EET Discover Arabia Brochure

Post on 17-Mar-2016

228 views 2 download

description

Product Guide for UAE, Oman and Arabian Gulf States

Transcript of EET Discover Arabia Brochure

  • Our ProductsHotels & Resorts, Receptive Services, MICE, Group Travel & More

    Our PledgePeace of mindfor Travel Partners

    What We OfferA Total DestinationManagement Solution

    UAE, Oman, Bahrain, Qatar & Kuwait

  • Priyantha AmarasingheGeneral Manager

    EET Destination Management

    Dmitry & Anait Arutyunov Directors of

    EET Destination Management & ART Tour

    Ahlan Wah Sahlan!

    EET Destination Management is a leading travel company with vast experience in recep-tive tourism, tour operations and MICE industry in the UAE, Oman and the Arabian Gulf states.

    Wholly-owned by ART Tour, an award-winning Russian tour operator and pioneers in luxu-ry travel, EET is a team of dedicated professionals experienced in handling visitors to this region for more than 20 years. Our guiding philosophy remains true to the core values and the vision of our parent company, thus our partners receive a fruitful collaboration with a professionally-run company that delivers what it promises.

    EET team is a creative and professional unit with a desire for long term relationships with their partners. We have the know-how and a network of suppliers throughout the region to support our partners under one roof.

    Our services include:

    Over500hotelsintheregionwithespeciallycontractednetratesforwholesaletour operators.

    UniformedWelcomeserviceatallairports/ports/borderpoints,hotelrepresenta-tions, sightseeing tours and excursions

    Experiencedteamofmulti-lingualReservationsExecutivesandTourconsultantstoprepareoffersandprovideinstantconfirmationofbookingsviaColumbusour own automated reservations system

    BrandnewandState-of-the-Artfleetofluxuryvehicleswithateamoftrainedanduniformed drivers

    In-houseonlineimmigrationsystemdirectlyconnectedwithgovtdepartmentstoissue tourist visas at short notice

    Welcomeinformationkitsforallvisitorsinmultiplelanguages

    Highqualitymulti-lingual sightseeing/excursionsprogramshighlighting a com-bination of modern developments in the region, tourist attractions, history, the traditional Arabian culture and heritage

    MICE(Meetings,Incentives,ConferenceandEvent)planningforArabia. EETEx-ecutivesofferfree,withno-obligationprogramproposalsandideasforincentiveitineraries and team building activities

    DesignSpecialInterestTourscoveringawidearrayofthemesincludingeduca-tional, cultural, historical, ethnological and geographical tourism interests of our clients.

    This publicationoutlinesonly a sample selectionof tour andhotel productsweoffer.Shouldyounotfindtherightproductyouarelookingfor,donotgiveup.Feelfreetodropus an email on incoming@eet.ae and let us know. Our resources and contacts are so di-verse, and there is nothing we cannot source for your exacting needs.

    EET Hotel Partners

    2

  • 3Hotel Type Key Hotel Ratings

    BeachResortWorldClassLuxuryHotelsor5-starratedHotelsandresortsofferinganexcellentaccommodation,extensiverangeofF&Boptionsandamenitiessupported by excellent service.

    Wellappointedaccommodation,agoodrangeoffacilities/amenitiesanda high standard of service level.

    Good tourist class standard accommodation with a reasonable range of facilities and services.

    Ratings are purely for reference purpose only and are combined with EETs own interpretation and official ratings.

    FamilyFriendly Kids Club

    CityHotel GroupFriendly MICE Venue

    Desert Resort Romantic Getaway EETBestSeller

    Deluxe

    FirstClass

    SuperiorTourist

    inDExIntroduction........................................................................................................................2Map of Arabia & The Middle East............................................................................4United Arab Emirates.....................................................................................................5UAE Things to do & see........................................................................................6-7Top 10 Reasons to book with EET......................................................................8-9

    Abu Dhabi Introduction.............................................................................................63Abu Dhabi Attractions............................................................................................64Abu Dhabi Hotels Beach Resorts...............................................................65-68Abu Dhabi Sir Bani Yas Island.............................................................................69Abu Dhabi Hotels City............................................................................................70Abu Dhabi Hotels Desert Resorts............................................................71-72

    Ras Al Khaimah Introduction..................................................................................79Ras Al Khaimah Hotels Beach & Desert Resorts................................80-84Fujairah Hotels Beach Resorts....................................................................85-86

    Destinations Qatar, Bahrain, Kuwait & Saudi Arabia...............................97Discover Arabia Tours.........................................................................................98-99

    Dubai Introduction.......................................................................................................10MICE Incentives & Team Building.............................................................11-13Golfing UAE..........................................................................................................14-15Arabian Heritage Experience..........................................................................16-17UAE & Oman Cruise Ship Hub in the Arabian Gulf..................................18Luxury Safaris with a difference...........................................................................19Dubai Hotels Palm Jumeirah.......................................................................20-28Dubai Hotels Jumeirah...................................................................................29-39Dubai Hotels Jebel Ali.....................................................................................40-41Dubai Hotels Jumeirah Beach Residence.............................................42-44Dubai Hotels New Downtown.....................................................................45-49Dubai Hotels Dubai Marina.................................................................................50Dubai Hotels City.............................................................................................51 -60Dubai Hotels Desert Resorts......................................................................61 -62

    Sharjah Introduction............................................................................................73-74Sharjah Hotels Beach Resorts.....................................................................75-76Ajman Hotels Beach Resorts........................................................................77-78

    Sultanate of Oman Introduction........................................................................87Sultanate of Oman Excursions & Tours..................................................88-90Muscat Hotels Beach Resorts......................................................................91-93Musandam Hotels Beach Resorts.....................................................................94Salalah Hotels Beach Resorts.............................................................................95Muscat Hotels City...................................................................................................96

  • 4MAP Of ARAbiA & MiDDlE EAST

  • 5TheUnitedArabEmirates(UAE)isaconstitutionalfed-erationofsevenemirates.FormallyestablishedinDecem-ber 1971, following an agreement between rulers of the seven emirates or sheikdoms to form a union, these emir-atesareAbuDhabi,Dubai,Sharjah,Ajman,UmmAlQuwain,RasAlKhaimah(whichjoinedtheunioninearly1972),andFujairah.

    TheUAEoccupiesanareaof83,600sq.km.alongthesoutheasterntipoftheArabianPeninsula.Qatarliestothewest, Saudi Arabia to the south and west, and Oman tothenorthandeast.Four-fifthsoftheUAEisdesert,yet itis a country of contrasting landscapes, from awe-inspiring dunes to rich oases, precipitous rocky mountains to fertile plains. The United Arab Emirates, one of the worlds fastest growing tourist destinations, has all the right ingredients for an unforgettable holiday, sun, sand, sea, sports, unbeat-able shopping, top-class hotels and restaurants, an intrigu-ing traditional culture, and a safe and welcoming environ-ment.

    The capital and the largest city of the federation, Abu Dhabi, is located in the emirate of the same name and is the seat of federal government. Neighbouring Dubai is consideredthecountryscommercialcapital.Sharjahisac-knowledged as the countrys cultural capital with its nu-merousmuseumsandheritagesites.Ajman,whichliesnexttoSharjah,isthesmallestemirateintermsofgeographicalterritory,whileUmmAlQuwainissituatedbetweenShar-jahtothesoutheastandRasAlKhaimahtothenortheast,along the coast of the Arabian Gulf. Unlike the other emir-ates,Fujairahisnestledbyroughmountains(Hajar)anda90kilometrecoastline(GulfofOman).RasAlKhaimah,onthe other hand, is endowed with scenic coasts, mountains, archaeological sites and agricultural lands.

    Endowed with rich natural resources, UAEs economy isdominatedbyoilexportsalthoughagrowingdiversifica-tion in the countrys economy has been evident in recent years. It has about 8% of the worlds proven oil reserves andhoststhefifthlargestnaturalgasreservesintheworld.The countrys impressive economic prosperity, coupled with a liberal business and social environment, ensures that people from nearly every country in the world will

    continue to come here to live, work and play.

    AsperUAEsofficialwebsite,thepopulationwas7.2millionattheendof2011andis estimated to reach 7.6 million in 2012. Of this, roughly 20 percent are estimated to be Emirati nationals with the rest accounted for mostly by Asian, African and European nationals.TheemiratesofAbuDhabiandDubaicompriseovertwo-thirds(67%)ofthecountrystotalpopulation.Thepopulationratioisalsosignificantlyskewedtowardstheurban zones, which host 82% of the countrys residents.

    UniTED ARAb EMiRATES

  • 6Ahundredandonethingstodocouldindeedbeanapt expression when you are in the UAE! This incred-ibledestinationoffersmyriadthingstodoforalltypesof travellers. You could be discovering ship wrecks in the ocean, riding up the worlds tallest tower, attend-ing a pop divas concert, trying your skills at belly and salsa dancing, or going to the theater, feasting on an mouth-wateringArabicbuffetinthedesert,ridecam-els or go swimming with the dolphins, a dinner cruise onanArabiandhow,goquadbikingordunebashingin the desert, exploring the nature and heritage sites, shopping, setting up a business, or even skiing yes, inthedesert!arejustsomeofthethingsyoucando.The list is endless. We have used this section to high-lightsomeoftheuniqueactivitiesourspecialistscan

    HalfandFulldayToursofModern&OldDubai

    AttheTopBurjKhalifa

    DesertsafarisSundowners,NatureDiscovery, Overnight camping & Adventure

    DhowCruising

    Aquaticthemeparks

    DolphinEncounters&ScubaDiving

    SeaPlanesightseeingflightsoverUAE

    HotAirBalloonFlights

    SkiDubai

    Mountains&WadiExplorations

    CapitalSightseeinginAbuDhabi

    HelicopterFlights

    help you plan and incorporate into your UAE itinerary.

    Whether you are stopping over on a transit, planning an escape from the everyday grind, or wondering how to make the most of a relaxing holiday, we can help you plan and make it memorable. You will cherish and remember your visit, long after it is over. Our tours and services include bespoke options to suit your re-quirementsbasedonthetypeofactivity,timeordate,choice of transportation and all other arrangements, which means you will never have to look at the clock or the calendar with anxiety. All we want is for you to enjoyeverymoment-fromtheminuteyoulandintheUAE, until it is time to bid goodbye.

    UAE - Things To Do & sEE

    A Choice of UAE Sightseeing, safaris & Experiences Yacht&Catamarancharters

    FerrariWorld&Waterworldthemeparks

    DesertResortsExperience

    BedouinHeritageTours

    Camel&HorseRacingTours

    EmptyQuarterSafarisLiwaDesert

    DiningExperiences

    PearlDiving&MuseumTours

    NorthernEmiratesofAjman,UmmAlQuwain&RasAlKhaimah

    SharjahHeritage,Arts&CultureTours

    EastCoastofUAE

    GardenCityofAlAin

    Contact res@eet.ae to request detailed tour descriptions or order bookings.

