SMU.2027 encodes for a LexA-like repressor. 318
319
S. mutans LexA regulates tolerance towards DNA damage through a mechanism that is 320
different to the SOS-like response pathway in streptococci. In order to test the role of LexA 321
regulator on tolerance to DNA damage, S. mutans cells were incubated in the presence of a lethal 322
concentration of the fluoroquinolone ofloxacin, a broad-spectrum antibiotic. Fluoroquinolones 323
induce DNA damage by preventing the ligation reactions of DNA gyrase and topoisomerase, 324
resulting in double strand breaks (43). Cell survival assays showed that ∆lexA(pIB184) had a 325
significant decrease (3.7-fold) in survival after 24 h compared with WT strain expressing the 326
empty plasmid (Table 3). A more severe reduction (22.9-fold) was observed with strain 327
∆lexA(pVL3) expressing the uncleavable form of LexA. Similar results were obtained with 328
mitomycin C, a potent DNA crosslinker. Cell survival towards antibiotic oxacillin exhibiting a 329
different mechanism of action remained unaffected suggesting that LexA does not affect 330
tolerance towards non-DNA damaging agents (Table 3). Together, these results further indicate 331
that S. mutans lexA gene encodes for a regulator involved in tolerance towards DNA damage. 332
In determining if the route by which LexA initiates a DNA damage tolerance response via an 333
SOS-like pathway, we examined the role of UmuC homolog in S. mutans. UmuC is a subunit of 334
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
16
the error-prone DNA polymerase V found in bacteria and is involved in bypassing DNA lesions 335
during DNA replication. In streptococci, this gene was found regulated by LexA-like repressors 336
in Streptococcus thermophilus (44) and Streptococcus uberis (45). In S. mutans UA159 strain, 337
SMU.403 encodes for an UmuC homolog exhibiting more than 85% amino acid sequence 338
similarity to UmuC of S. thermophilus and S. uberis. A strain disrupted in SMU.403 (∆umuC 339
mutant) was constructed in UA159 WT strain. The gene disruption had no effect upon cell 340
growth under normal growth conditions (data not shown). We then tested the effect of umuC 341
mutation on tolerance of S. mutans to DNA damage. Our results showed that in S. mutans, 342
UmuC homolog was dispensable in the tolerance and survival towards both ofloxacin 343
(concentrations varying between 2 µg/ml – 20 µg/ml) and mitomycin C (concentrations varying 344
between 0.18 µg/ml – 0.25 µg/ml). Furthermore, QPCR analysis showed that S. mutans umuC 345
gene was not differentially expressed in a ∆lexA mutant background (data not shown). We 346
conducted BLAST searches for homologous sequences using SMU.403 (umuC) as query 347
sequence. SMU.403 gene is highly conserved in all S. mutans strains, but SMU.403 sequence 348
does not share homology with any other sequences in S. mutans. Since knocking out SMU.403 349
failed to cause a change in the phenotype, our results suggest that other gene(s) can compensate 350
for the lost of SMU.403. Altogether, these results suggest that LexA regulates tolerance and 351
survival towards DNA damage through a mechanism that differs from the SOS-like response 352
pathway as described in S. thermophilus and S. uberis. 353
354
CSP-inducible formation of persisters in S. mutans is affected by the LexA pathway. 355
Persisters are dormant cells within an isogenic bacterial population that can tolerate lethal 356
concentrations of antibiotics (6, 46). The presence of dormant persisters has no effect on the MIC 357
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
17
of antibiotics, since persisters are not growing and lack antibiotic resistance mechanisms. The 358
results presented above showed that although cell survival is decreased in ∆lexA mutant and 359
∆lexA(pVL3) strain expressing the uncleavable form of LexA (Table 3), antibiotic sensitivity 360
remained the same as the MIC values of ofloxacin against the mutants were not different from 361
those for the WT strain (data not shown). Consequently, we hypothesized that LexA could 362
promote the formation of persister cells. Our previous work showed that environmental stresses 363
such as heat and DNA damage, induce the formation of persister cells (18) reinforcing our 364
hypothesis. Moreover, we demonstrated that S. mutans integrates its response to specific 365
environmental stresses with its quorum-sensing system, the CSP-ComDE regulatory circuit, by 366
positively influencing the persister levels (18). Given the above, we tested the direct impact of 367
S. mutans LexA in the CSP-inducible development of persisters. S. mutans WT strain and its 368
∆lexA mutant were pre-exposed to the quorum-sensing CSP pheromone before being treated with 369
different drugs for 24 h. As expected, our data showed that the CSP pheromone significantly 370
increased the numbers of persister cells tolerant to ofloxacin, oxacillin, rifampicin, and 371
vancomycin for WT strain (Fig. 4). Interestingly, the CSP-inducible persistence phenotype was 372
abolished in the ∆lexA mutant for all classes of antibiotics tested except vancomycin, suggesting 373
that the LexA pathway affects the formation of CSP-inducible persisters towards several 374
different classes of antibiotics, and not just towards antibiotics inducing DNA damage. 375
It is most likely that the CSP conditions induce SigX factor to upregulate genes involved in 376
DNA repair and recombination leading to formation of single-stranded DNA (ssDNA) 377
intermediates. Based on work done in E. coli, we can hypothesize that the highly expressed 378
RecA proteins (recA is a SigX-regulated gene in S. mutans and showed ~7-fold increase under 379
CSP conditions; (25)) probably bind towards any exposed ssDNA within the cell to form RecA 380
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
18
filaments, and this phenomenon is capable of serving as a SOS-inducing signal that leads to the 381
autocleavage of LexA and subsequent gene derepression (47). 382
383
The CSP-inducible LexA regulator is not necessary for the development of genetic 384
competence. It was recently shown that competence development and the “SOS pathway” in 385
S. thermophilus was antagonistic to one another (44). Since inactivation of lexA gene abolished 386
the formation of CSP-induced persister cells in S. mutans, whether competence is also hindered 387