  • 7Areyouahistoryorculturebuff?WhynotbookanexperiencedtourguideforaHeritagewalkandtravelbackintimetoenjoytheatmosphereof one of the oldest traditional Emirati neighbourhoods in Dubai. Your walkincludesexploringtheareaonfootthroughtheuniquenarrowsik-kas and beautiful wind towers that adorn the original residences along the Dubais historic district along the Creek.

    AwalkthroughthehistoricdistrictandavisittotheDiwanMosque.GueststhenreturntoalocalhouseforaculturaldiscoveryQ&AsessionandwillbetreatedtoArabictea,coffeeanddates.ToursareheldeverySaturday.60minutestoursdonotincludeavisittothemosqueandareheldeverySundaythroughThursday.

    AwalkthroughthehistoricdistrictandavisittotheDiwanMosqueand Textile Souq.Guests thenboard an abra boat, and journey acrossDubaiCreektoDeiratovisittheGoldSoukandSpiceSouk.Gueststhenreturntothe localhouseforaculturaldiscoveryQ&AsessionandwillbetreatedtoArabictea,coffeeanddates.Thistourrequiresminimum5personsandbookedonspecialrequestonly.

    JoinusforatraditionalEmiratibreakfastorlunchattheSheikhMo-hammedCentreforCulturalUnderstandingintheambienceofourBasta-kiya house, a typical wind tower house in one of the oldest Emirati neigh-bourhoodsinBurDubai.Enjoyamealwithlocalflairwhilechattingwithan Emirati host about UAE culture, customs and religion.

    ThebeautifulJumeirahMosquehasbecomerenownedasthefocalpointofvisitorsasitistheonlymosqueinDubaiwhichisopentothepublicanddedicatedtoreceivingnon-Muslimguests.Comeandjoinauniqueopportunity to learnaboutEmirati cultureand religion ina re-laxed,casualandopenatmosphereatthislandmarkmosque.TheSheikhMohammed Centre for Cultural Understanding hosts visits of the Grand JumeirahMosque6daysaweekSaturdaythroughThursdayat10:00am.Modest dress is preferred, however traditional attire can be borrowed fromtheMosque.

    Acknowledgement:ThesetoursarehostedbyTheSheikhMohammedCentreforCulturalUnderstanding(SMCCU).SMCCUwasestablishedunderthepatronageofHisHighnesstheVicePresidentoftheUAE,SheikhMohammedbinRashidAlMaktoumin1998.LocatedinatraditionalWindTowerHouseintheheartofthehistoricAlFahidiDistrictinBurDubai,thecentreoffersarangeofenrichmentactivitiesthroughitsawardwinningprogrammes.OperatingunderthecentresphilosophyandmottoOpenDoors.OpenMinds.theSMCCUstrivestoraiseawarenessanddemystifythelocalculture,customsandreligionoftheUnitedArabEmirates.Withanoverallobjec-tive to improve cross-cultural understanding and communication between locals and guests, visiting and residing across the UAE, we invite you to learn more about the localcultureinDubai.OurspecialthankstoSMCCUforthiswonderfulinitiative.

    ExplorE UAEs CUlTUrAl hEriTAgE

    Heritage Walk Tours (60 or 90 minutes)

    Creekside Tour (120 minutes)

    A Meal with an Emirati

    Jumeirah Mosque Tour (75 minutes)

    best idea for Your Dubai Stay!Join these tours with a combined stay at one of the Arabian style

    traditional guest houses. See Pages 16-17

  • 8For more than 20 years we have built a reputation to safeguard the interests and trust with our industry partners and the clients alike, ensur-ing a high quality service.

    Wherever you are and whatever your travel needs, were there for you giv-ing you peace of mind and guaran-teed service.

    Our network of partnerships with hundreds of suppliers give you flex-ible options, access to the most com-petitive and up to date information and pricing for any product.

    We are a creative and professional unit always yearning to offer memo-rable value for money vacations and unique experiences.

    Our people are the biggest asset. Theyre hands-on professionals, carefully nurtured and trained to appreciate our core values and good work ethics. They place an emphasis on customer service a priority above everything else.

    When our clients arrive for vacations, we ensure that even the smallest of details are looked into and taken care of. We pay attention to detail when planning and preparing itineraries.

    Make all your enquiries/bookings for the Arabian Gulf region through one source, one contact that saves you time and money.

    In the receptive business in the region for more than 20 years! Our team brings over 100 years of cu-mulative experience working with the local and international tourist markets.

    We offer finest quality and latest model luxury vehicles to ensure max-imum enjoyment, ultimate comfort and safety for our clients.

    We enjoy what we do. And, we pass this happy culture to our clients when they visit us and help them take home happy memories and come back for more

    TOP 10 REASOnS TO bOOK WiTH EET

    REPUTATiOnbUilT On QUAliTY & TRUST

    gloBAl

    flExibiliTY &

    CREATiVE iDEAS

    DEDiCiATED AnD

    ATTEnTiOn

    OnE-STOP-SHOP

    KnOW-HOW Of THE bUSinESS

    STATE Of THE ART fACiliTiES

    PARTnERSHiP

    ExClUsiVE priCing

    AnD COnSTAnT innOVATiOn

    KnoWlEgABlE TEAM

    TO DETAil

    fOR All YOUR nEEDS

    ExPERiEnCE

    & EQUiPMEnT

    1

    3

    5

    7

    9

    2

    4

    6

    8

    10SERViCEWiTH A SMilE

  • 9We were welcomed by a friendly repre-sentative who presented us with a lovely welcome kit and plenty of suggestions and clear information about dos donts. The drivers and guides on our holiday were exceptional and professional. Hotels we stayed in Dubai were excellent.

    A.R. from Moscow Russia

    My travel agent contacted EET for my travel itiner-ary in the Arabian Gulf. EETs itinerary visiting UAE, Oman, Bahrain, Qatar and Saudi Arabia, not only offered exactly what I had in mind but offered won-derful suggestions that I never thought possible. Once booked, everything including visa arrange-ments for all countries worked clockwise all hotels were first class and drivers/guides in every country were extremely knowledgeable.

    S.W. from Toronto, CanadaMy wife and I had a long list for shopping in Dubai. We asked an EET guide to help us find the shops. She had the most up to date list with all relevant informa-tion and tips. We did our shopping without wasting time and had plenty of time to see Dubais moderns marvels. Thank you for the wonderful service

    H. T. from new Delhi, india

    TAKing CArE of YoUr BUsinEssfor our entire team at EET, taking care of your business is our business. Thats all we do. And, we try hard and

    do the extra mile to ensure that your clients get to explore the very essence of travel to Arabia, take home won-derful memories and come back for more. look what some of our past travelers had to say about our work.

    Always standby our travel partners, giving you peace of mind

    Providing you with what we promise and strive for more

    Safety first, on time and in comfort Always prepared and ready to serve You can always reach us. Available

    24/7 Book and arrive with confidence

  • 10

    Dubai is auniqueplace that isbothadynamicbusinesscentreandatouristparadise,offeringmoreattractions,shopping,finediningandqualityhotels.Fromthetimelesstranquilityofthedeserttothelive-lybustleofthesouks,Dubaioffersakaleidoscopeofattractions for visitors. In a single day, the visitor can experience everything from rugged mountains and awe-inspiring sand dunes to sandy beaches and lush green parks, from dusty villages to luxurious residen-tial districts and from ancient houses with wind tow-ers to ultra-modern shopping malls.

    SituatedhalfwaybetweenEuropeandAsia, fewdestinationstakemorethan8hoursdirectflyingtimeto or from Dubai.

    Dubaioffersarangeofhotelstosuiteverytaste,whim and budget! From the glitzy, opulent and ofthe most expensive and only seven star hotel in the worldallthewaythroughtotheveryaffordable.Thenthere are the resorts in the desert where tourists can experienceunmatchedpeaceandtranquility.

    Dubai is ranked the worlds second most popular destinationforshoppingaftertheUnitedStatesandaheadofpopulardestinationslikeSingapore,France,UK,andHongKongamongothers.Withalonghisto-ry as a trading hub, today Dubai is synonymous with shopping.Fromsouktoshoppingmall,Dubaihas itall - duty free, gold, electronics, textiles, cars - and is a true shoppers paradise. Perfect for the shop-o-holics and for retail therapy!

    Dubaihasestablisheditselfasamajordestina-tion for an eclectic array of local and international events and earned its reputation as the sporting cap-ital of the Middle East. Throughout the year, Dubai hosts a range of popular annual sporting activities, dazzling entertainment attractions, as well as confer-ences and exhibitions.

    Dubaihasalivelynightlife.Hotelbarsrangefromsophisticated cocktail lounges to typically informal British and Irish pubs and Western-style lounges.Most of them serve food and many feature pianists,

    guitarists, duos and bands nightly. After-dinner revel-erscanenjoythelatestsoundsinanumberofhotelnightclubs, each with its own ambience.

    Although the early history of Dubai is not very well documented, archaeological discoveries suggest that,aslongas4000yearsagosmallfishingcommu-nities lived along the coast of the Arabian Gulf on the site of modern Dubai. In recent years, archaeologists have unearthed hundreds of artifacts that point to civilized settlements dating back to the third millen-niumB.C.Thesehistoricfindingshavebeencareful-ly preserved and the artifacts are now permanently housed in the archaeological section of Dubai Mu-seum. Dotted around Dubai are a number of historic buildingsandsitesthatofferaglimpseofabygoneerasuchastheAlFahidiFort,SheikhSaeedsHouse,andtheBastakiya.

    DUBAi - ThE CroWn JEWEl of ThE ArABiAn gUlf

  • 11

    EET is a leading MICE provider in the Arabian Gulf and we are specialized in the sourcing, planning and delivery of incentive travel programs, management of conferences, events, sports events and DMC services. Our customers are governmental entities, corporate companies, incentive houses, associations, PCOs and sports event agencies.

    We have international experience, are intimately familiar with the UAE and the region and possess the contacts, resources andlocalinfluencetoaccomplishyourgoals,whileprovidingyour guests with an exceptional experience.

    To service a client excellently, means to be aware of their surroundings, understand their business, and understand their culture. With our MICE team we have the knowledge and the expertise to accomplish all three.

    Whether youre planning a day-long meeting, a week-long incentive itinerary for 100, or something in between, our experienced planners are eager to provide you with all of the guidance and support necessary to develop and execute a seamless event. Our one-stop conference and event planning service has a reputation for producing amazingeventstailoredtotheuniqueneedsofeachclient.HereisasamplingofalonglistofideasforIncentivesandTeamBuildingActivities.