was investigated. The transformation efficiency of the ∆lexA mutant was evaluated under CSP-388
induced and uninduced conditions. Our results showed that inactivation of lexA gene, and thus 389
constant activation of the LexA-regulated pathway, had no significant effect on transformation 390
efficiency under both conditions (Fig. 5). These results suggest that the S. mutans LexA pathway, 391
while preventing CSP-inducible formation of persisters, does not interfere with the development 392
of genetic competence. 393
394
Comparison of the gene expression profile between WT and ∆lexA mutant. To determine 395
the potential genes regulated by the LexA transcriptional regulator, transcriptional analysis of 396
both WT and its ∆lexA mutant were compared. RNA was extracted from cultures of both WT 397
and the deletion mutant grown to mid-exponential phase under unstressed conditions (see 398
Materials and Methods for microarray experiment details). The results from the microarray 399
identified scrA coding for enzyme II of the phosphoenolpyruvate-dependent sucrose 400
phosphotransferase system (48), as the only gene differentially regulated (3-fold reduction in the 401
∆lexA mutant). Confirming our earlier results, the transcriptome analyses showed that the genes 402
involved in DNA repair and recombination, including umuC, did not appear to be differentially 403
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
19
expressed when LexA is inactivated (Table S2). These results confirmed that LexA regulates 404
tolerance towards DNA damage in a manner different from the classical SOS response. 405
406
Genome-wide expression response to CSP in the absence of LexA. Since our results 407
demonstrated that the CSP-inducible formation of persisters was affected by the LexA pathway, 408
we performed a comparison of the gene expression profiles between WT strain and its ∆lexA 409
mutant in the presence of the CSP pheromone (see Materials and Methods for microarray 410
experiment details). Our results showed that LexA regulated 11 genes (Table 4). Four genes were 411
selected for further analysis. Individual deletion mutants were constructed in the WT strain, and 412
each mutant was tested for its ability to produce CSP-induced persister cells. SMU.63 and 413
SMU.1402, two genes known to be differentially regulated under CSP conditions (25) were first 414
tested. SMU.1402 encodes for a CRISPR-associated Csn2 protein belonging to the CRISPR-1 415
region of S. mutans (49). CRISPR arrays with CRISPR-associated proteins are involved in 416
resistance to bacteriophage and resistance specificity is determined by the insertion of CRISPR 417
spacer-phage sequence similarity (50). Interestingly, inactivation of csn2 gene in S. mutans 418
completely abolished the increase in persister numbers observed for the WT strain following 419
pretreatment with CSP (Fig. 6). S. mutans Csn2 protein showed high similarity (81%; 154/187 420
aa) with Csn2 protein from S. thermophilus. In S. thermophilus, CRISPR systems provide 421
resistance against phages, and Csn2 protein is involved in spacer integration (50, 51). In 422
S. mutans, work previously done by van der Ploeg using strain OMZ 381, one of a few strains 423
sensitive to M102 phage attacking S. mutans, showed that deletion of CRISPR-1 region is 424
insufficient to render sensitivity to infection by the phage M102 (49). Natural phage resistance 425
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
20
mechanisms in S. mutans have not been previously described mainly because phages and 426
sensitive strains are actually quite rare in S. mutans (52). 427
SMU.63 gene encodes for a conserved membrane protein of 613 amino acid residues of 428
unknown function. This gene is located immediately downstream the comRS locus involved in 429
CSP-inducible persister formation (Fig. 1) and genetic competence (27, 53). Our results showed 430
that ∆63 mutant was still able to increase the number of ofloxacin-tolerant persister cells 431
following treatment with the CSP pheromone (Fig. 6). Moreover, inactivation of SMU.63 did not 432
alter the number of persisters under no CSP conditions (Fig. S1) suggesting that SMU.63 is not 433
involved in the formation of persister cells. 434
SMU.984 gene encodes for a protein of 166 amino acid residues with no known function. The 435
protein possesses a C-terminal CHAP (cysteine- and histidine-dependent 436
aminohydrolase/peptidase) domain that functions in peptidoglycan hydrolysis. Pre-stressing cells 437
with the CSP pheromone followed by ofloxacin treatment revealed that a lack of SMU.984 438
abolished the CSP-inducible persistence phenotype (Fig. 6). Global transcriptome analysis 439
performed by Senadheera and coll. showed that SMU.984 gene was regulated by the two-440
component system VicRK (D. Senadheera, personal communication). In S. mutans, the VicRK 441
system modulates stress tolerance by direct modulation of the CSP pheromone (54). Altogether 442
these results suggest that SMU.984 could be involved in stress tolerance by modulating the CSP-443
inducible persistence phenotype. 444
The scrA gene (SMU.1841) is part of the scr regulon composed of the three genes – scrA, 445
scrB, and scrR – coding for a sucrose-specific IIABC phosphoenolpyruvate:carbohydrate 446
phosphate transferase system (PTS) component, a sucrose-6-phosphate hydrolase, and a sucrose 447
operon repressor, respectively (55). The scrA gene was found down-regulated in both 448
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
21
transcriptome profile comparisons (CSP-induced and uninduced). The ∆scrA mutant was unable 449
to increase the number of ofloxacin-tolerant persister cells following treatment with the CSP 450
pheromone (Fig. 6). Moreover, a ∆scrA mutant had an approximately 4-fold decrease in persister 451
level after 24-h of ofloxacin treatment under no CSP condition (Fig. S1) suggesting that ScrA 452
also participates in the formation of persisters through quorum-sensing-independent 453
mechanism(s). 454
Using the online RSAT bioinformatic tool (http://rsat.ccb.sickkids.ca), we searched the 455
promoter region of SMU.984, SMU.1402 (csn2), and SMU.1841 (scrA) with the IR identified in 456
the promoter region of lexA (Fig. S2). No IR sequences were found, suggesting that these 457
persister genes are most probably indirectly regulated by LexA. 458
459
DISCUSSION 460
In this study, we have identified and characterized a LexA transcriptional regulator in S. mutans. 461