    DesertAdventures

    CamelPolo

    SportingActivitiesGolf,BeachVolleyball,

    BeachOlympics

    BeyondtheBorders

    TreasureHunts

    Shoppingsafari

    Dine-a-roundprograms

    Rub&WrapCulture

    InsearchofBlackGold

    DesertConventions

    BedouinTraditions

    NatureTrailDiscoveries

    PearlDiving

    DhowCruising

    TeamBuildingintheDesertScavengerHunts

    AmazingRace

    Falconry

    HotAirBalloonadventures

    DesertDuneBuggyRacing

    Skydiving

    DesertrunsandMarathons

    DesertTreksoncamel

    SandBoarding

    CanoeingandKayaking

    Kitesurfing

    RubAlKhaliEmptyQuarterDesertAdventures

    MusandamPeninsulafjordscruising

    CorporateGolftournaments

    MiCE - inCEnTiVEs & TEAM BUilDing

    looking for more details on these unique ideas and RfP for your upcoming incentive project? Drop us a line on mice@eet.ae for a prompt, free and no-obligation proposal

    from one of our dedicated Project Managers.

  • 12

    5-DAY DUBAi inCEnTiVE iTinErArY - for sEnior MAnAgErs/ExECUTiVEs ArrivalattheDubaiInternationalAirport.VIPMeetandGreetServicesbyEETWelcomeservice.

    Guestswillbewelcomedoutsidetheaircraftandescortedthroughimmigration,baggageclaimandtolimousinetransfer.GuestsarrivingonbusinessorfirstclassfromanEmiratesflightwillhaveadedicatedbelttocollecttheirluggage.SpecialwelcomeandVIPCheckinathotel.

    Morning-HalfDayCityTour.Takeascenictourofthecityinaluxuryprivatevehicle.Rangingfromthecitys rich historical sites to its new dynamic cosmopolitan architecture be prepared to be wowed by thisvibrantevolvingcity.DubaiMuseumattheAlFahidiFort,whichwaserectedaround1787todefendthecityagainstinvasion,offersafascinatinginsightintotherichhistoryandculturalheritageofthecity. Renovated in 1971 for use as museum, its colorful life size dioramas vividly depict everyday life in the days before the discovery of oil. Galleries recreate scenes from the Creek, traditional Arab houses, mosques,thesouk,datefarmsanddesertandmarinelife.

    Afternoon-PrivateShopperWafiShoppingMallandFashionAvenueinDubaiMallAprivateshoppingassistantwillescortyouthroughthevariousbrandeddesignerboutiquesinWafiShoppingMallandDubaiMallFashionAvenueandwillbeabletosetupaprivateviewingfornewclothingcollectionsandjewelry.

    EveningDineina3StarMichelinRestaurant-ReflectsbyPierreGagnaireinIntercontinentalFestivalCity.

    VisitthemosticonicstructuresandlandmarksofDubai

    BurjKhalifa-Witnessoneoftheworldstallestman-madestructureeverbuilt,at828mandgettothetopfor one of the most spectacular views of the Emirate.

    Afternoon-DubaiWorldIslandPrivateLunchEmbarkonayachtinDubaiMarinaandreachanexclusivedestination for a private lunch on the beach.

    BurjAlArab-EnjoythelateafternooninstyleandsamplethemostrefinedafternoonteainoneoftheBurjAl Arab salons.

    FinishoffyourdaywitharelaxingtreatmentintheSpaoverlookingtheshoresoftheArabianGulfSea.

    Evening-CocktailsinNeos,TheAddressDowntown

    Morning-AerialCityTourAseaplanetouroffersyoutheopportunitytotakeanaerialsightseeingtourofDubaiinaCessna208Caravanamphibianaircraft.TheWorldIslands,PalmIslands,JumeirahBeach,Dubailand,SportsCity,BurjAlArab,DowntownDubai,BurjKhalifa,MaritimeCity,PortRashidandFestivalCityareonlysomeofthepopularsightsyoumayseeonthisscenicflight.

    Afternoon-SwimwiththeDolphinsHaveaone-on-oneencounterwithDolphinsintheAtlantisAquaventurewaterparkanddiscoverthesecretsofanimalcommunication.OrCarRacingattheDubaiAutodromeChallengeyourselfbydrivingthefastestcarsfromLamborghinitoFerrariormaybethelatestAudi R8 model.

    Evening-DinneronTheDubaiCreek.CruiseDubaiCreektheParisianway,inBateauxDubai,amodernwater vessel.

    Departure.LimousinetransfertoDubaiInternationalAirport.

    Enjoytheplethoraofshoppingopportunitiesandamazingdealsataward-winningDubaiDutyFree.

    Day 1

    Day 2

    Day 3

    Day 4

    Day5

    MiCE - inCEnTiVEs & TEAM BUilDing

  • 13

    5-DAY DUBAi ADVEnTUrE inCEnTiVE - for ThE YoUng & YoUng AT hEArT

    Conference & Event Planning

    ArrivalattheDubaiInternationalAirport.Uponarrival,friendlywelcometeamfromEETDestinationManagement will meet you and guide you through passport control and baggage belts where you will assistedbyporterstohelploadpersonalbaggage.Finallyyouwillbeguidedtothecoachestobetakentothe hotel.

    Morning-SwimmingwithSharksintheDubaiMallAquarium Afternoon-DesertSafariActivities:4WDDuneBashing,SandSkiing/Boarding,QuadBiking Evening-DesertSafaricontinueswitha1001ArabianNightsDesertCampDinner Morning&Afternoon-DeepSeaFishingTrip Evening-DinnerinAlHadeerahrestaurantattheBabAlShamsDesertResort Morning&Afternoon-SafaritoHatta.DiscovertheWadisandmountainrangeoftheUAE Evening-PlayCamelPolo-ThegentlemansgamewithanArabicflavour Departure.LimousinetransfertoDubaiInternationalAirport. Enjoytheplethoraofshoppingopportunitiesandamazingdealsataward-winningDubaiDutyfree.

    Day 1

    Day 2

    Day 3

    Day 4

    Day5

    If you are a congress planner, hold your conference in Dubai and you are guaranteed a smooth, a wellplannedandanaffordableevent.Dubaicelebratesbeingthehuboftheworld,accessibletoall6continentsviadirectflights,unparalleled infrastructure, a culture rich inhistory setagainstamoderncosmopolitan city.

    Hosttomajorsportingchampionships,festivals,concerts,andseveralcity-wideconferencesuchastheInternationalMonetaryFund(IMF)andtheWorldDentalFederation(FDI),Dubaihasprovenexpertiseinstagingthesemajoreventswhichseeourinfrastructureandeventvenuesatfullcapacity,whichatteststothecityscollaborationandskillatholdingmajorevents.

    EETteamworksalongsidetheDubaiConventionBureau(DCB)whichhasbeensuccessfullywinning,developing and promoting national and international meetings, conventions, and special events for Dubai.

    MiCE - inCEnTiVEs & TEAM BUilDing

  • 14

    UAEisconsideredamajorgolfingdestinationbyinternationalgolf tour operators.

    Dubai undoubtedly leads the way with an impressive choice for the visiting golfer. Emirates Golf Club, Dubai Creek, The Montgom-erie Dubai, the Desert Course at the Arabian Ranches, the Jebel Ali ResortCourse,AlBadiaGolfResortatFestivalCityandtheNadAlShebaClubareallfirst-classcoursesthathavefirmlyestablishedtheregionasaworld-classgolfingdestination

    AmongotherEmiratesAbuDhabiisofferingfantasticopportu-nities for visitors. In 1989, .

    Dubaisportfolioofgolfingvenuesisabsolutelystunning.ThesignatureclubhouseattheEmiratesGolfClubmodeledonBed-ouin tents remains the most eye-catching in the region and the MajlisandWadicoursesutilizethenaturalrollingdesertterrainfora serious test.

    In2002,DubaiwasvotedtheBestEmergingGolfDestinationbytheInternationalAssociationofGolfTourOperators.Thequal-ity of the golf courses is on a par with the best in the world and the speedatwhichnewprojects areevolving it is clear that theregion is on a roll. Right now, the UAE is a fantastic destination for any golfer.

    golfing - UAE

    Abu Dhabi golf Club - Abu Dhabi

    The 18th hole at Abu Dhabi is a testing par-5 that sits under thewatchful eyeofthe iconic falcon shaped clubhouse. Water flankstherighthandsideofthehole,withbunkers and deep rough awaiting an ultra safe approach. A good drive gives you the option to have a go in two, but a layup is bynomeansstraightforward.Fairwaybun-kers lay in wait for anything other than a precisesecondshot.Ahugegreenrequiresanimmaculatetouchifyouaretowalkoffwith your head held high.

    Dubai Creak golf & Yacht Club, Dubai

    Thisisthefirstoftwoofthefinestconsecutive finishing holes you willfindanywhereintheworld.The17this not overly long, but the salty Creek is only a few feet off the fairwayon the left side and there is no real space to play safe to with the driver up the right. A long iron towards the bunker on the right is a sensible play from the tee for longer hitters, where amidtoshortironwillberequiredtofindtheslightlyelevatedgreen.

    The Els Club, Dubai

    Positioning your tee shot well is the key to having a chance to get your ap-proach shot close on this tough par-4. Thosewho are greedymayfind awaterygrave as water comes into play all the way up the right hand side of this hole. Though dont play too safe from the tee as two bunkers lie in wait for an aggressive tee shot, which may convince some to play a 3-woodorironoffthetee.Thewaterisstillin play for the second shot as the green slopes away from back to front, making this hole a formidable foe.

    Ask for especially contracted golf pricing for these courses.

  • 15

    golfing - UAE

    The Montgomerie Dubai, Dubai

    The most eye-catching feature of this delightful short hole is the hand shaped bun-ker guarding the front of the green, which makes for some tricky bunker shots if you dont take enough club from the tee and get caught in its fingers. Measuring only 168yards from the black pearl tees the green appears to be a generous target, so take a chance here and attack the flagatthisuniquepar-3.

    The Majlis Course at The Emirates golf Club, Dubai

    One of the most attractive par-fours on the course, the 8th hole retains much of the character of the desert.FromtheteethebackdropofthemagnificentDubaiMarinarevealsthe extent of Dubais development and growth over the past 10 years. The fairway curves to the right and rises sharply.. The guarded green is protected by well-positioned bun-kers and an undulating putting sur-face, wreaking havoc on an approach shots which are heavily influencedby the direction of the wind.

    saadiyat Beach golf Club, Abu Dhabi

    A drivable par 4 that re-quires the utmost accuracy,this classic risk reward hole de-signed by Gary Player teases thebrashintofiringstraightatthe green. However even theslightest deviation from dead centre will find some of thedeepest bunkers anywhere in golf. A series of pot bunkers also guard the rolling green and actasasignificantdeterrenttopulling the driver out from the tee.