This LexA ortholog has many of the notable hallmarks of a typical LexA regulator such as auto-462
regulatory expression upon heat shock and DNA damage, and a conserved Ala-Gly self-cleavage 463
site. The observed full auto-regulatory expression is contingent on a functional ClpP subunit, 464
which is most likely required for the degradation of the N-terminal DNA binding domain after 465
LexA autocleavage to allow complete derepression of its own gene expression. Furthermore, the 466
S. mutans LexA regulator plays a role in a DNA damage response with regulating the formation 467
of persisters tolerant towards DNA damaging agents such as mitomycin C and fluoroquinolones. 468
Indeed, a ΔlexA(pVL3) strain overexpressing the mutated and uncleavable LexA A115D protein 469
showed a significant decreased survival towards ofloxacin and mitomycin C. However, the 470
LexA-regulated pathway in S. mutans differs greatly from the canonical SOS response seen in 471
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
22
other bacteria, and even from other streptococcal species that have been identified with an SOS-472
like pathway via the LexA-like HdiR regulator. In S. thermophilus and S. uberis, HdiR functions 473
similarily as LexA in regulating an SOS-like response by directly upregulating the expression of 474
umuC upon DNA damage to bypass DNA lesions during DNA replication (44, 45). However, 475
umuC gene along with other genes with known or putative roles in DNA repair were not found 476
regulated by LexA in S. mutans (Table S2). In fact, a ΔumuC mutant did not affect tolerance and 477
survival towards DNA damage. 478
Most interestingly, S. mutans LexA was also identified in playing a significant role in the 479
formation of quorum-sensing-induced multidrug-tolerant persisters, in addition to its role in 480
forming persisters tolerant towards DNA-damaging agents. A lack of LexA completely abolished 481
the formation of CSP-induced persisters tolerant to multiple antibiotics suggesting that LexA 482
influences the deterministic formation of persisters mediated by the stress inducible alarmone. It 483
is interesting that a lack of LexA does not greatly affect survival and tolerance towards oxacillin 484
antibiotic, while under CSP conditions the lack of the LexA regulator prevents CSP-inducible 485
persistence. This suggests that there are at least two mechanisms regulated by LexA by which 486
S. mutans can respond to and tolerate DNA-damaging stress. One mechanism occurs under 487
normal growth, where LexA functions to provide an immediate response for tolerating DNA 488
damage conditions. The other mechanism occurs through activation of the CSP-ComDE quorum-489
sensing pathway most like responding to various environmental stressors. In this case, activation 490
of LexA regulator indirectly alters the expression profile of a group of genes that are required for 491
the formation of CSP-induced persisters tolerant not only to DNA damage but also to several 492
classes of antibiotics. 493
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
23
In S. thermophilus, it was recently shown that the HdiR pathway functioned antagonistically 494
towards its own competence development (44). Activation of the SOS-like response via HdiR led 495
to the downregulation of competence genes and to the decrease in transformation efficiency, 496
whilst a SigX-deficient strain had an increased survivability towards both mitomycin C and 497
norfloxacin. Our results showed that the continuous activation of the LexA pathway in a LexA 498
deficient mutant acts negatively towards CSP-induced persisters, where the formation requires 499
the intact competence pathway from ComE to SigX. This may suggest that competence is also 500
negatively impacted in S. mutans, but this was not the case as we observed that the 501
transformation efficiency (Fig. 5) and the expression of competence genes (data not shown) were 502
not affected in a ∆lexA mutant treated with or without exogenous CSP. This difference is most 503
likely due to differing mechanism(s) and genes regulated by LexA in S. mutans as compared to 504
those regulated by HdiR in S. thermophilus. 505
Our transcriptomic analyses identified a number of genes with various cellular roles that 506
appear to contribute towards the formation of CSP-induced persisters. A few of these identified 507
genes are involved with metabolism, specifically amino acid biosynthesis. Although we did not 508
test individual knockout mutants for SMU.563 encoding the ornithine carbamoyltransferase 509
enzyme involved in arginine biosynthesis or the genes SMU.663 to SMU.666 belonging to the 510
glutamate family amino acid synthesis operon, it is likely that affecting amino acid biosynthesis 511
would greatly influence persister formation, as it has been recently shown in E. coli through the 512
use of a transposon library (56). 513
Our study led us to identify new genes involved in the formation of quorum-sensing-induced 514
persisters. These genes are most likely indirectly regulated through LexA. They include 515
SMU.984 encoding a hypothetical CHAP-containing protein. CHAP domains are typically 516
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
24
associated with lytic proteins such as autolysins involved in peptidoglycan hydrolysis (57). Our 517
group had previously identified and characterized LytF-Sm, a SigX-regulated autolysin involved 518
in cell death induced by the CSP pheromone (58). Preliminary work done in our lab showed that 519
SMU.984 encodes a functional murein hydrolase but is not involved in the CSP-induced cell 520
death pathway. As similarities goes, SMU.984 may be a lytic protein that potentially functions 521
with reduced efficiency or potency in altering the cell wall integrity, leading to CSP-inducible 522
persister formation. 523
The CRISPR-associated csn2 gene was found to be important in the CSP-inducible 524
persistence phenotype. To the best of our knowledge, it is the first time a link is proposed 525
between a CRISPR-associated protein and persister formation. The CRISPR system is not well 526
characterized in S. mutans, and csn2 gene is only found in the type II-A systems. The Csn2 527
protein was recently characterized as forming a ring-shaped tetramer complex that binds to 528
double-strand DNA ends with the proposed function of assisting in the integration of new spacer 529