    Yas links, Abu Dhabi

    Designer Kyle Phillips would say every hole at Yas Links is a signature hole, but since opening, the 3rd has been the most talked about and photographed hole. The first of eight coastline holes the fairwaybends left around the shoreline to a green tucked justbehindadune.Oftenplayinginto a head wind you have two choices; either take on the water and the bunkers on the inside of the dogleg or play safe to the right. An opening to the green framed by the right hand dune will accept a low running approach shot, but with bunkers guarding the right side of the green you need to be very accurate.

    for enquiries, golf packages and group proposals on UAE golf courses, email golf@eet.ae

  • 16

    EET Destination Management has pioneered a partnership with Heritage Collection Dubai, a chain of fully-restoredandconvertedArabianvillasandhomes.Theseuniquevenuescomefullyequippedwithmodernamenitiesofahotelandareidealforthosetravelerslookingforcost-effectivealternativetoaconventionalhotel stay.

    orient guest house is a traditional villa restored to its former glory,withelevenArabianstyledrooms,amajlis(lounge)offer-ing travelers the true taste of times gone by. The roof terrace andcourtyardsprovidetranquilspotsinwhichtorelaxanden-joy thepeaceful surroundings.Offers24hoursButlerService.It features a cozy Courtyard Cafe, serving International break-fast, light meals, snacks, tea/coffee and refreshing beveragesthroughouttheday.OrientGuestHousehasbeenactiveindif-ferent public events like painting exhibitions organized by local artists. The famous celebrities in the likes of Tom Cruise and dignitariesPrinceCharlesandPresidentGeorgeBushhad theprivilege to visit the house.

    Barjeel heritage guest house, a sanctuary from the hustle and bustle of the city, invites you to discover true Arabian hospitality with a modern twist. Overlooking the magnificentview of the Dubai Creek, relive history with scenesandflavoursof theoldcity.TheGuesthouse has spacious bedrooms with complete facilities, having a colorful courtyard with tradi-tional tent surrounded by seating and dining ar-eas.Thecozyaccommodationoffersgueststheopportunity to recreate life in Dubai as it was done indays goneby. BarjeelHeritageGuestHouse offers 24 hours Butler Service. It alsofeatures a traditional Arabic Restaurant, named BarjeelAlArabservingEmiratiandcuisines.Lo-catedintheheartofShindagaoverlookingtheDubaiCreekandnearBurDubaiBusStations,Barjeel Heritage Guest House is also a stonethrowawayfromtheHeritage&DivingVillage,SheikhSaeedHouse,OldSouk,ShoppingCen-ters,DubaiCreek,AbraStation(watertaxi).Itislocated close to the many souks where you can findexoticproduceandhandmadetrinkets totreasure.

    ArABiAn hEriTAgE ExpEriEnCE

  • 17

    Ahmedia heritage guest house is an impressive and inviting traditionalArabianGuestHousewithagrandeurentrancetothecourtyard,surroundedbydiningandseatingareas,with15spa-cious bedrooms overlooking the courtyards spread over three EmiratiHousesrestoredtoitsgloriouspast.Thelodgingplaceprovides guests an opportunity to discover the richness of an-cient Arab culture and traditional spice trading hub that is still thriving.Afterahecticday, guests can relaxatSunTerraceorenjoythetraditional(TurkishStyle)Hammamtorejuvenate.Ah-mediaHeritageGuestHouseoffersroundtheclockButlerSer-vice. Light snacks and soft beverages are also available all day at theCourtyardCafe.Located in theheartofAl-RasHeritageareaadjacenttoAl-AhmadiyaSchoolIslamicMuseumandHeri-tageHouse,theHouseisastonethrowawayfromthefamousSpiceMarket,GoldSouk,and theTraditionalCreeksidewatertaxi station.

    ArABiAn hEriTAgE ExpEriEnCE

    for enquiries and bookings, contact: incoming@eet.ae

  • 18

    UAE & oMAn - CrUising hUBs of ThE ArABiAn gUlfEET Cruise Ships department isa leadinggroundhandler forcruisecalls in theUAEandOman,offeringacompleterangeofhandling,shoreexcursionsandmanagementservices.Weofferahighqualityofservicecombinedwiththeutmostefficiencyandattentiontoeverydetailoftheoperation.

    Quality, Reliability & Value

    Creative shore excursions depicting rich ArabianHeritage,cultureanddiversifiedinterests of cruise travellers

    Professional, knowledgeable, multilingual tour guides in uniform

    Aluxuryvehiclesfleetdrivenbywell-trained, responsible drivers

    4WD vehicles for desert tours are driven by experienced, English speaking drivers inuniform.Thevehiclesareequippedwithmineralwater,tissues,firstaidkitandmobile phones

    Punctuality, safety and comfort for passengers

    Individual or private tours, golf bookings, diving packages etc.

    Liaison with local authorities for special opening of Museums etc.

    Pre & Post Tours Dubai, Abu Dhabi, Oman & bahrain

    EETholdscontractswithmorethan500hotels in the region with hotel allocation

    Welcome meet and assist service at the airports

    HotelVisitationsforinformationbriefings

    Escorted airport and port transfers by multilingual guides

    Optional Excursion packages

    Handlingofentryvisasandexitformalitieswith local Immigration authorities and Airlines

    Working with Cruise liners, local authorities

    EETShoreExcursionsManagercoordinateswith the shipping agent, port and the immigration authorities for a smooth and speedy handling of passengers

    Connect with tourism and others authorities for special welcome arrangementsatquayandforpassengerexchanges at airports.

    Welcome services with music and folkloric dancers,childrenwithflowersArabicCoffeeanddateservice,coldtowels,welcome kits and city maps, sale of local souvenirs etc.

  • 19

    DUbAi WilDlifE & nATURE COnSERVATiOn SAfARiSA desert safari is the number one activity all international guests must-do in a visit to Dubai. The romance of the desert conjures up imagesof the golden sands of Lawrence of Arabia, 1001 nights and the soft flames of an antique lampandagentlebonfirecastingawarmglowaroundBedouins.EETisofferingauniquebrandofluxurysafarisforthe lovers of Arabian heritage, nature and wildlife. These safaris offer a completely different feelwith a special emphasis placed on Dubais drive for the nature and wildlife conservation and its work on preserving the Arabian heritage. The trips are operated in collaboration with The Dubai Desert Conservation Reserve (DDCR)whichisUAEsfirstnationalparkcreatedfortheprotection of the endangered species and for the conservation of the natural desert habitat and heritage. Our guests get a rare opportunity to see

    upclosethefloraandfaunaofArabiawhilstlearningabout the local way of life.

    The adventures are conducted in the legendary MercedesG-Wagonsor1950sclassicopen-top Land Rovers to add the nostalgic touch to your desert adventure. Accompanied by expertdriver/naturalistguides,tripscomecompletewith a first class service at ourexclusive desert retreat on the grounds of a Dubai royal family, traditional entertainment, falconry displays, and delectable Emirati cuisine and ample time for authentic and close interactions with the localBedouins.

    Overnight Safari breakfast with a bedouin

    night Safari & Stargazing

    Dinner Safari

    falconry & Wildlife Safari

    The #1 ranked safari in Dubai on Tripadvisor with 95.5%rankingasExcellentand4.5%VeryGood

    An authentic Enjoy fascinating tales

    An interactive wildlife

    Take a step back

    Put on your night-vision binoculars

    desert experience. with a local Bedouin .

    and falcon experience

    in time 50 years.

    to explore the desertscape

  • ATlAnTiS THE PAlM, DUbAi

    20

    Atlantis,ThePalmisthefirstentertainmentresortdestinationintheregionandlocated at the centre of the crescent of iconic landmark The Palm Dubai. Opened inSeptember2008,thisuniqueocean-themedresortfeaturesavarietyofmarineandentertainmentattractions,aswellaswaterscapeamusementatAquaventureWaterpark, all within a 46 hectare site. It is home to one of the largest open-air marinehabitatsintheworld,withover65,000marineanimalsinlagoonsanddis-playsincludingTheLostChambersAquarium,amazeofunderwatercorridorsandpassagewaysprovidingajourneythroughancientAtlantis.Aquaventurefeatures18million litres of fresh water used to power thrilling waterslides, a 2.3 kilometre river ride with tidal waves and pools, water rapids and white water chargers. Dolphin Bay,theunparalleleddolphinconservationandeducationhabitat,wascreatedtoprovide guests a once in a lifetime opportunity to learn more about one of natures most graceful mammals.

    Eachofthe1,539guestroomsandsuitesintheRoyalTowersprovideprivatebalconies and views over The Palm or Arabian Gulf. Guests may choose from a vari-etyofaccommodationincludingtheindulgent:

    imperial Club-aresortwithinaresortwithover150roomsandsuites,exclu-sive services and private club lounge;

    Royal bridge Suite - spanning the Royal Towers, a private lift takes guests 22 storeys above Atlantis for heart-stopping views of The Palm, Dubai and the Arabian Gulf;

    Underwater Suites - Each three stories high with mesmerising views directly into The Ambassador Lagoon from the master bedroom, these two suites located within The Lost Chambers, Neptune and Poseidon create an illusion of being be-neath the sea whilst looking directly into the heart of Atlantis.

    Atlantis, The Palm is also known as the culinary destination in the region with a collection of world-renowned restaurants including Nobu, Ronda Locatelli and Ros-tang.Theresortboastsanimpressivecollectionofluxuryboutiquesandshopsaswell as extensive meeting and convention facilities.

    ShuiQiSpa&FitnessatAtlantiscapturestheimaginationandcuriosityofguestsand draws them into a haven of relaxation and well-being. Upon entering the two-storey2,400squaremetreSpaintheRoyalTowers,guestsaregreetedbyaserenewaterwalltobeginthejourneytorelaxation.ShuiQifurtheroffersfullsalonser-vices for his and hers beautifying sessions, and the menu is as extensive as it is en-duringwithofferingsrangingfromSpajourneystobodytherapies.

    Deluxe

    Guests of Atlantis get unlimited FREE access to The Lost Chambers

    Aquarium and Aquaventure Waterpark

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAH

  • OnE&OnlY THE PAlM

    21

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAH

    Sereneandexclusive,One&OnlyThePalmisabeachfrontoa-sis on the lushly landscaped private peninsula of the Palm Island crescent, embracing chic contemporary island-feel living amidst the cosmopolitan energy of Dubai. Rimmed with white sand beaches surrounded by immaculate gardens, intricate fountains and sparkling pools, this intimate boutique resort boasts privi-legedviewsofthesoaringNewDubaiskyline.BlendingMoorishand Andalusian architecture with Arabian chic interiors, accommo-dation is secluded in a residential environment within the tri-level ManorHouse,six lowriseMansionsandfourprivatebeachfrontVillas.Chicandrefined,One&OnlyThePalmbringsasophisticatedair of contemporary elegance to the bustle of Dubai.

    Accommodation: The exquisitely styled low rise Mansionsand beachfront Villas surrounding the main Manor House andpool. Vaulted spaces, rhythmic symmetry, expansive arched win-dowsanddecorativearabesqueflourishesdefinetheimpeccablyfurnished rooms and suites, all with outdoor terrace or balcony and some with a private pool. Inspired by Arabias rich history of design,finelywovenfabrics,intricatelycarveddarkwoodfurnish-ings and ornamental glassworks create a chic and thoroughly mod-ernenclave.Sumptuousbathroomsfeatureoversizedfreestandingbathtubsanddrenchingrainshowers,withthefinestinlaidmarblefromItalyandSpain.

    Restaurants & bars:Expansivefloor-to-ceilingwindowscreateadecidedlyelegantandinvitingambienceinZEST.Silverleafandcut-quartzcrystalaccentflourishesofArabiandesignastwolivecooking stations prepare Asian and Middle Eastern cuisines. Deep earthtones,richmarblefloorsandanintricatelypatternedcrystalceiling will provide an atmosphere of sophisticated romance for eveningdiningatSTAY,thesignaturerestaurantbythreeMichelinstar chef Yannick Allno. The chic, overwater 101 Dining Lounge andBarbringsasophisticatedvibetotheresortsexclusiveisland-feel atmosphere. Under sweeping white canopies, alfresco dining opens onto a fashionable chill-out lounge with seaside tables and bar.

    leisure facilities: With sublime perfection, One&Only Private Spaoffersrejuvenatingtreatmentsinnineprivatesuitessurround-ing a central courtyard and private lap pool. Wellness facilities in-cludeastate-of-the-artFitnessCentrewithKinesistrainingstations,tenniscourt,BastienGonzalezPedi:Mani:CureStudioandpamper-ing hair salon by Alexandre Zouari.

    Deluxe

  • 22

    JUMEiRAH ZAbEEl SARAY Deluxe

    InspiredbytheimperialpalacesoftheOttomanera,JumeirahZabeelSarayisafive-starluxuryhotelthatdoesabsolutelyeverythinginsuperbstyle.Fromitsex-clusive location on the west crescent of the iconic Palm Jumeirah to the truly spec-tacular lobby entrance, every detail inspires awe and delight. The resort is made up of 379 elegant guest rooms, with 26 lavish suites and 38 Royal Residences of-feringstunningoceanviews.LoseyourselfintheoutdoorinfinitypooloverlookingtheArabianGulf.Discoverawholenewwayofdiningat thehotelsmagnificentMehteran Theatre. And explore a world of treatments at the palatial Talise Ottoman Spa,hometo42treatmentrooms,eighthydrotherapyrooms,steamrooms,saunas,snowroomsandthreeTurkishhammams.Howeveryouspendyourtimeinthisho-tel, every moment is a pleasure.

    TherestaurantsatJumeirahZabeelSarayareknownfortheirlavish,spectacularsettings.Butequally impressiveisthevaluetheserestaurantsoffer.Theyincludethelaidback,beachsidecharmofPlaj,theultra-chicVodaBar,ortheMehteranThe-atre,whereyoucanwatchaliveperformancewhileenjoyingafinemealthefirstof its kind in Dubai.

    ForWeddingandMICEplanners,JumeirahZabeelSarayisthevenuetomakean impact. With its fabulous Ottoman Palace-inspired design, its truly one of a kind venue foranyevent, ameeting foradozenpeopleor themagnificentMehteranTheatre which can accommodate up to 600 guests.

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAH

  • 23

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAH

    fAiRMOnT THE PAlMFairmont The Palm, aptly named

    after the iconic Dubai Palm Jumeirah, is located on the worlds largest man made island shaped in the form of a palm tree. This beachside hotel show-cases unrivalled views of the Arabi-an Gulf and provides easy access to Dubais attractions, the Dubai Interna-tional Airport, some of the citys best shopping with the Mall of the Emir-ates, Marina Mall and the Dubai Mall, in addition to numerous golf courses.

    The hotel features 381 guest-rooms and suites, including two Presi-dential Suites and a Fairmont GoldLoungeandrooms,3,000squareme-tres of conference and meeting space and a full service business centre. Other facilities include a 450 metreprivate beach, beach club and four glistening pools, complete with ca-banas with butler service.

    Guests can indulge in pan Chi-nese cuisine at the signature restau-rant B, or experience the vibrantambience of the Brazilian restaurantFrevo. The elegant Flow Kitchen isthe perfect place for culinary delights from Europe, Middle East and Asia. SavorafternoonteainthecomfortofMashrabiya lounge or in the evening, headtoSeaGrillon25Restaurant&Lounge, watch the sunset and enjoythe spectacular Dubai Marinas sky-line, while sipping on one of our sig-nature beverages.

    Younger guests will be enter-tained in the Childrens activity centre while those young at heart can have anexhilaratingworkoutattheHealthClub or try some of the hotels water sports.Fortheultimateinrelaxation,unwind and find your energy at theWillow Stream Spa. Experience au-thentic treatments inspired by the cultural wonders of the region, in a peaceful haven where the design pays homage to the timeless dunes and rich marine environment of Arabia.

    AtFairmontThePalm,experiencethe true spirit of generosity at the vi-brant heart of Palm Jumeirah.

    Deluxe

  • KEMPinSKi HOTEl & RESiDEnCES PAlM JUMEiRAH

    24

    Deluxe

    Situatedon theman-made islandof Palm Jumeirah, theKempinskiHotel&Residencesboast strikingviewseitherover thePalmJumeirahlagoon and the Dubai skyline in the distance, or undisturbed views of the ArabianSea. This elegantbeachside setting is complementedwithfiveacresoflandscapedgardens,500metersofwhitesandyprivatebeach,a1,200sq.mfree-formoutdoorswimmingpoolincludingashadedareaforchildren,anextensivegymwithstate-of-the-artequipment,amagnificentpampering spa and a kids club and playground.

    244 spacious suites, penthouses and villas provide the lavish com-forts of well-appointed living rooms, dining areas, and fully equipped

    kitchens and are ideal for families. Each suite has plush furnishings, ex-quisitedcorinsoftbluesoropulentgold.

    Diningat thishotel isarguably thekingofall luxuriesandoffersatrulyuniquemedleyofdiningoptionstoteaseyourpalates.WhetheryouchoosetoexploreacontemporaryMediterraneanfeastatBrunelloRes-taurant,aseafoodfareattheBeachBBQorascintillatingcigarandcognaccomboattheKWestBar,youcanrestassuredthatyourtastebudsareinforquiteatreat.Ifyoucravesomethingalittleclosertohome,ourin-roomPalaceCeremonyofferingsareoftheultimateprivatediningindulgence.

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAH

  • RixOS THE PAlM DUbAi

    25

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAH

    Deluxe

    RixosThePalmDubaiisatopfive-starluxuryresorthotellocatedinthe Palm Jumeirah ideal for guests combining leisure, business and fam-ily holidayswith entertainment and activities, offeringmeeting venuesandbusinessservices.TheHotelfeatures231spaciousandcomfortablerooms and suites with sweeping views of Dubai.

    RixosRoyalSpaisaluxuryhealthandbeautycentre,offeringwaterrituals, massages, body therapies and skin care regimens derived from a globalmenuoftraditionalandcontemporarypractices.Spafacilitiesin-clude:Turkishbathwithtraditionalrelaxationlounge;Sauna,SteamRoom,HydroIndoorPool;andLuxuriousmassageroomsforcouples.

    Rixos ThePalmalsooffers a uniqueprogram for children. TheRixyClub is exclusively geared for all children with an experience that begins

    from the time they arrive at a special check-in desk at the Rixy Club Re-ceptionwithgiftsandpresentsawaitingthem.Theclubactivitiesinclude:Rixydisco,musicalgames;Kidscinema;Poolgames;Facepainting;trea-sure hunts; native American plays; Talent games and Magic school.

    Nestled in its private bay, Rixos The Palm beach is amongst the best in Dubai.Beachisdividedinto3themeareas:NarBeach(foractiveguests);SuiteBeachwithprivateCabanas;anda familybeach for familieswithchildren.

    The hotel also boasts several restaurants and bars including A La Turca analldaydiningrestaurant;LOlivoItalianRestaurant;SaltSeafoodrestaurant.Bibersushibar;NargileShishaLounge;HighlightsPoolBar;LaPatisserieIstanbulandachicWhiteXBeachbar&Lounge.

  • AnAnTARA DUbAi PAlM JUMEiRAH RESORT & SPA

    26

    Deluxe

    Anantara Dubai Palm Jumeirah Resort & Spaisaluxuriousfivestarresortlocatedonthecrescent of the iconic Palm Jumeirah. Comple-menting such a prestigious destination, resort facilities are designed with relaxation and luxu-riousindulgenceinmind,andculinaryjourneysare crafted from a focus on mouthwatering di-versity and impeccable tastes.

    A collection of 293 rooms and villas are clustered in units of four to eight to maximise privacy, with 126 of these featuring direct ac-cessto10,000squaremetresoflagoonpools.Guests desiring the ultimate private haven can choose aOneBedroomBeach Pool Villawithapersonal infinitypool, aOneBedroomOverWater Villa poised over the ocean, or a gener-ous Anantara Two Bedroom Beach Pool Villathatoffers thepinnacleof luxuryand is idealfor families and friends.

    Fordiningpleasure,thereisanalldaydin-ing restaurant, where classic Middle Eastern dishesarematchedbythefinestinternationalcuisine. Feast on flame grilled specialties oruniquelyvibrantAsiantastes. Enjoydeliciouspoolside refreshmentsandMediterraneanfla-vours in a stunning beachfront setting. Expe-rience the perfect meeting place at our lobby lounge, featuring a dedicated shisha deck.

    Step into the tranquil sanctuary of Anan-taraSpa,whereinnovativefacilitiesandanex-tensive treatment menu provide inspirational journeys. Experience ancient wellness tradi-tions from Arabia and across Asia, as well as advancedwesterntechniques.Putyourbeautyand well being in professional, intuitive hands, as we guide you on a revitalizing pathway that responds precisely to your individual needs.

    A diverse collection of meeting rooms and eventvenueswithflexiblelayoutoptionscaterfor intimate boardroom gatherings, elegant pri-vateparties,aswellasflawlessweddingsandgrand celebrations.

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAH

  • TiARA RESiDEnCE, PAlM JUMEiRAH

    27

    Tiara Residence is one of the firstluxury apartment complexes to open on the Palm Jumeirah. Tiara is a residential beach resort which features privately-owned apartments and has a private beach, a large outdoor pool, a gym and a sea-view bar.

    EET owns a modern two bed room fully furnished self-catering apartment at Tiara Residence which is ideal for small families with children. Bookings can bemade by our worldwide partners for short-term rentals. Pool and beach tow-els, once-a-week house-keeping, clean-ing and change of linen are available.

    The apartment has a private balcony overlooking the main frond of the Palm Jumeirah, a large separate living room, of-fice room and a fully equipped kitchen.Theapartmentisalsoequippedwithflat-screenTV,OPUSSmartHometechnology,a music system and three luxury bath-rooms.Freehigh-speedinternetandpri-vate parking for one car is available.

    Guests can shop at the Mall of Emir-ateswhichisa15-minutedrivefromTiaraResidence. Jumeirah Beach Residence,with its famous promenade, the Walk and restaurants is only 10 minutes by car.