DNA fragments by stabilizing the DNA ends together, and as a potential accessory protein 530
recruiting DNA-repair proteins (59). Perhaps increased csn2 gene expression contributes to 531
ofloxacin tolerance by recruiting DNA repair proteins at the post-transcriptional level not 532
detected in our microarrays. How exactly Csn2 protein plays a role in the formation of CSP-533
induced persisters remains to be determined. 534
The scrA gene, encoding a PTS sucrose specific component, was the only gene found to be 535
significantly differentially regulated in a ∆lexA mutant cultivated under both CSP-induced and 536
non-induced conditions. The role of carbohydrate metabolism has been previously associated to 537
the formation of persisters (60, 61). Based on our results, we can hypothesize that a lack of LexA 538
derepresses gene(s) involved in the downregulation of scrA gene contributing to the reduced 539
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
25
persister levels. Interestingly, inactivation of scrA gene led to decrease persister formation under 540
both CSP-induced and non-induced conditions, suggesting that scrA is involved in the formation 541
of persisters governed by both stochastic and deterministic mechanisms. ScrA is a sucrose 542
permease that is heavily involved in sucrose uptake. However, there are other systems that 543
contribute to uptake and/or catabolism of sucrose in S. mutans, specifically the 544
glucosyltransferases (GtfB, GtfC, GtfD), the fructosyltransferase (Ftf), and the multiple-sugar-545
metabolism pathway (62). This would likely eliminate the notion of sucrose metabolism being 546
the mechanism by which scrA contributes to persister formation. Additionally, our persistence 547
assays were performed in a nutrient-rich complex medium that contains glucose as the major 548
carbohydrate source. Interestingly, we have previously identified from an overexpression 549
genomic library that deletion of the sucrose operon repressor ScrR, which normally represses the 550
expression of scrA and scrB genes in S. mutans, led to ~10-fold increase in persister formation 551
(18) suggesting that a derepression of scrA may lead to an increase of persister formation. These 552
results also suggest that there are multiples layers of regulation on scrA. Regulation of scrA 553
could also occur from the IGR1445 intergenic region corresponding to the scrA/scrB promoter 554
region. Unfortunately efforts in identifying a regulatory anti-sense RNA in this intergenic region 555
have been unsuccessful thus far. 556
It is important to note that significantly upregulated genes were expected to be detected in 557
our comparative microarray analysis. Detection of up-regulated genes would signify that these 558
genes are most likely directly regulated by the LexA regulator in S. mutans. In contrast, all 559
significantly differentially regulated genes were downregulated. Our results suggest two possible 560
mechanisms by which LexA contributes to the persister phenotype in S. mutans. In the first 561
model, LexA acts as a transcriptional activator following its autocleavage. Under these 562
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
26
conditions, deletion of lexA gene would cause downregulation of genes, and the loss of the CSP-563
inducible persistence phenotype. However, this would suggest that LexA regulator in S. mutans 564
possesses a different transcriptional function following its autocleavage, which would be in stark 565
contrast to the well-characterized LexA family of transcriptional regulators described in other 566
bacteria. In the second scenario, LexA acts as a repressor inhibiting another repressor of persister 567
genes, where LexA autocleavage leads to the indirect repression of these genes. The fact that the 568
identified IR located in the promoter region of S. mutans lexA gene was not found upstream the 569
downregulated genes identified in our arrays strongly supports this model. 570
It is also possible that upregulated genes were not detected because the binding affinity of 571
LexA towards the promoter regions of potential LexA-regulated genes is heterogeneous 572
depending on the strength and conservation of the consensus LexA-box motif, their relative 573
location in the target promoter, and even the promoter strength of the target gene itself, as it has 574
been well characterized in E. coli (63). This variation in LexA-binding results in a difference in 575
the expression level, timing and duration for different LexA-regulated genes. Some SOS-576
regulated genes in E. coli have low promoter activity in the absence of DNA-damaging agents 577
(64). Furthermore, genomic analyses in E. coli have shown that LexA is capable of binding and 578
regulating genes that do not contain a canonical LexA-box motif in their promoter regions (65). 579
All these factors make it challenging to identify genes that are directly regulated by LexA. 580
Moreover, it is possible that LexA-regulated genes are non-protein encoding regulatory RNAs 581
that would not be detected in our microarrays. In this case, transcriptome analyses using RNAseq 582
of S. mutans in the presence of DNA-damaging agents would need to be performed. 583
The results of this study presents two roles by which the LexA transcriptional regulator 584
partakes in regulating bacterial survival towards antibiotic challenge in S. mutans. One pathway 585
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
27
involves DNA-damaging agents initiating LexA self-cleavage that indirectly leads to tolerance 586
through the regulation of scrA. The second pathway involves the stress-inducible CSP alarmone 587
that activates the competence regulon. Our results suggest that lexA gene is part of the sigX 588
regulon acting as a general stress response in streptococci. Once activated, the lexA pathway 589
leads to the expression of a group of genes including csn2, scrA, and SMU.984 that collectively 590
contribute to the stress-inducible multidrug-tolerant persister state. Although CSP-inducible 591
persister genes have been identified, their exact roles are unknown. Further experiments would 592
need to be performed to elucidate the exact mechanisms by which each identified gene 593
contributes towards persister formation. Nonetheless, disrupting the inducible persister pathway 594
at any point between the components of the bacterial quorum-sensing system to the effector 595
genes to prevent stress-inducible persister formation could lead to innovative drug designs and 596
strategies. 597
598
ACKNOWLEDGMENTS 599
We thank Delphine Dufour for careful reading of the manuscript. We thank Indranil Biswas for 600
the pIB107 and pIB184 plasmids. This study was supported by a Canadian Institutes of Health 601
Research (CIHR) grant MOP-93555 to C.M.L. and a Natural Sciences and Engineering Research 602
Council of Canada (NSERC) grant RGPIN 355968 to C.M.L. C.M.L. is a recipient of a Canada 603
Research Chair. 604
605
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
28
REFERENCES 606
1. Alekshun MN, Levy SB. 2007. Molecular mechanisms of antibacterial resistance. Cell 607
128:1037–1050. 608
2. Levin BR, Rozen DE. 2006. Non-inherited antibiotic resistance. Nat. Rev. Microbiol. 609
4:556–562. 610
3. Wiuff C, Zappala RM, Regoes RR, Garner KN, Baquero F, Levin BR. 2005. 611
Phenotypic tolerance: antibiotic enrichment of noninherited resistance in bacterial 612
populations. Antimicrob. Agents Chemother. 49:1483–1494. 613
4. Dufour D, Leung V, Lévesque CM. 2012. Bacterial biofilm: structure, function, and 614
antimicrobial resistance. Endo. Topics 22:2–16. 615
5. Lewis K. 2008. Multidrug tolerance of biofilms and persister cells. Curr. Top. Microbiol. 616
Immunol. 322:107–131. 617
6. Lewis K. 2010. Persister cells. Annu. Rev. Microbiol. 64:357–372. 618
7. Lewis K. 2012. Persister cells: molecular mechanisms related to antibiotic tolerance. 619
Handb. Exp. Pharmacol. 211:121–33. 620
8. Jayaraman R. 2008. Bacterial persistence: some new insights into an old phenomenon. 621
J. Biosci. 33:795–805. 622
9. Veening JW, Smits WK, Kuipers OP. 2008. Bistability, epigenetics, and bet-hedging in 623
bacteria. Annu. Rev. Microbiol. 62:193–201. 624
10. Yamaguchi Y, Park JH, Inouye M. 2011. Toxin-antitoxin systems in bacteria and archae. 625
Annu. Rev. Genet. 45:61–79. 626
11. Gerdes K, Maisonneuve E. 2012. Bacterial persistence and toxin-antitoxin loci. Annu. 627
Rev. Microbiol. 66:103–123. 628
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
29
12. Schuster CF, Bertram R. 2013. Toxin-antitoxin systems are ubiquitous and versatile 629
modulators of prokaryotic fate. FEMS Microbiol. Lett. 340:73–85. 630
13. Van Melderen L, Saavedra de Bast M. 2009. Bacterial toxin-antitoxin systems: more than 631
selfish entities? PLoS Genet. 5:e1000437. 632
14. Kint CI, Verstraeten N, Fauvart M, Michiels J. 2012. New-found fundamentals of 633
bacterial persistence. Trends Microbiol. 20:577–585. 634
15. Maisonneuve E, Shakespeare LJ, Jorgensen MG, Gerdes K. 2011. Bacterial persistence 635
by RNA endonucleases. Proc. Natl. Acad. Sci. U S A 108:13206–13211. 636
16. Dörr T, Vulić M, Lewis K. 2010. Ciprofloxacin causes persister formation by inducing the 637
TisB toxin in Escherichia coli. PLoS Biol. 8:e1000317. 638
17. Vega NM, Allison KR, Khalil AS, Collins JJ. 2012. Signaling-mediated bacterial persister 639
formation. Nat. Chem. Biol. 8:431–433. 640
18. Leung V, Lévesque CM. 2012. A stress-inducible quorum-sensing peptide mediates the 641
formation of persister cells with noninherited multidrug tolerance. J. Bacteriol. 194:2265–642
2274. 643
19. Loesche WJ. 1986. Role of Streptococcus mutans in tooth decay. Microbiol. Rev. 50:353–644
380. 645
20. Marsh PD. 2006. Dental plaque as a biofilm and a microbial community: implications for 646
health and disease. BMC Oral Health 6:S14. 647
21. Lemos JA, Burne RA. 2008. A model of efficiency: stress tolerance by 648
Streptococcus mutans. Microbiology 154:3247–3255. 649
22. Smith EG, Spatafora GA. 2012. Gene regulation in S. mutans: complex control in a 650
complex environment. J. Dent. Res. 91:133–141. 651
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
30
23. Oggioni MR, Morrison DA. 2008. Cooperative regulation of competence development in 652
Streptococcus pneumoniae: cell-to-cell signaling via a peptide pheromone and an alternative 653
sigma factor, p. 345–362. In S. C. Winans and B. L. Bassler (ed.), Chemical communication 654
among bacteria. ASM Press, Washington DC. 655
24. Kreth J, Merritt J, Shi W, Qi F. 2005. Co-ordinated bacteriocin production and 656
competence development: a possible mechanism for taking up DNA from neighbouring 657
species. Mol. Microbiol. 57:392–404. 658
25. Perry JA, Jones MB, Peterson SN, Cvitkovich DG, Lévesque CM. 2009. Peptide 659
alarmone signalling triggers an auto-active bacteriocin necessary for genetic competence. 660
Mol. Microbiol. 72:905–917. 661
26. Dufour D, Cordova M, Cvitkovitch DG, Levesque CM. 2011. Regulation of the 662
competence pathway as a novel role associated with a streptococcal bacteriocin. J. Bacteriol. 663
193:6552–6559. 664
27. Mashburn-Warren L, Morrison DA, Federle MJ. 2010. A novel double-tryptophan 665
peptide pheromone controls competence in Streptococcus spp. via an Rgg regulator. Mol. 666
Microbiol. 78:589–606. 667
28. Fontaine L, Goffin P, Dubout H, Delplace B, Baulard A, Lecat-Guillet N, Chambellon 668
E, Gardan P, Hols P. 2013. Mechanism of competence activation by the ComRS signalling 669
system in streptococci. Mol. Microbiol. 87:1113–1132. 670
29. Miller RA, Britigan BE. 1997. Role of oxidants in microbial pathophysiology. Clin. 671
Microbiol. Rev. 10:1–18. 672
30. Cooke MS, Evans MD, Dizdaroglu M, Lunec J. 2003. Oxidative DNA damage: 673
mechanisms, mutation, and disease. FASEB J. 17:1195–1214. 674
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
31
31. Gonzalez K, Faustoferri RC, Quivey Jr RG. 2012. Role of DNA base excision repair in 675
the mutability and virulence of Streptococcus mutans. Mol. Microbiol. 85:361–377. 676
32. Claverys JP, Prudhomme M, Martin B. 2006. Induction of competence regulon as a 677
general response to stress in Gram-positive bacteria. Annu. Rev. Microbiol. 60:451–475. 678
33. Lau PC, Sung CK, Lee JH, Morrison DA, Cvitkovitch DG. 2002. PCR ligation 679
mutagenesis in transformable streptococci: application and efficiency. J. Microbiol. 680
Methods. 49:193–205. 681
34. Suntharalingam P, Senadheera MD, Mair RW, Lévesque CM, Cvitkovitch DG. 2009. 682
The LiaFSR system regulates the cell envelope stress response in Streptococcus mutans. 683
J. Bacteriol. 191:2973–2984. 684
35. Biswas I, Jha JK, Fromm N. 2008. Shuttle expression plasmids for genetic studies in 685
Streptococcus mutans. Microbiology 154:2275–2282. 686
36. Ajdić D, Pham VT. 2007. Global transcriptional analysis of Streptococcus mutans sugar 687