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAHEET Exclusive

    Private Residence

  • SOfiTEl THE PAlM, DUbAi

    28

    DeluxeDiscover a captivating blend of splendor

    andtranquilityontheeastcrescentofDubaisextra-ordinary Palm Jumeirah. Unfolding lei-surelyalongthesandyshore,SofitelthePalmoffers stunning organic architecture and so-phisticated design along with an irresistible, mellow tropical spirit. The perfect mix of ele-gance and ease to soothe both mind and body.

    Delight in the airy, subtly energizing at-mosphere of 361 contemporary guest rooms and suites featuring balconies and gorgeous sea or Palm views. Ivory havens accented with oversized artwork and lively touches of fuch-siaorturquoise.Cabin-likebathroomsinexoticwood with stone tubs celebrate natural beauty and Polynesian inspiration. Glide through the sliding panels in your suite andbenefit fromthe attentions of a private butler. Indulge in pure luxury in the Palm suite, featuring 4 bed-rooms and a game room perfect for select get-togethers.Reserve theBeachVilla toenjoyaprivate pool and a rooftop terrace overlooking thesea.Forlengthystays,settleinto182resi-dences, magnificently furbished and offeringfull hotel services.

    Fordiningoptions,indoorsandout,exqui-sitely presented, thrilling cuisine from around theworldareofferedin9restaurants,barsandlounges.

    Unwind and daydream poolside surround-ed by rustling palm trees and linen parasols. Lounge on the beach, swim in the crystalline waters,andstrolldownthejettytotakeasun-set cruise. Enjoy tennis, water skiing, scuba-diving, and fishing.Work out in the state-of-the-artSoFitgym,whereapersonalcoachcanoffer tips to improve your routine, then relaxin the sauna or steam room. Receive unforget-tablepamperingat theSoSpa in28gracefulrooms, including 4 outdoor cabanas. Rejuve-natingmassages, the finest in French beautytreatments, a marvelous seawater pool, and separates his and her hair salons. The Palm kids club is a paradise for children, offeringfun and games and a specially conceived res-taurant.

    FortheMICEgroupsandmeetingplanners,hotelofferslargeorsmall-scalemeetingsandcelebrations in luxurious conference facilities. 4 meeting rooms and a 700 person ballroom with a carved wood ceiling that recall tradi-tional pirogues.

    Du

    BAI H

    oTE

    lS -

    THE

    PAlm

    Ju

    mEI

    rAH

  • bURJ Al ARAb

    29

    HO

    TEL

    NA

    ME

    DeluxeRising from the Arabian Gulf on an island 280 me-

    tres from the shores of the renowned Jumeirah beach and designed to resemble the graceful sails of an Ara-biandhow,BurjAlArabsoarstoaheightof321metres,dominating Dubais coastline.

    Burj Al Arab has long been recognized as one ofthefinesthotelsintheworldandofferstheultimateinluxury accommodation. The respect for privacy and the warmthandcordialityofBurjAlArabcolleaguesblendswith legendary service, guaranteeing the guest an un-forgettable stay.

    Burj Al Arabs architecturally innovative exteriorand truly exuberant interior come together to create the breathtaking entirety. Offering unparalleled stan-dards of comfort and service, the exclusive all-suite ho-tel trulyreflects thefinest that theworldhastooffer.Towering27double-height storeyshigh,BurjAlArabcomprisesofachoiceofOne,TwoandThreeBedroomDeluxe Suites; Panoramic and Club Suites; the Presi-dentialSuitesandthetwoRoyalSuitesthatextendoverthe25thfloor incorporatingunsurpassedattention todetail and unmatched opulence.

    For simply exceptional dining, there are nine sig-nature restaurants and bars, where dining is about far morethanfood.Hotelspecializesinbringingtogetherevery element to ensure your experience is exceptional. Soakupthevibrantatmosphereintheelegantspaces,dottedthroughBurjAlArabfromtheatriumallthewayto the skyline.While each restaurant is unique, eachshares the ability to create flavour combinations thatlingerinyourmindlongafterthemealisover.Fromau-thenticArabiccuisinetoFarEastAsianandModernEu-ropean dishes, the hotel has sourced ingredients from aroundtheglobetocreateadiningexperiencefit forthe worlds most luxurious hotel.

    The lavishly appointed banqueting venues andballroomatBurjAlArabhaveplayedhosttomanypres-tigiousgaladinners,banquetsandbusinessseminars.Burj Al Arab Spa offers a unique nature-based luxuryspatohelpyouunwind,encompassingafitnesscentreandanaquaretreat.

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • MADinAT JUMEiRAH

    30

    DeluxeMadinat Jumeirah - The Arabian Resort of Dubai, is a

    magnificenttributetoDubaisheritageandisstyledtore-semble an ancient citadel. This combination of authentic themeshascreatedadestinationofuniquequalitiesandoutstanding beauty. Madinat Jumeirah is a city of contrasts - from the sublimely relaxing to the vibrant and exotic. The resort is a re-creation of old Arabia and a place where his-toricbeautymeetsnewluxury.Twograndboutiquehotels,29courtyardsummerhouses,atraditionalsouk,TaliseSpa,44 world-class restaurants, bars and lounges, the regions leadingconferenceandbanquetingcentre,1.5kmprivatebeach and a host of water sports activities, unlimited recre-ationalfacilitiesandthesuperlativeTaliseFitness-allthis and more combine to make Madinat Jumeirah the most fascinating resort in the world.

    The Premium Leisure Club at Madinat Jumeirah resorts is a family oriented concept with an exclusive check-in and reception, a lounge area and spacious outdoor seating for the sole use of Premium Leisure Club guests. It offersadedicatedareaforchildrenwithentertainmentfa-cilities within a purpose-built playroom. The club provides personalized service through its specially trained team.

    Fortheconferenceandbanquetingorganizer,Madi-natJumeirahcomfortablyfulfilsthetechnological,ca-pacityandqualitycriteriaofalmostalleventrequire-ments. More importantly, it achieves this within a format whichisenticinglyuniquecapturingtheimaginationofallwho visit - inspiring the senses through a step back in time toaplaceofArabiandreams.FromlargeballroomstotheArena,a1,000seatamphitheatreandFortIsland-alltheconferenceandbanquetingoptionsofferveryhighqualityspaceswithflexibleplanningvariations,dependingonyour individual needs.

    Souk Madinat Jumeirah - Wander through the tradi-tional Arabian souk, past wind towers, lantern lit hallways and narrow waterways to discover the treasures hidden within. With specially selected shops, restaurants and bars to entertain throughout the day and into the night, enjoyunlimitedamusementatSoukMadinatJumeirah.

    Guests of Madinat Jumeirah Receive Complimentary access to Sinbads Kids Club and unlimited access to

    Wild Wadi Waterpark.

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • MinA A SAlAM Madinat Jumeirah

    31

    DeluxeA grand boutique hotel built

    in exquisite style, Mina A Salam isnestled on the shores of the Ara-bianGulf.Thisuniquehideawayof-fers you a window into a world rich in culture and faithful to time hon-oured traditions. 292 luxurious guest rooms provide a world of comfort, with private balconies of-fering views of the resort or the Arabian Gulf. All rooms feature sepa-rate walk-in rain showers, dressing area for added privacy, a generous loungearea,floortoceilingwindowsas well as complimentary internet access. D

    uBA

    I Ho

    TElS

    - Ju

    mEI

    rAH

  • Al QASR Madinat Jumeirah

    32

    DeluxeInArabicforThePalaceAlQasr

    is the focal point of Madinat Jumeirah, builtinthestyleofanexquisiteroyalsummerresidence.Asbefitsthestatusof the hotel, it is elevated above the rest of the resort and painted in lighter colours than its neighbours. Rooms and suites feature private balconies with views of the resort, separate dress-ing area, complimentary internet access, luxurious bathrooms with a large bath, walk-in rain shower and a lounge seat-ing area.

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • DAR Al MASYAf & MAlAKiYA VillAS Madinat Jumeirah

    33

    The spacious courtyard summer houses of Dar Al Masyaf and Malakiya Villas exude the lavishness one would expect of the re-splendent Madinat Jumeirah. The resort is cen-tred around a cluster of exclusive private vil-las available to guests, discreetly scattered throughout the beachside enclave and each with its own swimming pool. Guests can access the villas via the waterways in a dedicated abra, adding to the auspicious and secluded feel of these exclusive hideaways. Open court-yards with intricate Arabian details characterize these delightful spaces, perpetuating a sense of feeling entirely at ease.

    Deluxe

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • JUMEiRAH bEACH HOTEl

    34

    Deluxe

    With its striking wave-like design, this five-starresort is one of Dubais most instantly recognizable structures.TheJumeirahBeachHotelisequallyfamedfor its amazing value and sheer wealth of options to enjoyingastay.

    All the hotels 617 rooms, suites and villas are luxuriously furnished and provide spectacular views oftheArabianGulf.Andonceyouvefinishedtakingin the view, you can choose from the widest array of leisure facilities around, including a scuba diving cen-tre,fiveswimmingpools,SinbadsKidsClub,TheHubfor teens and complimentary, unlimited access to the Wild Wadi Water Park.

    Hoteloffersawidevarietyofsportandentertain-ment: aprivate sandybeachof900m,water sports,fitness center with rooms for fitness, yoga, karate,squashcourts,7outdoorlightedtenniscourtsandafull-service Talise spa.

    JumeirahBeachoffers16diningoptionsservinginternational cuisine including Lebanese, Argentin-ean and Italian. Many restaurants have a childrens menu. Drinks options include the rooftop lounge 360 andthehotelsswim-upbarOceanBlue.

    FortheMICEorganizer,JumeirahBeachHotelof-fers meeting rooms and event facilities every bit as impressive as its leisure amenities. Whether youre looking for the perfect venue for your corporate event,aninspirationalvenueforstafftrainingorteambuilding, or a magical wedding venue, the Jumeirah BeachHotelistheperfectchoice.

    All Guests receive FREE access to Wild Wadi Water Park during stay

    and FREE access to The HUB for teenagers

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • onE&onlY roYAl MirAgE, DUBAi

    35

    Deluxe

    One&Only Royal Mirage pays tribute to Arabian architecture and hospitality on a truly regal scale. Considered Dubais most stylish beach resort, it restsonakilometreofprivatecoastlinenestled in65acresoflandscapedgardens.OverlookingPalmIslandBay,theresortiscomposedofthreedistinctenvironmentseachflowingintothenextto ignitethesenses:ThePalace,ArabianCourtandResidence&Spa.

    The Palace is a domain where guests may wander amidst the abundant gardens or stroll amongst the meandering water features. All 231 superior roomsandsuitesreflectcontemporaryelegancewithanArabesquesenseofplace,offeringthelatestinmoderntechnologyandcomfort.Inall172deluxe rooms and suites at the Arabian Court the dramatic architecture creates symmetry, amidst a landscape of fountains, walkways and lush gar-dens. The Residence & Spa has 49 Prestige rooms and suites and is an in-timate sanctuary with private dining room and library for guests. It boasts a private pool with great beach access.