transporters using microarrays. J. Bacteriol. 189:5049–5059. 688
37. Dufour D, Lévesque CM. 2013. Bacterial behaviors associated with the quorum-sensing 689
peptide pheromone (‘alarmone’) in streptococci. Future Microbiol. 8:593–605. 690
38. Lee MS, Morrison DA. 1999. Identification of a new regulator in 691
Streptococcus pneumoniae linking quorum sensing to competence for genetic 692
transformation. J. Bacteriol. 181:5004–5016. 693
39. van der Veen S, Hain T, Wonters JA, Hossain H, de Vos WM, Abee T, Chakraborty T, 694
Wells-Bennik MH. 2007. The heat-shock response of Listeria monocytogenes comprises 695
genes involved in heat shock, cell division, cell wall synthesis, and the SOS response. 696
Microbiology 153:3593–3607. 697
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
32
40. Savijoki K, Ingmer H, Frees D, Vogensen FK, Palva A, Varmanen P. 2003. Heat and 698
DNA damage induction of the LexA-like regulator HdiR from Lactococcus lactis is 699
mediated by RecA and ClpP. Mol. Microbiol. 50:609–621. 700
41. Little JW. 1984. Autodigestion of lexA and phage lambda repressors. Proc. Natl. Acad. Sci. 701
U S A 81:1375–1379. 702
42. Neher SB, Flynn JM, Sauer RT, Baker TA. 2003. Latent ClpX-recognition signals ensure 703
LexA destruction after DNA damage. Genes Dev. 17:1084–1089. 704
43. Drlica K, Zhao X. 1997. DNA gyrase, topoisomerase IV, and the 4-quinolones. Microbiol. 705
Mol. Biol. Rev. 61:377–392. 706
44. Boutry C, Delplace B, Clippe A, Fontaine L, Hols P. 2013. SOS response activation and 707
competence development are antagonistic mechanisms in Streptococcus thermophilus. 708
J. Bacteriol. 195:696–707. 709
45. Varhimo E, Savijoki K, Jalava J, Kuipers OP, Varmanen P. 2007. Identification of a 710
noval streptococcal gene cassette mediating SOS mutagenesis in Streptococcus uberis. 711
J. Bacteriol. 189:5210–5222. 712
46. Wood TK, Knabel SJ, Kwan BW. 2013. Bacterial persister cell formation and dormancy. 713
Appl. Environ. Microbiol. 79:7116–7121. 714
47. Kuzminov A. 1999. Recombinational repair of DNA damage in Escherichia coli and 715
bacteriophage lambda. Microbiol. Mol. Biol. Rev. 63:751–813. 716
48. Sato Y, Poy F, Jacobson GR, Kuramitsu HK. 1989. Characterization and sequence 717
analysis of the scrA gene encoding enzyme IIScr
of the Streptococcus mutans 718
phosphoenolpyruvate-dependent sucrose phosphotransferase system. J. Bacteriol. 171:263–719
271. 720
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
33
49. van der Ploeg JR. 2009. Analysis of CRISPR in Streptococcus mutans suggests frequent 721
occurrence of acquired immunity against infection by M102-like bacteriophages. 722
Microbiology 155:1966–1976. 723
50. Barrangou R, Fremaux C, Deveau H, Richards M, Boyaval P, Moineau S, Romero DA, 724
Horvath P. 2007. CRISPR provides acquired resistance against viruses in prokaryotes. 725
Science 315:1709–1712. 726
51. Deveau H, Barrangou R, Garneau JE, Labonte J, Fremaux C, Boyaval P, Romero DA, 727
Horvath P, Moineau S. 2008. Phage response to CRISPR-encoded resistance in 728
Streptococcus thermophilus. J. Bacteriol. 190:1390–1400. 729
52. Maruyama F, Kobata M, Kurokawa K, Nishida K, Sakurai A, Nakano K, Nomura R, 730
Kawabata S, Ooshima T, Nakai K, Hattori M, Hamada S, Nakagawa I. 2009. 731
Comparative genomic analyses of Streptococcus mutans provide insight into chromosomal 732
shuffling and species-specific content. BMC Genomics. 10:358. 733
53. Fontaine L, Goffin P, Dubout H, Delplace B, Baulard A, Lecat-Guillet N, Chambellon 734
E, Gardan P, Hols P. 2013. Mechanism of competence activation by the ComRS signalling 735
system in streptococci. Mol. Microbiol. 87:1113–1132. 736
54. Senadheera DB, Cordova M, Ayala EA, Chávez de Paz LE, Singh K, Downey JS, 737
Svensäter G, Goodman SD, Cvitkovitch DG. 2012. Regulation of bacteriocin production 738
and cell death by the VicRK signaling system in Streptococcus mutans. J. Bacteriol. 739
194:1307–1316. 740
55. Wang B, Kuramitsu HK. 2003. Control of enzyme IIscr
and sucrose-6-phosphate hydrolase 741
activities in Streptococcus mutans by transcriptional repressor ScrR binding to the cis-active 742
determinants of the scr regulon. J. Bacteriol. 185:5791–5799. 743
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
34
56. Bernier SP, Lebeaux D, DeFrancesco AS, Valomon A, Soubigou G, Coppee JY, Ghigo 744
JM, Beloin C. 2013. Starvation, together with the SOS response, mediates high biofilm-745
specific tolerance to the fluoroquinolone ofloxacin. PLoS Genet. 9:e1003144. 746
57. Vollmer W, Joris B, Charlier P, Foster S. 2008. Bacterial peptidoglycan (murein) 747
hydrolases. FEMS Microbiol. Rev. 32:259–286. 748
58. Dufour D, Lévesque CM. 2013. Cell death of Streptococcus mutans induced by quorum-749
sensing peptide occurs via a conserved streptococcal autolysin. J. Bacteriol. 195:105–114. 750
59. Arslan Z, Wurm R, Brener O, Ellinger P, Nagel-Steger L, Oesterhelt F, Schmitt L, 751
Willbold D, Wagner R, Gohlke H, Smits SH, Pul U. 2013. Double-strand DNA end-752
binding and sliding of the toroidal CRISPR-associated protein Csn2. Nucleic Acids Res. 753
41:6347–6359. 754
60. Spoering AL, Vulic M, Lewis K. 2006. GlpD and PlsB participate in persister cell 755
formation in Escherichia coli. J. Bacteriol. 188:5136–5144. 756
61. Girgis HS, Harris K, Tavazoie S. 2012. Large mutational target size for rapid emergence 757
of bacterial persistence. Proc. Natl. Acad. Sci. U S A 109:12740–12745. 758
62. Zeng L, Choi SC, Danko CG, Siepel A, Stanhope MJ, and Burne RA. 2013. Gene 759
regulation by CcpA and catabolite repression explored by RNA-Seq in 760
Streptococcus mutans. PLoS ONE 8:e60465. 761
63. Butala M, Zgur-Bertok, Busby SJW. 2009. The bacterial LexA transcriptional repressor. 762
Cell Mol. Life Sci. 66:82–93. 763
64. Kamensek S, Podlesek Z, Gillor O, and Zgur-Bertok D. 2010. Genes regulated by the 764
Escherichia coli SOS repressor LexA exhibit heterogenous expression. BMC Microbiol. 765
10:283. 766
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
35
65. Wade JT, Reppas NB, Church GM, and Struhl K. 2005. Genomic analysis of LexA 767
binding reveals the permissive nature of the Escherichia coli genome and identifies 768
unconventional target sites. Genes Dev. 19:2619–2630. 769
770
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
36
FIGURE LEGENDS 771
FIG. 1. Role of essential competence genes in the formation of CSP-induced persister cells. 772
Overnight cultures of S. mutans WT strain and its ∆comD, ∆comE, ∆cipB, ∆comR, ∆comS, and 773
∆sigX mutants were diluted (1:100) into fresh THYE broth in the absence (no CSP) or presence 774
of CSP pheromone, and incubated at 37º for 2 h before being challenged with ofloxacin. Aliquots 775
of cells were removed at the introduction of the antibiotic and after the antibiotic treatment (24 h) 776
to determine cell survival by spot plating onto THYE agar plates. Results are expressed as the 777
log-fold change in cell survival normalized to non CSP pre-stress. The data are the averages and 778
standard errors of results from three independent cultures. 779
780
FIG. 2. Primary structures of LexA-like regulators. Multi-sequence alignment of amino acid 781
sequences of S. mutans SMU.2027 with LexA and HdiR of E. coli, Lactococcus lactis, 782
Staphylococcus aureus, Streptococcus uberis, Rhodobacter sphaeroides, and 783
Bifidobacterium longum. The helix-turn-helix motif is shown as a grey box at the N-terminal end 784
of SMU.2027. The C-terminal serine-peptidase domain (white box) is also shown. *Denotes 785
conserved amino acid residues involved in LexA autocleavage. The amino acid mutated in the 786
present study is in bold and underlined. 787
788
FIG. 3. LexA self-cleavage. LexA (A) and LexA A115D (B) recombinant proteins were 789
incubated in Tris-HCl buffer at pH values varying from 6.0 to 10.0. Autocleavage assay was 790
visualized on SDS-PAGE stained with Coomassie brilliant blue. Sizes in kilodaltons (kDa) of 791
Precision Plus Protein Dual Color Standards (Bio-Rad) are on the left. The arrows on the right 792
indicate the positions of breakdown products of LexA. 793
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
37
FIG. 4. Effects of S. mutans LexA on the development of CSP-induced persister cells. 794
Overnight cultures of S. mutans WT strain and its ∆lexA mutant were diluted (1:100) into fresh 795
THYE broth in the absence or presence of CSP pheromone, and incubated at 37ºC for 2 h before 796
being challenged with ofloxacin, oxacillin, rifampicin, or vancomycin. Aliquots of cells were 797
removed at the introduction of the antibiotic and after the antibiotic treatment (24 h) to determine 798
cell survival by spot plating onto THYE agar plates. Results are expressed as the log-fold change 799
in cell survival normalized to non CSP pre-stress. The data are the averages and standard errors 800
of results from three independent cultures. 801
802
FIG. 5. Effect of inactivation of lexA gene on the development of genetic competence. 803
Overnight cultures of WT strain and its ∆lexA mutant were diluted (1:20) in fresh THYE broth 804
and grown until an OD600 of 0.1 was reached. Aliquoted cultures were cultivated in the absence 805
(no CSP) and presence of CSP, and 20 µg/ml of UA159 genomic DNA carrying the kanamycin 806
resistance marker. Cells were incubated at 37ºC for 2.5 h before differential plating. The 807
transformation efficiency (TE) was expressed as the percentage of kanamycin resistant 808
transformants divided by the total number of recipient cells. The data are the averages and 809
standard errors of results from three independent cultures. 810
811
FIG. 6. Role of selected LexA-regulated genes on the formation of CSP-induced persister 812
cells. Overnight cultures of S. mutans WT strain and its ∆63, ∆csn2, ∆scrA, and ∆984 mutants 813
were diluted (1:100) into fresh THYE broth in the absence or presence of CSP pheromone, and 814
incubated at 37º for 2 h before being challenged with ofloxacin. Aliquots of cells were removed 815
at the introduction of the antibiotic and after the antibiotic treatment (24 h) to determine cell 816
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
38
survival by spot plating onto THYE agar plates. Results are expressed as the log-fold change in 817
cell survival normalized to non CSP pre-stress. The data are the averages and standard errors of 818
results from three independent cultures. 819
820
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
39
TABLE 1. Bacterial strains and plasmids used in this study. 821
Strain or plasmid Relevant characteristic(s)a Source or
reference
Strains
S. mutans UA159 Wild-type reference strain
Lab stock
E. coli DH10B Host strain for cloning and plasmid production Lab stock
E. coli LMG194 Host strain for pBAD expression Invitrogen
E. coli XL10-Gold Host strain for site-directed mutagenesis Agilent
Technologies
ΔlexA mutant In-frame SMU.2027 deletion mutant derived from S. mutans
UA159; Spr
This study
UA159(pIB184) UA159 harbouring pIB184; Emr This study
ΔlexA::lexA A115D ΔlexA harbouring pVL6 chromosomally integrated; Spr, Km
r This study
ΔlexA(pVL2) ΔlexA harbouring pVL2; Spr, Em
r This study
ΔlexA(pVL3) ΔlexA harbouring pVL3; Spr, Em
r This study
LMG194(pVL4) LMG194 containing pVL4; Kmr This study
LMG194(pVL5) LMG194 containing pVL5; Kmr This study
ΔumuC mutant In-frame SMU.403 deletion mutant derived from S. mutans
UA159; Emr
This study
ΔclpP mutant In-frame SMU.1672 deletion mutant derived from S. mutans
UA159; Emr
This study
∆comE mutant In-frame SMU.1917 deletion mutant derived from S. mutans
UA159; Emr
(25)
∆cipB mutant In-frame SMU.1914 deletion mutant derived from S. mutans
UA159; Emr
(25)
∆comS mutant In-frame comS deletion mutant derived from S. mutans UA159;
Emr
This study
∆comR mutant In-frame SMU.61 deletion mutant derived from S. mutans
UA159; Emr
D. Morrison,
UIC
∆sigX mutant In-frame SMU.1997 deletion mutant derived from S. mutans
UA159; Emr
(25)
ΔscrA mutant In-frame SMU.1841 deletion mutant derived from S. mutans
UA159; Emr
This study
Δcsn2 mutant In-frame SMU.1402 deletion mutant derived from S. mutans
UA159; Emr
This study
Δ63 mutant In-frame SMU.63 deletion mutant derived from S. mutans
UA159; Emr
This study
Δ984 mutant In-frame SMU.984 deletion mutant derived from S. mutans
UA159; Spr
This study
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
40
Plasmids
pBAD202/D-
TOPO
Expression vector linearized and topoisomerase-activated; Kmr Invitrogen
pIB184 Shuttle plasmid containing the constitutive P23 lactococcal
promoter; Emr
(35)
pIB107 Plasmid for chromosomal integration into S. mutans; Kmr (35)
pVL2 lexA cloned into pIB184 under its own promoter; Emr This study
pVL3 lexA A115D mutation into pVL2; Emr This study
pVL4 lexA cloned under the control of araBAD promoter into
pBAD202/D-TOPO vector; Kmr
This study