    At One&Only Royal Mirage, world-class chefs prepare classic cuisines of the Mediterranean, Morocco and the Middle East, with grills and succu-

    lent delicacies of the sea served alfresco beachside.

    TheHealth&BeautyInstitutelocatedintheResidence&SpaistheSpa,atraditionalOrientalHammam,HairSalonbyAlexandreZouariandFitnessCentre.WaterSportsofferedincludeSailing,kayaks,HobieCats,windsurfing, water-skiing, fishing, diving, snorkelling, temperature-con-trolledswimmingpoolsandanextensiveprivatebeach.LandSportsin-clude

    Land sports includefloodlit tennis courts, putting green, petanque,volleyballandbasketball. KidsOnlyThecluboffers imaginative fun forkids(4to11).Fullysupervisedactivitiesandmealsareallarranged.

    AtThePalace,theBallroomcatersforupto250guests,divisibleintothree sound-proof rooms, boardroom and conference rooms, all with au-dio-visual installationsandadedicatedBusinessCorner.At theArabianCourt,aspectacularoutdoorAmphitheatrecatersforupto350guestsforgaladinners,showsandproductlaunches.Ballroomforupto200diningguests,twomeetingroomsandatraditionalMajlisstylemeetinglounge.

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • THE RiTZ CARlTOn, DUbAi

    36

    DeluxeThe Ritz-Carlton, Dubai is a Mediterranean-style beach

    resort providing renowned Arabian hospitality in an exclu-sivesettingonavast350-acreestate,comprisingofmani-cured gardens and own private white sandy beach along Dubais famed Jumeirah beach. With its 148 rooms and suites having a view of the Arabian Gulf, the Ritz Carlton ser-vices and facilities include sophisticated dining venues of-feringworld-classcuisineinspiredfromtheexoticflavorsofAsia,Arabia,MediterraneanandLaBaieLoungeforstylishgatherings from noon to sunset; an extensive recreational facility includesaspaandfitnesscenter,beautifully land-scaped gardens with 5 swimming pools including a chil-drens pool with slide and a private beach.

    The guests of this unique luxury resort also enjoy allrooms and suites open onto private patios or balconies with direct views of the pool, the garden and Arabian Gulf, Ritz-Carltonsignaturelinensandfeatherbeds,47LCDTVsshowing a mix of local and international channels, an ex-tensive DVD library for the in-room player, 24-hour in-room dining In-room iron and ironing board, Laundry and valet services and more.

    FullserviceBalinese-themedSpawithninetreatmentrooms,plusJacuzzi,steamandsaunaandanextensivefit-nesscentreofferingpersonaltrainingandgroupclasses,aRitzKidsClubofferingdailychildrensactivitiesinasecureplayroom,fourfloodlittenniscourtsandtwoglass-backedsquashcourtsandabeautysaloncateringtobothmaleandfemale guests.

    TheRitz-Carlton,Dubaioffersstylish locations togiveyour festivities just the right ambience. From beachfrontwedding receptions and ceremonies to elegant soirees re-sorts sea-view terrace or luxury ballroom, the stylish event andwedding venuesoffer richdcor, stunning views andmenus individually prepared for every event to deliver a one-of-a-kind celebration.

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • lE ROYAl MRiDiEn bEACH RESORT & SPA

    37

    DeluxeOverlookingtheturquoisewatersofthe

    Arabian Gulf, Le Royal Mridien Beach Re-sort& Spa is a haven of calm amongst thediverse metropolis of Dubai. Whether visiting for business or leisure, or to explore the citys ample shopping opportunities, the elegant surroundings and amenities provide the per-fect base. Choose from the timeless elegance of the standard rooms and suites, the sophis-ticated superior deluxe, or the breathtaking settings of the Club Tower, where the latest in personalized technology awaits.

    The hotels 500 rooms and suites caterfor every type of traveler and with 13 inter-national restaurants and bars, the hotel of-fers guests the world on a plate. Whatever, or wherever you choose to eat, the food, service and ambience is always the product of pas-sion, care and imagination.

    Caracalla,thehotelsRomanthemedSpa&HealthClub, is the ideal retreat formindandbody.TheSpaalsoboastsfiveHammampools, sauna, steam room, Jacuzzi, state-of-the art gym. The pool and beach facilities are quite spectacular: 3 temperature controlledswimming pools, 200 m private beach, ten-nis, squash, water sports, supervised kidsClub with play area and daily activities. The Penguin Kids Club has long been a popular feature of the resort for children - as long as they are between the ages of four and twelve years.Foryourspecialevents,ourconferenceandbanquetingservicesprovideinternation-al expertise to guarantee a truly unforgetta-ble occasion.

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • 38

    TheWestinDubaiisaluxuriousfive-starresort,lo-cated on the pristine Jumeirah Beach shorelinewith500mofprivateBeachandwarmwatersoftheArabianGulf.

    Embracing Westins characteristics of personal, instinctive and renewal, the resorts 294 spacious roomsandsuites includeHeavenlyBeds, luxuriousbathroomsandhi-tech42LCDTVscreens,whilethesoothingHeavenlySpaandWestinWorkoutfitnesscentreprovidetotalrelaxationandrejuvenation.

    The resorts four themedrestaurantsofferawidechoice of dining options and extensive conference and banquetingfacilitiesmakeittheidealdestinationforweddings, gala dinners, meetings or incentives.

    THE WESTin DUbAi MinA SEYAHi bEACH RESORT & MARinA Deluxe

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • 39

    LeMridien Mina Seyahi Beach Resort andMari-na is a5 star resort seton500metresof the Jumei-rah coastline, curving alongside Dubais largest private whitesandbeach,andamagnificent238-berthmarina.With the focus on fun for the entire family, if you love a beachside vacation, this luxury beach resort in Dubai is for you.

    The boutique-styled luxury resort features 220guest rooms, with a choice of deluxe rooms and suites featuring modern dcor.

    The resorts Restaurants include some of the most populardiningoutletsinDubai.Abeachclub,fivetropi-cal outdoor pools, and the Penguin Club - a dedicated childrens play area, are added attractions for guests.

    Theprimelocationis justa10minutedriveawayfrom Championship golf courses, including the Emir-ates Golf Club. A wide range of superb water sports, including a choice of exciting sailing experiences are available at the resort itself.

    lE MRiDiEn MinA SEYAHi bEACH RESORT AnD MARinA Deluxe

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H

  • 40

    The award-winning Dubai beach resort destination, Jebel Ali Golf Re-sort,featurestwostrikingbeachhotels:thebeautifulPalmTreeCourtandtheoriginalJebelAliBeachHotel,whichwasrefurbished in2009alongwith a brand new Conference Centre.

    Located just15minutes fromDubaiMarina, this fabulousDubai re-sort features an 800-metre palm-lined private beach, lush gardens and 4 Swimmingpools,watersportsplus15restaurantsandbars.JebelAliisaplacewherean incredible rangeof facilitiesandservicesareoffered insynergy. A championship-standard 9-hole golf course and academy, luxu-ry 10-treatment room spa with associated wet spa facilities, horse riding stables,marina, seaplaneflights anddiving centre are just a fewof thespecialfacilitiesonoffer.Withawellestablishedcateringandbanqueting

    Situatedwithintheaward-winningJebelAliGolfResort, JAJebelAliBeachHotelisDubaisonlyfour-starall-inclusivebeachresortandoffersfriendly service with value for money beachfront accommodation. The 260 hotelroomsandsuitesarespreadacrossfivelevels,withstandingbalco-

    JA JEBEl Ali golf rEsorT

    JA JEbEl Ali bEACH HOTEl

    division, Jebel Ali Golf Resort can arrange catering in the desert or at any of the private garden and beach venues in the resort.

    For Golf lovers, the 9-hole, par 36, championship standard resortcourse is situated within the idyllic grounds of the resort. Designed by Pe-terHarradineandopenedin1998,thegolfcoursehashostedtheworldsbestplayersaspartoftheofficialcurtainraisertotheEuropeanPGATourevent,theDubaiDesertClassic.Eachholeisuniquelylandscapedwithex-otictrees,shrubsandoriginaldesertfloraandthegolfcoursealsofeaturesasaltwaterlakewhichcomesintoplayonfiveholes.Thewoodengazebos,views of the Arabian Gulf and peacocks which freely roam the fairways have added a special charm to this course that is a fair and exciting chal-lenge for golfers of all abilities.

    FirstClassnies and terraces overlooking the golf course, gardens, marina, beach and Arabian Gulf. A private beach, 2 temperature-controlled swimming pools and kids pool, 10 restaurants and bars plus a vast selection of leisure and sport facilities make this hotel a great Dubai beach holiday destination.

    Du

    BAI H

    oTE

    lS -

    JEBE

    l Al

    I

  • 41

    Asuperbfamilybeachholidaydestination,JAPalmTreeCourtisafive-starbeachresort within Dubais award-winning Jebel Ali Golf Resort. Dedicated to the pursuit of casual luxury, the resort is set amidst lush, tropical gardens with winding walkways, waterfallsandfish-filledstreamsjuststepsfromtheprivatebeachontheArabianGulf.3Temperature-controlledswimmingpools,15restaurantsandbarsplusavastselec-tion of leisure and sport facilities, including horse riding, mini golf and water sports, arealsoavailableforguestenjoyment.Guestscanchoosetostayonanall-inclusivebasis,whilefamilieswillappreciatethekidsgofreeoffer2dedicatedchildrensclubsand a creche.

    JA PAlM TREE COURT Deluxe

    Du

    BAI H

    oTE

    lS -

    JEBE

    l Al

    I

  • 42

    TheSheraton JumeirahBeachResort is locateddirectly on the white sands of the Arabian Golf, sur-rounded by landscaped gardens that boast more than 200 palm trees. Right next to the new shop-ping and dining district The Walk, just minutesaway from the world famous Emirates Golf Club and 15minutesawayfromthepopularMalloftheEmir-ates,SheratonJumeirahBeachResortisonly40kmfrom Dubai International Airport.

    The Resort offers 256 beautifully appointedguest rooms decorated in a fresh Mediterranean style. All rooms are equipped with the SheratonSweetSleeperBed, individually controlledair con-dition,interactiveTV,complimentaryteaandcoffeemaking facilities, hairdryer, in room safe and ironing facilities. Guests can use the complimentary shuttle service to selected shopping malls throughout their stayorenjoyarelaxingtimeatthetemperature-con-trolledfreshwaterpool.Forfamiliesandkids,Sher-aton Jumeirah Beach Resort offers a separate chil-drens pool and the Pirates Kids Club with program during the day in either the spacious indoor playing area or at the outdoor playground.