pVL5 lexA A115D mutation cloned under the control of araBAD
promoter into pBAD202/D-TOPO vector; Kmr
This study
pVL6 lexA A115D mutation cloned under its own promoter into
pIB107; Kmr
This study
a Em
r, erythromycin resistance; Km
r, kanamycin resistance; Sp
r, spectinomycin resistance. 822
823
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
41
TABLE 2. Effects of heat and DNA damage stresses on lexA (SMU.2027) gene expression. 824
Change in S. mutansa
Stress WT ∆lexA::lexA A115D ∆clpP
50C +2.84 0.55 +1.18 0.17¶ -1.31 0.14
¶
Antibiotic ofloxacin +5.22 3.03 +1.09 0.11¶ +1.29 0.45
¶
Hydrogen peroxide +5.04 3.93 +1.32 0.25¶ +1.28 0.54
¶
aQPCR was performed to analyse lexA gene expression. The expression is presented as the 825
average fold change standard deviation compared with lexA gene expression in the absence of 826
stress. Statistical significance was determined by using a Student’s t-test with the parametric P 827
value cutoff set at < 0.01 (¶, mutant versus WT). 828
829
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
42
TABLE 3. S. mutans cell survival towards different drugs. 830
Percentage of cell survival in S. mutans straina
Drugb WT(pIB184) ∆lexA(pIB184) ∆lexA(pVL3)
Ofloxacin 110 5.0 ( 10-3
) 30 20 ( 10-3
)¶ 4.8 1.2 ( 10
-3)
¶
Mitomycin C 67 1.0 ( 10-4
) 7 2.1 ( 10-4
)¶ 1.6 1.3 ( 10
-4)
¶
Oxacillin 2.2 1.0 1.6 0.8 1.6 0.7
aAliquots of cells were removed at the introduction of the drug and after the treatment (24 h) 831
to determine cell survival by spot plating onto THYE agar plates. The data are the averages 832
and standard errors of results from three independent cultures. Statistical significance was 833
determined by using a Student’s t-test with the parametric P value cutoff set at < 0.01 834
(¶, mutant versus WT(pIB184)). 835
bLethal concentrations of drugs were used. 836
837
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
43
TABLE 4. DNA microarray data obtained by comparing the expression profiles of WT strain 838
and ∆lexA mutant in the presence of the CSP pheromone 839
Locusa Common name, putative function
Fold changeb
∆lexA mutant
SMU.63 Conserved membrane protein –1.8
SMU.503 Hypothetical protein –1.5
SMU.563 ornithine carbamoyltransferase –1.7
SMU.663-666 Glutamate family amino acid synthesis
operon
–1.5
SMU.984 Hypothetical protein; CHAP domain
containing protein
–1.5
SMU.1402 CRISPR-associated (CAS) protein –1.5
SMU.1841 ScrA; sucrose –specific IIABC
component
–2.2
SMU.1907 Hypothetical protein; bacteriocin-related
genomic island
–1.7
aResults for selected genes were ordered based on their position in the UA159 840
chromosome. 841
bDifferential gene expression was based on a post-normalization cut-off ± ≥1.5-842
fold. 843
844
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
44
FIG. 1 845
846
847
848
4.07
1.08 0.96 0.83 0.82 0.71
0
1
2
3
4
5
6
UA159 ΔcomE ΔcipB ΔcomR ΔcomS ΔsigX
log
-fo
ld c
ha
ng
e in
cel
l su
rviv
al
(no
rmali
zed
to
no
CS
P p
re-s
tres
s)
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
45
FIG. 2 849
850
>ECOLI_LexA --------------------------------------------------MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKG 851 >LLACT_HdiR MNFGQNLKKLRKEAKLTQSQLADKLGMKQNAYVLWEQ-------KATNPTLELLE-KLADIYDLPIQELIK---NPDNGAEKQLID---------N-------- 852 >SMUTA_2027 MFSSQKLKERRKKLGLSQAQTADKLGISRPSYFNWEI-------GKTKPNQKNLD-KLAHLLKVDSA---------YFLSQHDIVE---------I-------- 853 >STAPH_REPR IIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLN-------LRSNPSHGVIQ-RIADVFEVGKSDIDT-----TYKDDNDITS---------I-------- 854 >SUBER_HDIR MFSGKQLKTIRQKHQMSQESLGQKLGVNKMTISNWEK-------GKNVPNQKHLN-QLLEIFHLDAD---------SFNPYQAIIL---------P-------- 855 >RSPHA_LexA ----------------------------------------------------MLTRKQMELLDFIKTRMDRDGVPPSFDEMKDALDLRSKSGIHRLITALEERG 856 >BLONG_LexA -------------------------------------MSTIPFSPKQKPDESTLTDRQRKVLDAIRTHIDEQGFAPSFREIGNAAGLKSPSSVKHQLQVLEDKG 857 858 >ECOLI_LexA VIEIVSGASRGIRLL------------------------------------------QEEE--EGLPLVGRVAAGEPLLAQQHIEGHYQVD-PSLFKPNADFLL 859 >LLACT_HdiR -------------YRSLTGEQQESVINFTDFLIEQNKADL---IDLKTY--------RRSSLQYAVVEDEALSAGFGQTANNTGG-HYRAY-TTENLGRYDGAA 860 >SMUTA_2027 -------------YTRLNESNKTKTLKYSQYLLEQQDKERNLM--------------KNKR--YPYRVYEKLSAGTGYSYFGDG--NFDTV-FYDEEIDHDFAS 861 >STAPH_REPR -------------YNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSY--------KQEK--TPVNVNGCVSAGVGERLHDET--LFTEM-VKGPIPTHDLAL 862 >SUBER_HDIR -------------YKQLTSLNQEKVVTYSKELLEEQNKIVQLS----QS--------QKKL--YVYRVYESLSAGTGFSYFGDG--NYDEV-FYDEQLDYDFAS 863 >RSPHA_LexA FIRRLAHRARAIEIVKLPEAMERAG--FSARAAK---------AAAAPLPKGAVTVETAGA--LDLPLMGRIAAGLPIEAINGGPQSVTVPGMMLSGRGQHYAL 864 >BLONG_LexA FIRMNANKGRAIEVVAGSAPNAEKPSQASEEATST-----SNVAEIYQFP----AEAIAES--HDVPLVGRIAAGVPITAEQHVDDVMRLP-ERLTGSGTLFML 865 ** 866 867 >ECOLI_LexA RVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARI----DDE-VTVKRLKKQGNKVELLPEN--SEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL---- 868 >LLACT_HdiR RVKGESMEPD-FPNFSIATFLHTGFGRSGDVYAIAEGDLGEERLYIKQVFEEEDGNFRIHSLNPDPQYKDFYLG-QEDNFRIIGPVVDNFEEIEESQIID 869 >SMUTA_2027 WIFGDSMEPI-FLNGEVALIKQTGFDYDGAIYAIDW----DGQTYIKKVYREETG-LRLVSLN--KKYADKFAP-YDENPRIIGLIVGNFIPLEG----- 870 >STAPH_REPR KVNGDSMEPM-FKDGEIIFVEKTHNIKNGQIGIFII----EEEAYVKKVFVEDDR-LTLVSLN--KDYDDLHFY-RNESVRLIGKVIL------------ 871 >SUBER_HDIR WVFGDSMEPT-YLNGEVVLIKQEGFDYDGAIYAVEW----DGQTYIKKVYREEDG-LRLVSLN--KKYSDKFAP-FDENPRIIGKIIANFMPLEV----- 872 >RSPHA_LexA EVKGDSMIAAGINDGDIVVIREQQTADNGDIVVALVA---DHE-ATLKRYRRRGGMIALEPAN--DSYETQVYP--EQMVKVQGRLVGLIRSY------- 873 >BLONG_LexA EVHGDSMVDAAICDGDYVVVREQNSAVNGDIVAALL----DDE-ATVKTFRKENGHVWLMPHN--PAYSPIDGT----HATIMGKVVTVLRKL------- 874 * * 875 876
877
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
46
FIG. 3 878
A) 879
880
B) 881
882
883
884
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
47
FIG. 4 885
886
887
888
889
6.77
0.74
2.36
0.85
2.29
1.38
2.42
2.76
0
1
2
3
4
5
6
7
8
9
10
UA159 ΔlexA
log
-fo
ld c
ha
ng
e in
cel
l su
rviv
al
(no
rmali
zed
to
no
CS
P p
re-s
tres
s)
Ofloxacin
Oxacillin
Rifampicin
Vancomycin
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
48
FIG. 5 890
891
892
893
894
0.0001
0.001
0.01
0.1
1
UA159 ΔlexA
TE
(%
)
No CSP
CSP
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from
49
FIG. 6 895
896
897
3.03 2.91
1.00 0.90
0.84
0
1
2
3
4
5
UA159 Δ63 Δ984 ΔscrA Δcsn2
log
-fo
ld c
ha
ng
e ce
ll s
urv
ival
(no
rmali
zed
to
no
CS
P p
re-s
tres
s)
on February 11, 2018 by guest
http://jb.asm.org/
Dow
nloaded from