    TheResortsdiningfacilitiesofferawiderangeof internationalcuisine.Enjoyalldaydiningat thePalm Garden Restaurant with themed nights for din-ner.ThePeacockRestaurantoffersauthenticChinesecuisine while the Ciao Ristorante will inspire you withatraditionalItalianmenu.EnjoythebestLeba-nesegrillsandShishas intheAlHadiqaRestaurantorhaveasnackat theAzurePoolBar.Forchilloutafternoonsandupbeatnights,visitBlissLoungeorgo to your evening rendezvous in the stylish Moods Bar.TheLink@SheratonCafisacomfortableplaceto work, talk or relax with complimentary wireless Internet access as well as varied food and beverage options.

    THE SHERATOn JUMEiRAH bEACH RESORT Deluxe

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H B

    EAcH

    rES

    IDEn

    cE

  • 43

    HiltonDubaiJumeirahResort&Residenceistheperfectdestinationforboth business and leisure travellers. This property is ideally located on Ju-meirahbeachs goldenmile alongside the JumeirahBeachResidence andTheWalkofferingauniqueshoppinganddiningexperiencewithits1.75kmbeachfrontboulevardhousing350retailoutletsand45restaurants.

    The hotel is also minutes away from two of the citys largest malls, the in-door ski-slope, Emirates golf club, Wild Wadi Water Park, Internet City, Media City as well as the commercial area of Jebel Ali.

    With389 roomsandsuites themajorityofwhichoverlook thecrystalclearbluewatersoftheArabianGulf,TheHiltonDubaiJumeirahResortResi-dence has a warm and welcoming atmosphere. With a choice of 10 restau-rants and bars there are plenty of dining options to suit all tastes. Among these are two signature restaurants popular with Dubai residents and in-house guests alike: BiCE, the award-winning Italian restaurant and SouthAmericaninspiredPachangarestaurantfeaturingcuisinefromBrazil,Argen-tina and Mexico.

    TheSpa-ahavenofrelaxationandtranquilityoffersavarietyofluxuri-ous signature treatments, massages and facials. With six treatment rooms as wellassaunaandsteamareasitisadefinitemust-do.TheHiltonbyPre-corgymnasiumisfullyequippedwiththelatestcardiovascularandweightmachines as well as the Power plate dubbed by many to be the miracle ma-chine. The hotel is also a perfect destination for families with its Kidz Para-dise open daily from 9am to 7pm organizing daily activities for children aged 4-12 years.

    The nearby Hilton Residence is a 4* property offering 364 Studios ,2,3and4BedroomApartments,LoftApartmentsandPenthouseswithfullyequippedkitchenandwashingmachine,2privatediningoutlets,gymandswimming pool. Resort and Residence are connected by a bridge and guests of the residence have complimentary access to the private beach at the Re-sort .

    HilTOn DUbAi JUMEiRAH RESORT & RESiDEnCE Deluxe

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H B

    EAcH

    rES

    IDEn

    cE

  • JA OCEAn ViEW HOTEl

    44

    FirstClassAstheonlyfour-starbeachhotelonTheWalkatJumeirahBeachResi-

    denceinDubaiMarina,JAOceanViewHotelhasarelaxedholidayatmo-sphere ideal for young families and couples. All the 338 rooms and suites have sea views and balconies overlooking the Arabian Gulf and The Palm Jumeirah. Guests may choose a stay on breakfast or half board basis, while enjoyingfacilitieslikeaseaviewinfinityswimmingpool,6restaurantsandbars,aspa,salon,healthclub,gymnasium,158interconnectingroomsandfamily rooms, a kids club and childrens pool. The Jumeirah open beach, close to additional shopping and entertainment options, can be accessed directly from the hotels pool deck.

    Du

    BAI H

    oTE

    lS -

    Jum

    EIrA

    H B

    EAcH

    rES

    IDEn

    cE

  • ARMAni HOTEl DUbAi

    45

    Deluxe

    SoaringhighaboveDowntownDubai,theiconicBurjKhalifa, the worlds tallest tower, is home to the exclu-siveArmaniHotelDubai.Aglobaldesignfirst,thehotelhas been designed and developed by Giorgio Armani, andreflectsthepureelegance,simplicityandsophisti-catedcomfortthatdefinehissignaturestyle.ArmaniHo-tel Dubai is the realization of the designers long-held dream to bring his personal style to life in the most in-clusiveway,byofferinghiscustomersauniqueStaywithArmani experience. Every detail in the hotel bears the Armani signature, beginning with warm Italian-style hos-pitality and moving through to each individual design el-ementfromtheEramosastonefloorstozebrawoodpan-els, bespoke furnishings and personally designed hotel amenities.

    Sophisticatedcolors,cleanlinesanduniquetexturesblend together seamlessly with the towers stunning ar-chitecture and use of natural light to create an atmo-sphere of calm serenity where guests can retreat into a world of minimalist elegance.

    Nestled in the worlds tallest tower, occupying con-course level through to level 8 and levels 38 and 39, hoteloffers160Armanistyledeluxeroomsandawiderange of suites with sweeping views across the city and Arabian Gulf. With its own dedicated entrance, it is sit-uated within walking distance of The Dubai Mall, the worlds largest retail destination, set within the vibrant Downtown Dubai business and leisure district.

    Seven restaurants offer an exciting collection ofworld cuisine, from Japaneseand Indian toflavoursofthe Mediterranean and authentic Italian. The impressive culinaryoptionsreflectthecosmopolitannatureofthecity.

    For uniqueeventswith signature style and impec-cableservice,ArmaniHotelhasavenuetocomplementeveryoccasion.Fromhighprofilebusinessconferencesand closed door boardroom negotiations, to unforget-tableweddingcelebrationswithuniqueflair,acollectionof contemporary spaces are designed to offer flexibleyet sophisticated location solutions.

    Du

    BAI H

    oTE

    lS -

    nEW

    Do

    Wn

    ToW

    n

  • THE PAlACE DOWnTOWn DUbAi

    46

    Classical themes and Arabian tradition meet at The Palace Downtown. This hotel is the centerpieceof TheOld Town Island inDowntownBurjDubaisituatedbytheBurjKhalifaLake,nearBurjKhalifa,theworldstall-esttower.Thisluxurious5starhoteloffersprimeviewsoftheDubaiFoun-tainonthelake.ThehotelisdirectlyconnectedwiththeSoukAlBahar,amodernshoppingdestinationwithArabesquearchitecturalfeaturesandisin close proximity to The Dubai Mall, the largest shopping and entertain-ment destination in the Middle East.

    ThePalaceDowntownoffers242spaciousandluxuriousguestroomsand 81 suites boasting a captivating Middle Eastern theme. All guestrooms and suites are decorated with authentic Arabian interiors, including dark wood paneling and furnishings. All rooms have balconies with views over theBurjKhalifaLakeorTheOldTownIsland.ComplimentaryWirelessIn-ternet,flatscreenTVs,coffeemachines,24-hourcheckinfacilityandsafe-ty boxes are standard in all rooms and suites.

    The Palace Downtown Dubai hosts three international restaurants and stunning meetings and events facilities and a comprehensive business centre.OfferingOrientaltreatmentsinauniqueArabicdcor,TheSpaatthehotel offers relaxingexperienceswith its 2Oriental bathhouses, 4Monsoonshowers,2Hydrospabathtubswiththerapyjets,2steamrooms,6 treatment suites and a relaxation lounge. The hotels fully equippedHealthClubofferspersonaltrainingsessionsandalsofeaturesanoutdoortemperature controlled pool.

    Deluxe

    Du

    BAI H

    oTE

    lS -

    nEW

    Do

    Wn

    ToW

    n

  • THE ADDRESS DUbAi MAll

    47

    Deluxe

    TheAddressDubaiMallisapremiumhotelthatoffersauniqueblendoftraditionalArabianandcosmopolitanhospitality.Setamidstthechicanden-ergetic Downtown Dubai and linked to Dubai Mall, one of the largest shopping and entertainment destinations in the world, The Address Dubai Mall is a haven forbusinesstravellersandleisureguests. TheAddressDubaiMallredefineshospitalitystandardswithacomplete24-hourstaybenefitforguestsreserv-ing suites, innovative shopping services and convenient business amenities. Anexclusivepersonal fashionadvisorensuresapersonalizedstay. For littleguests,theQixKidsClubprovidesanentertainingambianceandfunactivities.

    Eachofthe245roomsandsuitesareappointedwithcontemporaryandrich interiors.Everyguest room isaccessorizedwithflatscreenTVs,compli-mentarywireless internetaccess, iPoddockingstations,gourmetcoffeeandteamachines,mini-barsandsafetyboxes.Locatedonthe15thfloor,theClubLoungepresentsaluxuryhotelexperiencewithculinaryofferingsthroughoutthe day.

    Afineselectionofinternationalcuisineisavailableatthefivecontempo-rary restaurantsand loungesof thehotel,eachofferingauniqueambience.With direct access from the Dubai Mall, the chic signature restaurant Ember offers contemporary Australian cuisinewith la cartemenus for lunch anddinner.SettobecomeoneofthebestArabicspecialtyrestaurantsinthecity,NA3NA3offersanauthenticexperienceofunsurpassedMiddleEasternhos-pitality.

    The poolside restaurant Cabana features international comfort food and refreshing beverages. The fashionable setting will attract Dubais young and trendy, with an alluring menu of exotic cocktails and upbeat music. The pre-mierlounge,Amatista,withitsdramaticfoyerentrance,offersarangeoftrade-markbeveragesandawidevarietyofCubanandSouthAmericancigars.KaratisasophisticatedLobbyLounge,idealforrelaxingandsocializing.Itsrefineddcor lulls guests to pause in its elegantly designed surroundings.

    TheSpaatTheAddressDubaiMall isa sanctuaryofcontemplationandtranquillityofferingworld-classexperiences.Hoteloffersextensivespaceformeetingsandevents.Thelargeballroomaccommodatesupto650guests,andcan be divided into three sections.

    Du

    BAI H

    oTE

    lS -

    nEW

    Do

    Wn

    ToW

    n

  • JUMEiRAH EMiRATES TOWERS

    48

    Jumeirah Emirates Towers is one of the most stunning archi-tectural highlights on the Dubai skyline. The spectacular views from the hotel itself are complemented by the stellar accommo-dationandbusinessservicesyoullfindwithin.

    JumeirahEmiratesTowers redefines thebusinesshotelex-perience;seamlesslycombininghightechnology,efficiencyandunparalleled luxury.Andwith itsuniqueandprestigiousshop-ping destination, The Boulevard, youll find shopping, diningand nightlife opportunities to rival any luxury destination in the world.

    The 400 spacious, beautifully appointed rooms and suites, paired with state-of-the-art meeting and business facilities, make Jumeirah Emirates Towers one of the most popular choices for the corporate traveller.

    Ontheculinaryfront,hotelboasts15worldclassrestaurantsandbarsservinginternationalcuisinefromSushitoBritishCui-sine,fromSteakhousetoFineDining.JumeirahEmira